Q7Z7G8 (VP13B_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 88.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Vacuolar protein sorting-associated protein 13B Alternative name(s): Cohen syndrome protein 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 4022 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May be involved in protein sorting in post Golgi membrane traffic By similarity. |
| Tissue specificity | Widely expressed. There is apparent differential expression of different transcripts. In fetal brain, lung, liver, and kidney, two transcripts of 2 and 5 kb are identified. These transcripts are also seen in all adult tissues analyzed. A larger transcript (12-14 kb) is expressed in prostate, testis, ovary, and colon in the adult. Expression is very low in adult brain tissue. Isoform 1 and isoform 2 are expressed in brain and retina. Isoform 2 is expressed ubiquitously. Ref.1 Ref.12 |
| Involvement in disease | Cohen syndrome (COH1) [MIM:216550]: A rare autosomal recessive disorder characterized by obesity, hypotonia, intellectual deficit, characteristic craniofacial dysmorphism and abnormalities of the hands and feet. Characteristic facial features include high-arched or wave-shaped eyelids, a short philtrum, thick hair and low hairline. |
| Sequence similarities | Belongs to the VPS13 family. |
| Sequence caution | The sequence BAC03664.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. Isoform 5: The sequence AAP41106.1 differs from that shown. Reason: erroneous termination (Stop codon at position 412) Isoform 5: The sequence BAA91275.1 differs from that shown. Reason: erroneous termination (Stop codon at position 412) |
Ontologies
| Keywords | |
|---|---|
| Biological process | Protein transport Transport |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Disease mutation Obesity |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | protein transport Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q7Z7G8-1) Also known as: 1A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q7Z7G8-2) Also known as: 2A; The sequence of this isoform differs from the canonical sequence as follows: 1386-1433: SLGEECWSLGQCGGVFLSCTDKLNRRTLLVRPISKQDPFSNCSGFFPS → RPGEGWQSGHFEGVFLQCKEKSV | ||||||
| Isoform 3 (identifier: Q7Z7G8-3) The sequence of this isoform differs from the canonical sequence as follows: 1386-1427: SLGEECWSLG...ISKQDPFSNC → RPGEGWQSGH...AMWRCLPFLY 1428-4022: Missing. | ||||||
| Isoform 4 (identifier: Q7Z7G8-4) The sequence of this isoform differs from the canonical sequence as follows: 839-863: GVKSKNPLPTLEGSIQNVELKYCST → EIGSCYVAQVDLELLASNDPPTSTS 864-4022: Missing. | ||||||
| Isoform 5 (identifier: Q7Z7G8-5) The sequence of this isoform differs from the canonical sequence as follows: 403-415: LTEMQVESSYYSP → VGLFSCCLYLYQL 416-4022: Missing. | ||||||
| Isoform 6 (identifier: Q7Z7G8-6) The sequence of this isoform differs from the canonical sequence as follows: 977-977: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 4022 | 4022 | Vacuolar protein sorting-associated protein 13B | PRO_0000065880 | |||||
Amino acid modifications | |||||||||
| Modified residue | 999 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 1002 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 403 – 415 | 13 | LTEMQ…SYYSP → VGLFSCCLYLYQL in isoform 5. | VSP_009404 | |||||
| Alternative sequence | 416 – 4022 | 3607 | Missing in isoform 5. | VSP_009405 | |||||
| Alternative sequence | 839 – 863 | 25 | GVKSK…KYCST → EIGSCYVAQVDLELLASNDP PTSTS in isoform 4. | VSP_009406 | |||||
| Alternative sequence | 864 – 4022 | 3159 | Missing in isoform 4. | VSP_009407 | |||||
| Alternative sequence | 977 | 1 | Missing in isoform 6. | VSP_039837 | |||||
| Alternative sequence | 1386 – 1433 | 48 | SLGEE…GFFPS → RPGEGWQSGHFEGVFLQCKE KSV in isoform 2. | VSP_009408 | |||||
| Alternative sequence | 1386 – 1427 | 42 | SLGEE…PFSNC → RPGEGWQSGHFEGVFLQCKE KSVPWGRVLVFGAMWRCLPF LY in isoform 3. | VSP_009409 | |||||
| Alternative sequence | 1428 – 4022 | 2595 | Missing in isoform 3. | VSP_009410 | |||||
| Natural variant | 829 | 1 | A → T. Ref.10 Corresponds to variant rs61753721 [ dbSNP | Ensembl ]. | VAR_058749 | |||||
| Natural variant | 866 | 1 | V → I. Ref.10 | VAR_058750 | |||||
| Natural variant | 1138 | 1 | P → L. Corresponds to variant rs35342235 [ dbSNP | Ensembl ]. | VAR_057750 | |||||
| Natural variant | 1494 | 1 | Missing in COH1. Ref.12 | VAR_058751 | |||||
| Natural variant | 1739 – 1744 | 6 | Missing in COH1. | VAR_058752 | |||||
| Natural variant | 1994 | 1 | I → V. Ref.10 | VAR_058753 | |||||
| Natural variant | 2193 | 1 | L → R in COH1; could be a rare polymorphism. Ref.1 | VAR_017759 | |||||
| Natural variant | 2341 | 1 | Y → C in COH1. Ref.8 | VAR_038422 | |||||
| Natural variant | 2584 | 1 | V → A. Corresponds to variant rs7833870 [ dbSNP | Ensembl ]. | VAR_057751 | |||||
| Natural variant | 2645 | 1 | G → D in COH1. Ref.8 | VAR_038423 | |||||
| Natural variant | 2773 | 1 | S → L in COH1. Ref.10 | VAR_058754 | |||||
| Natural variant | 2820 | 1 | I → T in COH1. Ref.9 | VAR_058755 | |||||
| Natural variant | 2822 | 1 | Y → C. Ref.10 | VAR_058756 | |||||
| Natural variant | 2993 | 1 | N → S in COH1. Ref.7 Corresponds to variant rs28940272 [ dbSNP | Ensembl ]. | VAR_038424 | |||||
| Natural variant | 3001 | 1 | L → V in a breast cancer sample; somatic mutation. Ref.11 | VAR_036325 | |||||
| Natural variant | 3142 | 1 | S → R. Ref.10 | VAR_058757 | |||||
| Natural variant | 3432 | 1 | G → R. Corresponds to variant rs6468694 [ dbSNP | Ensembl ]. | VAR_057752 | |||||
Experimental info | |||||||||
| Sequence conflict | 401 | 1 | F → S in BAA91275. Ref.3 | ||||||
| Sequence conflict | 544 | 1 | M → V in AAP41102. Ref.1 | ||||||
| Sequence conflict | 544 | 1 | M → V in AAP41103. Ref.1 | ||||||
| Sequence conflict | 544 | 1 | M → V in AAP41104. Ref.1 | ||||||
| Sequence conflict | 544 | 1 | M → V in AAP41105. Ref.1 | ||||||
| Sequence conflict | 544 | 1 | M → V in BAC03664. Ref.3 | ||||||
| Sequence conflict | 618 | 1 | D → N in AAP41102. Ref.1 | ||||||
| Sequence conflict | 618 | 1 | D → N in AAP41103. Ref.1 | ||||||
| Sequence conflict | 618 | 1 | D → N in AAP41104. Ref.1 | ||||||
| Sequence conflict | 618 | 1 | D → N in AAP41105. Ref.1 | ||||||
| Sequence conflict | 618 | 1 | D → N in BAC03664. Ref.3 | ||||||
| Sequence conflict | 1387 | 1 | L → H in AAP41102. Ref.1 | ||||||
| Sequence conflict | 1401 | 1 | F → I in AAP41102. Ref.1 | ||||||
| Sequence conflict | 1425 | 1 | S → R in AAP41102. Ref.1 | ||||||
| Sequence conflict | 1673 | 1 | A → D in AAP41102. Ref.1 | ||||||
| Sequence conflict | 1673 | 1 | A → D in AAP41103. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY223814 mRNA. Translation: AAP41102.1. AY223815 mRNA. Translation: AAP41103.1. AY223816 mRNA. Translation: AAP41104.1. AY223817 mRNA. Translation: AAP41105.1. AY223818 mRNA. Translation: AAP41106.1. Sequence problems. AJ608772 mRNA. Translation: CAE75584.1. AJ608773 mRNA. Translation: CAE75585.1. AK091431 mRNA. Translation: BAC03664.1. Different initiation. AK000590 mRNA. Translation: BAA91275.1. Sequence problems. AC018442 Genomic DNA. No translation available. AC023933 Genomic DNA. No translation available. AC026827 Genomic DNA. No translation available. AC104986 Genomic DNA. No translation available. AC105195 Genomic DNA. No translation available. AC105328 Genomic DNA. No translation available. AC107909 Genomic DNA. No translation available. AP004289 Genomic DNA. No translation available. AP004290 Genomic DNA. No translation available. AB011104 mRNA. Translation: BAA25458.1. |
| IPI | IPI00376436. IPI00376437. IPI00376439. IPI00420061. IPI00941724. IPI00970801. |
| PIR | T00070. |
| RefSeq | NP_056058.2. NM_015243.2. NP_060360.3. NM_017890.4. NP_689777.3. NM_152564.4. NP_858047.2. NM_181661.2. |
| UniGene | Hs.191540. |
3D structure databases | |
| ProteinModelPortal | Q7Z7G8. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q7Z7G8. 2 interactions. |
PTM databases | |
| PhosphoSite | Q7Z7G8. |
Polymorphism databases | |
| DMDM | 308153515. |
Proteomic databases | |
| PaxDb | Q7Z7G8. |
| PRIDE | Q7Z7G8. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000355155; ENSP00000347281; ENSG00000132549. ENST00000357162; ENSP00000349685; ENSG00000132549. ENST00000358544; ENSP00000351346; ENSG00000132549. ENST00000395996; ENSP00000379318; ENSG00000132549. ENST00000441350; ENSP00000398472; ENSG00000132549. ENST00000496144; ENSP00000430900; ENSG00000132549. |
| GeneID | 157680. |
| KEGG | hsa:157680. |
| UCSC | uc003yis.3. human. uc003yit.3. human. uc003yiu.1. human. uc003yiv.3. human. uc003yiw.3. human. |
Organism-specific databases | |
| CTD | 157680. |
| GeneCards | GC08P100095. |
| HGNC | HGNC:2183. VPS13B. |
| HPA | HPA028146. |
| MIM | 216550. phenotype. 607817. gene. |
| neXtProt | NX_Q7Z7G8. |
| Orphanet | 193. Cohen syndrome. 217315. Cutis verticis gyrata - retinitis pigmentosa - sensorineural deafness. |
| PharmGKB | PA26699. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG5043. |
| HOVERGEN | HBG094148. |
| InParanoid | Q7Z7G8. |
| OMA | VFISKFT. |
| PhylomeDB | Q7Z7G8. |
Gene expression databases | |
| ArrayExpress | Q7Z7G8. |
| Bgee | Q7Z7G8. |
| Genevestigator | Q7Z7G8. |
| GermOnline | ENSG00000132549. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR015412. Autophagy-rel_C. IPR026847. VPS13. IPR026854. VPS13A_N. IPR009543. VPSAP_dom. [Graphical view] |
| PANTHER | PTHR16166. PTHR16166. 1 hit. |
| Pfam | PF09333. ATG_C. 1 hit. PF12624. Chorein_N. 1 hit. PF06650. DUF1162. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | VPS13B. human. |
| GenomeRNAi | 157680. |
| NextBio | 87507. |
| SOURCE | Search... |
Entry information
| Entry name | VP13B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q7Z7G8 Secondary accession number(s): C9JD30 Q9Y4E7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
