Q7Z7D3 Q0GN76 Q45VN0 Q5WPZ3 Q6P097 Q9H6B2 VTCN1_HUMAN V-set domain-containing T-cell activation inhibitor 1 B7h.5 Immune costimulatory protein B7-H4 Protein B7S1 T-cell costimulatory molecule B7x VTCN1 B7H4 UNQ659/PRO1291 Homo sapiens Human Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo B7-H4, a molecule of the B7 family, negatively regulates T cell immunity. NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1) SUBCELLULAR LOCATION TISSUE SPECIFICITY Placenta B7x: a widely expressed B7 family member that inhibits T cell activation. NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1) B7-H3 and B7-H4 expression in non-small-cell lung cancer. NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2) SUBCELLULAR LOCATION TISSUE SPECIFICITY A new splice variant of B7-H4. NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3) The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1) Complete sequencing and characterization of 21,243 full-length human cDNAs. NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4) Kidney epithelium Thymus The DNA sequence and biological annotation of human chromosome 1. NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4) Brain Prostate NUCLEOTIDE SEQUENCE [MRNA] OF 1-167 (ISOFORM 1) Peripheral blood Genomic organization and expression analysis of B7-H4, an immune inhibitory molecule of the B7 family. ALTERNATIVE SPLICING TISSUE SPECIFICITY The immunomodulatory protein B7-H4 is overexpressed in breast and ovarian cancers and promotes epithelial cell transformation. FUNCTION SUBCELLULAR LOCATION TISSUE SPECIFICITY GLYCOSYLATION B7-H4 expression identifies a novel suppressive macrophage population in human ovarian carcinoma. FUNCTION TISSUE SPECIFICITY INDUCTION Induction of B7-H4 on APCs through IL-10: novel suppressive mode for regulatory T cells. INDUCTION B7-H4 expression in renal cell carcinoma and tumor vasculature: associations with cancer progression and survival. TISSUE SPECIFICITY USE AS A MARKER FOR RENAL CELL CANCER Relationship between B7-H4, regulatory T cells, and patient outcome in human ovarian carcinoma. FUNCTION INDUCTION B7-H4 (DD-O110) is overexpressed in high risk uterine endometrioid adenocarcinomas and inversely correlated with tumor T-cell infiltration. FUNCTION Negatively regulates T-cell-mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. When expressed on the cell surface of tumor macrophages, plays an important role, together with regulatory T-cells (Treg), in the suppression of tumor-associated antigen-specific T-cell immunity. Involved in promoting epithelial cell transformation. Cell membrane Single-pass type I membrane protein Expressed at the cell surface. A soluble form has also been detected. Q7Z7D3-1 1 Q7Z7D3-2 2 Q7Z7D3-3 3 Q7Z7D3-4 4 Overexpressed in breast, ovarian, endometrial, renal cell (RCC) and non-small-cell lung cancers (NSCLC). Expressed on activated T- and B-cells, monocytes and dendritic cells, but not expressed in most normal tissues (at protein level). Widely expressed, including in kidney, liver, lung, ovary, placenta, spleen and testis. Up-regulated by IL6/interleukin-6 and IL10/interleukin-10 and inhibited by CSF2/GM-CSF and IL4/interleukin-4 on antigen-presenting cells (APCs). N-glycosylated. May serve as a predictive marker for renal cell carcinoma. Belongs to the immunoglobulin superfamily. BTN/MOG family. Contains 2 Ig-like V-type (immunoglobulin-like) domains. The mouse ortholog has been shown (PubMed:12818166) to be a GPI-anchored protein but the Gly residue which is predicted to be the modified site in mouse and rat is not conserved in human. 3D-structure Adaptive immunity Alternative splicing Cell membrane Complete proteome Disulfide bond Glycoprotein Immunity Immunoglobulin domain Lipoprotein Membrane Reference proteome Repeat Signal Transmembrane Transmembrane helix GRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGK EVSVWLSAMKGWCRSSKASLSIDLCFLNFRETLHHSHYCRLSWEHWGGWNPELHF F L L Q MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEP DIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNV QLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVV WASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKV TESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms Distributed under the Creative Commons Attribution-NoDerivs License