Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q7Z7B0 (FLIP1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 83. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Filamin-A-interacting protein 1

Short name=FILIP
Gene names
Name:FILIP1
Synonyms:KIAA1275
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1213 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

By acting through a filamin-A/F-actin axis, it controls the start of neocortical cell migration from the ventricular zone. May be able to induce the degradation of filamin-A By similarity.

Subunit structure

Interacts with FLNA By similarity.

Tissue specificity

Moderately expressed in adult heart and brain. Weakly expressed in lung, skeletal muscle, ovary, testis, kidney, and fetal brain, and hardly detectable in liver, pancreas, spleen, and fetal liver. Within brain, moderate expression is found in amygdala and caudate nucleus. Ref.7

Sequence similarities

Belongs to the FILIP1 family.

Sequence caution

The sequence BAA91763.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence CAH71818.1 differs from that shown. Reason: Erroneous gene model prediction.

The sequence CAH73614.1 differs from that shown. Reason: Erroneous gene model prediction.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainCoiled coil
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
None. [Check GOA]

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q7Z7B0-1)

Also known as: L-FILIP;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q7Z7B0-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1165-1213: GMKAGKPVVAAPGAGNLTKFEPRAETQSMKIELKKSAASSTTSLGGGKG → ESIIIHQLRMNSR
Note: No experimental confirmation available.
Isoform 3 (identifier: Q7Z7B0-3)

Also known as: S-FILIP;

The sequence of this isoform differs from the canonical sequence as follows:
     1-248: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 12131213Filamin-A-interacting protein 1
PRO_0000234540

Regions

Coiled coil192 – 591400 Potential
Coiled coil624 – 781158 Potential
Compositional bias37 – 415Poly-Lys

Natural variations

Alternative sequence1 – 248248Missing in isoform 3.
VSP_018344
Alternative sequence1165 – 121349GMKAG…GGGKG → ESIIIHQLRMNSR in isoform 2.
VSP_018345
Natural variant10031P → S.
Corresponds to variant rs34807169 [ dbSNP | Ensembl ].
VAR_050995

Experimental info

Sequence conflict401K → R in CAD89912. Ref.3
Sequence conflict74 – 9017ELSKE…IMEGE → AQYAIYIVSRLILLHFL in BAA86589. Ref.2
Sequence conflict3481T → I in CAD89912. Ref.3
Sequence conflict3731N → D in BX647178. Ref.3
Sequence conflict4211L → F in BAC04928. Ref.2
Sequence conflict7231E → G in BAB55310. Ref.2
Sequence conflict7931R → K in BAB55310. Ref.2
Sequence conflict10451T → A in BX647178. Ref.3
Sequence conflict11021E → G in CAD89912. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (L-FILIP) [UniParc].

Last modified October 1, 2003. Version 1.
Checksum: EE4329B03516E6AF

FASTA1,213138,109
        10         20         30         40         50         60 
MRSRNQGGES ASDGHISCPK PSIIGNAGEK SLSEDAKKKK KSNRKEDDVM ASGTVKRHLK 

        70         80         90        100        110        120 
TSGECERKTK KSLELSKEDL IQLLSIMEGE LQAREDVIHM LKTEKTKPEV LEAHYGSAEP 

       130        140        150        160        170        180 
EKVLRVLHRD AILAQEKSIG EDVYEKPISE LDRLEEKQKE TYRRMLEQLL LAEKCHRRTV 

       190        200        210        220        230        240 
YELENEKHKH TDYMNKSDDF TNLLEQERER LKKLLEQEKA YQARKEKENA KRLNKLRDEL 

       250        260        270        280        290        300 
VKLKSFALML VDERQMHIEQ LGLQSQKVQD LTQKLREEEE KLKAITSKSK EDRQKLLKLE 

       310        320        330        340        350        360 
VDFEHKASRF SQEHEEMNAK LANQESHNRQ LRLKLVGLTQ RIEELEETNK NLQKAEEELQ 

       370        380        390        400        410        420 
ELRDKIAKGE CGNSSLMAEV ENLRKRVLEM EGKDEEITKT ESQCRELRKK LQEEEHHSKE 

       430        440        450        460        470        480 
LRLEVEKLQK RMSELEKLEE AFSKSKSECT QLHLNLEKEK NLTKDLLNEL EVVKSRVKEL 

       490        500        510        520        530        540 
ECSESRLEKA ELSLKDDLTK LKSFTVMLVD ERKNMMEKIK QEERKVDGLN KNFKVEQGKV 

       550        560        570        580        590        600 
MDVTEKLIEE SKKLLKLKSE MEEKVYNLTR ERDELIGKLK SEEEKSSELS CSVDLLKKRL 

       610        620        630        640        650        660 
DGIEEVEREI TRGRSRKGSE LTCPEDNKIK ELTLEIERLK KRLQQLEVVE GDLMKTEDEY 

       670        680        690        700        710        720 
DQLEQKFRTE QDKANFLSQQ LEEIKHQIAK NKAIEKGEVV SQEAELRHRF RLEEAKSRDL 

       730        740        750        760        770        780 
KAEVQALKEK IHELMNKEDQ LSQLQVDYSV LQQRFMEEEN KNKNMGQEVL NLTKELELSK 

       790        800        810        820        830        840 
RYSRALRPSV NGRRMVDVPV TSTGVQTDAV SGEAAEEETP AVFIRKSFQE ENHIMSNLRQ 

       850        860        870        880        890        900 
VGLKKPVERS SVLDRYPPAA NELTMRKSWI PWMRKRENGP SITQEKGPRT NSSPGHPGEV 

       910        920        930        940        950        960 
VLSPKQGQPL HIRVTPDHEN STATLEITSP TSEEFFSSTT VIPTLGNQKP RITIIPSPNV 

       970        980        990       1000       1010       1020 
MPQKQKSGDT TLGPERAMSP VTITTFSREK TPESGRGAFA DRPTSPIQIM TVSTSAAPAE 

      1030       1040       1050       1060       1070       1080 
IAVSPESQEM PMGRTILKVT PEKQTVPTPV RKYNSNANII TTEDNKIHIH LGSQFKRSPG 

      1090       1100       1110       1120       1130       1140 
TSGEGVSPVI TVRPVNVTAE KEVSTGTVLR SPRNHLSSRP GASKVTSTIT ITPVTTSSAR 

      1150       1160       1170       1180       1190       1200 
GTQSVSGQDG SSQRPTPTRI PMSKGMKAGK PVVAAPGAGN LTKFEPRAET QSMKIELKKS 

      1210 
AASSTTSLGG GKG 

« Hide

Isoform 2 [UniParc].

Checksum: BF9EC236362CE6B4
Show »

FASTA1,177134,859
Isoform 3 (S-FILIP) [UniParc].

Checksum: 75A68B5C76E5E62E
Show »

FASTA965109,300

References

« Hide 'large scale' references
[1]"Human orthologue of L-FILIP."
Nagano T., Sato M.
Submitted (MAY-2002) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 550-1213 (ISOFORM 3).
Tissue: Small intestine.
[3]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Skeletal muscle and Small intestine.
[4]"The DNA sequence and analysis of human chromosome 6."
Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. expand/collapse author list , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[7]"Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O.
DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 74-1213 (ISOFORM 1), TISSUE SPECIFICITY.
Tissue: Brain.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB086011 mRNA. Translation: BAC77067.1.
AK001570 mRNA. Translation: BAA91763.1. Different initiation.
AK027705 mRNA. Translation: BAB55310.1.
AK097021 mRNA. Translation: BAC04928.1.
AL832009 mRNA. Translation: CAD89912.1.
BX647178 mRNA. No translation available.
AL589649, AL445465 Genomic DNA. Translation: CAH71818.1. Sequence problems.
AL589649, AL445465 Genomic DNA. Translation: CAH71820.1.
AL445465, AL589649 Genomic DNA. Translation: CAH73614.1. Sequence problems.
AL445465, AL589649 Genomic DNA. Translation: CAH73615.1.
CH471051 Genomic DNA. Translation: EAW48737.1.
BC136443 mRNA. Translation: AAI36444.1.
BC136444 mRNA. Translation: AAI36445.1.
AB033101 mRNA. Translation: BAA86589.1.
RefSeqNP_056502.1. NM_015687.3.
XP_005248770.1. XM_005248713.1.
XP_005248771.1. XM_005248714.1.
UniGeneHs.696158.

3D structure databases

ProteinModelPortalQ7Z7B0.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid118029. 6 interactions.
MINTMINT-4725886.
STRING9606.ENSP00000237172.

PTM databases

PhosphoSiteQ7Z7B0.

Polymorphism databases

DMDM74750226.

Proteomic databases

PaxDbQ7Z7B0.
PRIDEQ7Z7B0.

Protocols and materials databases

DNASU27145.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000237172; ENSP00000237172; ENSG00000118407. [Q7Z7B0-1]
ENST00000393004; ENSP00000376728; ENSG00000118407. [Q7Z7B0-2]
GeneID27145.
KEGGhsa:27145.
UCSCuc003phy.1. human. [Q7Z7B0-2]
uc003phz.3. human. [Q7Z7B0-1]

Organism-specific databases

CTD27145.
GeneCardsGC06M076005.
HGNCHGNC:21015. FILIP1.
HPAHPA053564.
MIM607307. gene.
neXtProtNX_Q7Z7B0.
PharmGKBPA134992638.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG145980.
HOVERGENHBG053840.
InParanoidQ7Z7B0.
OMADERKNMM.
OrthoDBEOG77M8NN.
PhylomeDBQ7Z7B0.
TreeFamTF331399.

Gene expression databases

BgeeQ7Z7B0.
CleanExHS_FILIP1.
GenevestigatorQ7Z7B0.

Family and domain databases

InterProIPR019131. Cortactin-binding_p2_N.
[Graphical view]
PfamPF09727. CortBP2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiFILIP1.
GenomeRNAi27145.
NextBio49894.
PROQ7Z7B0.
SOURCESearch...

Entry information

Entry nameFLIP1_HUMAN
AccessionPrimary (citable) accession number: Q7Z7B0
Secondary accession number(s): B2RMU6 expand/collapse secondary AC list , Q5VUL6, Q86TC3, Q8N8B9, Q96SK6, Q9NVI8, Q9ULE5
Entry history
Integrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: October 1, 2003
Last modified: April 16, 2014
This is version 83 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 6

Human chromosome 6: entries, gene names and cross-references to MIM