Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q7Z7B0

- FLIP1_HUMAN

UniProt

Q7Z7B0 - FLIP1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Filamin-A-interacting protein 1

Gene

FILIP1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli

Functioni

By acting through a filamin-A/F-actin axis, it controls the start of neocortical cell migration from the ventricular zone. May be able to induce the degradation of filamin-A.By similarity

Names & Taxonomyi

Protein namesi
Recommended name:
Filamin-A-interacting protein 1
Short name:
FILIP
Gene namesi
Name:FILIP1
Synonyms:KIAA1275
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 6

Organism-specific databases

HGNCiHGNC:21015. FILIP1.

Subcellular locationi

Cytoplasmcytoskeleton 1 Publication

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134992638.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 12131213Filamin-A-interacting protein 1PRO_0000234540Add
BLAST

Proteomic databases

MaxQBiQ7Z7B0.
PaxDbiQ7Z7B0.
PRIDEiQ7Z7B0.

PTM databases

PhosphoSiteiQ7Z7B0.

Expressioni

Tissue specificityi

Moderately expressed in adult heart and brain. Weakly expressed in lung, skeletal muscle, ovary, testis, kidney, and fetal brain, and hardly detectable in liver, pancreas, spleen, and fetal liver. Within brain, moderate expression is found in amygdala and caudate nucleus.1 Publication

Gene expression databases

BgeeiQ7Z7B0.
CleanExiHS_FILIP1.
GenevestigatoriQ7Z7B0.

Organism-specific databases

HPAiHPA053564.

Interactioni

Subunit structurei

Interacts with FLNA. Interacts with RHOD (in GTP-bound form).1 Publication

Protein-protein interaction databases

BioGridi118029. 6 interactions.
MINTiMINT-4725886.
STRINGi9606.ENSP00000237172.

Structurei

3D structure databases

ProteinModelPortaliQ7Z7B0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili192 – 591400Sequence AnalysisAdd
BLAST
Coiled coili624 – 781158Sequence AnalysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi37 – 415Poly-Lys

Sequence similaritiesi

Belongs to the FILIP1 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG145980.
GeneTreeiENSGT00680000099614.
HOVERGENiHBG053840.
InParanoidiQ7Z7B0.
OMAiIPWMRKR.
OrthoDBiEOG77M8NN.
PhylomeDBiQ7Z7B0.
TreeFamiTF331399.

Family and domain databases

InterProiIPR019131. Cortactin-binding_p2_N.
[Graphical view]
PfamiPF09727. CortBP2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q7Z7B0-1) [UniParc]FASTAAdd to Basket

Also known as: L-FILIP

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRSRNQGGES ASDGHISCPK PSIIGNAGEK SLSEDAKKKK KSNRKEDDVM
60 70 80 90 100
ASGTVKRHLK TSGECERKTK KSLELSKEDL IQLLSIMEGE LQAREDVIHM
110 120 130 140 150
LKTEKTKPEV LEAHYGSAEP EKVLRVLHRD AILAQEKSIG EDVYEKPISE
160 170 180 190 200
LDRLEEKQKE TYRRMLEQLL LAEKCHRRTV YELENEKHKH TDYMNKSDDF
210 220 230 240 250
TNLLEQERER LKKLLEQEKA YQARKEKENA KRLNKLRDEL VKLKSFALML
260 270 280 290 300
VDERQMHIEQ LGLQSQKVQD LTQKLREEEE KLKAITSKSK EDRQKLLKLE
310 320 330 340 350
VDFEHKASRF SQEHEEMNAK LANQESHNRQ LRLKLVGLTQ RIEELEETNK
360 370 380 390 400
NLQKAEEELQ ELRDKIAKGE CGNSSLMAEV ENLRKRVLEM EGKDEEITKT
410 420 430 440 450
ESQCRELRKK LQEEEHHSKE LRLEVEKLQK RMSELEKLEE AFSKSKSECT
460 470 480 490 500
QLHLNLEKEK NLTKDLLNEL EVVKSRVKEL ECSESRLEKA ELSLKDDLTK
510 520 530 540 550
LKSFTVMLVD ERKNMMEKIK QEERKVDGLN KNFKVEQGKV MDVTEKLIEE
560 570 580 590 600
SKKLLKLKSE MEEKVYNLTR ERDELIGKLK SEEEKSSELS CSVDLLKKRL
610 620 630 640 650
DGIEEVEREI TRGRSRKGSE LTCPEDNKIK ELTLEIERLK KRLQQLEVVE
660 670 680 690 700
GDLMKTEDEY DQLEQKFRTE QDKANFLSQQ LEEIKHQIAK NKAIEKGEVV
710 720 730 740 750
SQEAELRHRF RLEEAKSRDL KAEVQALKEK IHELMNKEDQ LSQLQVDYSV
760 770 780 790 800
LQQRFMEEEN KNKNMGQEVL NLTKELELSK RYSRALRPSV NGRRMVDVPV
810 820 830 840 850
TSTGVQTDAV SGEAAEEETP AVFIRKSFQE ENHIMSNLRQ VGLKKPVERS
860 870 880 890 900
SVLDRYPPAA NELTMRKSWI PWMRKRENGP SITQEKGPRT NSSPGHPGEV
910 920 930 940 950
VLSPKQGQPL HIRVTPDHEN STATLEITSP TSEEFFSSTT VIPTLGNQKP
960 970 980 990 1000
RITIIPSPNV MPQKQKSGDT TLGPERAMSP VTITTFSREK TPESGRGAFA
1010 1020 1030 1040 1050
DRPTSPIQIM TVSTSAAPAE IAVSPESQEM PMGRTILKVT PEKQTVPTPV
1060 1070 1080 1090 1100
RKYNSNANII TTEDNKIHIH LGSQFKRSPG TSGEGVSPVI TVRPVNVTAE
1110 1120 1130 1140 1150
KEVSTGTVLR SPRNHLSSRP GASKVTSTIT ITPVTTSSAR GTQSVSGQDG
1160 1170 1180 1190 1200
SSQRPTPTRI PMSKGMKAGK PVVAAPGAGN LTKFEPRAET QSMKIELKKS
1210
AASSTTSLGG GKG
Length:1,213
Mass (Da):138,109
Last modified:October 1, 2003 - v1
Checksum:iEE4329B03516E6AF
GO
Isoform 2 (identifier: Q7Z7B0-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1165-1213: GMKAGKPVVAAPGAGNLTKFEPRAETQSMKIELKKSAASSTTSLGGGKG → ESIIIHQLRMNSR

Note: No experimental confirmation available.

Show »
Length:1,177
Mass (Da):134,859
Checksum:iBF9EC236362CE6B4
GO
Isoform 3 (identifier: Q7Z7B0-3) [UniParc]FASTAAdd to Basket

Also known as: S-FILIP

The sequence of this isoform differs from the canonical sequence as follows:
     1-248: Missing.

Show »
Length:965
Mass (Da):109,300
Checksum:i75A68B5C76E5E62E
GO

Sequence cautioni

The sequence BAA91763.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence CAH71818.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence CAH73614.1 differs from that shown. Reason: Erroneous gene model prediction.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti40 – 401K → R in CAD89912. (PubMed:17974005)Curated
Sequence conflicti74 – 9017ELSKE…IMEGE → AQYAIYIVSRLILLHFL in BAA86589. (PubMed:14702039)CuratedAdd
BLAST
Sequence conflicti348 – 3481T → I in CAD89912. (PubMed:17974005)Curated
Sequence conflicti373 – 3731N → D in BX647178. (PubMed:17974005)Curated
Sequence conflicti421 – 4211L → F in BAC04928. (PubMed:14702039)Curated
Sequence conflicti723 – 7231E → G in BAB55310. (PubMed:14702039)Curated
Sequence conflicti793 – 7931R → K in BAB55310. (PubMed:14702039)Curated
Sequence conflicti1045 – 10451T → A in BX647178. (PubMed:17974005)Curated
Sequence conflicti1102 – 11021E → G in CAD89912. (PubMed:17974005)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti1003 – 10031P → S.
Corresponds to variant rs34807169 [ dbSNP | Ensembl ].
VAR_050995

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 248248Missing in isoform 3. 1 PublicationVSP_018344Add
BLAST
Alternative sequencei1165 – 121349GMKAG…GGGKG → ESIIIHQLRMNSR in isoform 2. 1 PublicationVSP_018345Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB086011 mRNA. Translation: BAC77067.1.
AK001570 mRNA. Translation: BAA91763.1. Different initiation.
AK027705 mRNA. Translation: BAB55310.1.
AK097021 mRNA. Translation: BAC04928.1.
AL832009 mRNA. Translation: CAD89912.1.
BX647178 mRNA. No translation available.
AL589649, AL445465 Genomic DNA. Translation: CAH71818.1. Sequence problems.
AL589649, AL445465 Genomic DNA. Translation: CAH71820.1.
AL445465, AL589649 Genomic DNA. Translation: CAH73614.1. Sequence problems.
AL445465, AL589649 Genomic DNA. Translation: CAH73615.1.
CH471051 Genomic DNA. Translation: EAW48737.1.
BC136443 mRNA. Translation: AAI36444.1.
BC136444 mRNA. Translation: AAI36445.1.
AB033101 mRNA. Translation: BAA86589.1.
CCDSiCCDS4984.1. [Q7Z7B0-1]
CCDS75480.1. [Q7Z7B0-2]
RefSeqiNP_001276916.1. NM_001289987.1.
NP_056502.1. NM_015687.3. [Q7Z7B0-1]
XP_005248770.1. XM_005248713.1. [Q7Z7B0-1]
UniGeneiHs.696158.

Genome annotation databases

EnsembliENST00000237172; ENSP00000237172; ENSG00000118407. [Q7Z7B0-1]
ENST00000393004; ENSP00000376728; ENSG00000118407. [Q7Z7B0-2]
GeneIDi27145.
KEGGihsa:27145.
UCSCiuc003phy.1. human. [Q7Z7B0-2]
uc003phz.3. human. [Q7Z7B0-1]

Polymorphism databases

DMDMi74750226.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB086011 mRNA. Translation: BAC77067.1 .
AK001570 mRNA. Translation: BAA91763.1 . Different initiation.
AK027705 mRNA. Translation: BAB55310.1 .
AK097021 mRNA. Translation: BAC04928.1 .
AL832009 mRNA. Translation: CAD89912.1 .
BX647178 mRNA. No translation available.
AL589649 , AL445465 Genomic DNA. Translation: CAH71818.1 . Sequence problems.
AL589649 , AL445465 Genomic DNA. Translation: CAH71820.1 .
AL445465 , AL589649 Genomic DNA. Translation: CAH73614.1 . Sequence problems.
AL445465 , AL589649 Genomic DNA. Translation: CAH73615.1 .
CH471051 Genomic DNA. Translation: EAW48737.1 .
BC136443 mRNA. Translation: AAI36444.1 .
BC136444 mRNA. Translation: AAI36445.1 .
AB033101 mRNA. Translation: BAA86589.1 .
CCDSi CCDS4984.1. [Q7Z7B0-1 ]
CCDS75480.1. [Q7Z7B0-2 ]
RefSeqi NP_001276916.1. NM_001289987.1.
NP_056502.1. NM_015687.3. [Q7Z7B0-1 ]
XP_005248770.1. XM_005248713.1. [Q7Z7B0-1 ]
UniGenei Hs.696158.

3D structure databases

ProteinModelPortali Q7Z7B0.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 118029. 6 interactions.
MINTi MINT-4725886.
STRINGi 9606.ENSP00000237172.

PTM databases

PhosphoSitei Q7Z7B0.

Polymorphism databases

DMDMi 74750226.

Proteomic databases

MaxQBi Q7Z7B0.
PaxDbi Q7Z7B0.
PRIDEi Q7Z7B0.

Protocols and materials databases

DNASUi 27145.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000237172 ; ENSP00000237172 ; ENSG00000118407 . [Q7Z7B0-1 ]
ENST00000393004 ; ENSP00000376728 ; ENSG00000118407 . [Q7Z7B0-2 ]
GeneIDi 27145.
KEGGi hsa:27145.
UCSCi uc003phy.1. human. [Q7Z7B0-2 ]
uc003phz.3. human. [Q7Z7B0-1 ]

Organism-specific databases

CTDi 27145.
GeneCardsi GC06M076005.
HGNCi HGNC:21015. FILIP1.
HPAi HPA053564.
MIMi 607307. gene.
neXtProti NX_Q7Z7B0.
PharmGKBi PA134992638.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG145980.
GeneTreei ENSGT00680000099614.
HOVERGENi HBG053840.
InParanoidi Q7Z7B0.
OMAi IPWMRKR.
OrthoDBi EOG77M8NN.
PhylomeDBi Q7Z7B0.
TreeFami TF331399.

Miscellaneous databases

GeneWikii FILIP1.
GenomeRNAii 27145.
NextBioi 49894.
PROi Q7Z7B0.
SOURCEi Search...

Gene expression databases

Bgeei Q7Z7B0.
CleanExi HS_FILIP1.
Genevestigatori Q7Z7B0.

Family and domain databases

InterProi IPR019131. Cortactin-binding_p2_N.
[Graphical view ]
Pfami PF09727. CortBP2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Human orthologue of L-FILIP."
    Nagano T., Sato M.
    Submitted (MAY-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 550-1213 (ISOFORM 3).
    Tissue: Small intestine.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Skeletal muscle and Small intestine.
  4. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  7. "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O.
    DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 74-1213 (ISOFORM 1), TISSUE SPECIFICITY.
    Tissue: Brain.
  8. "RhoD regulates cytoskeletal dynamics via the actin nucleation-promoting factor WASp homologue associated with actin Golgi membranes and microtubules."
    Gad A.K., Nehru V., Ruusala A., Aspenstrom P.
    Mol. Biol. Cell 23:4807-4819(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH RHOD AND FLNA, SUBCELLULAR LOCATION.

Entry informationi

Entry nameiFLIP1_HUMAN
AccessioniPrimary (citable) accession number: Q7Z7B0
Secondary accession number(s): B2RMU6
, Q5VUL6, Q86TC3, Q8N8B9, Q96SK6, Q9NVI8, Q9ULE5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: October 1, 2003
Last modified: October 29, 2014
This is version 87 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3