Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Filamin-A-interacting protein 1

Gene

FILIP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

By acting through a filamin-A/F-actin axis, it controls the start of neocortical cell migration from the ventricular zone. May be able to induce the degradation of filamin-A.By similarity

Names & Taxonomyi

Protein namesi
Recommended name:
Filamin-A-interacting protein 1
Short name:
FILIP
Gene namesi
Name:FILIP1
Synonyms:KIAA1275
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:21015. FILIP1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

DisGeNETi27145.
OpenTargetsiENSG00000118407.
PharmGKBiPA134992638.

Polymorphism and mutation databases

BioMutaiFILIP1.
DMDMi74750226.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002345401 – 1213Filamin-A-interacting protein 1Add BLAST1213

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei138PhosphoserineBy similarity1
Modified residuei979PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ7Z7B0.
MaxQBiQ7Z7B0.
PaxDbiQ7Z7B0.
PeptideAtlasiQ7Z7B0.
PRIDEiQ7Z7B0.

PTM databases

iPTMnetiQ7Z7B0.
PhosphoSitePlusiQ7Z7B0.
SwissPalmiQ7Z7B0.

Expressioni

Tissue specificityi

Moderately expressed in adult heart and brain. Weakly expressed in lung, skeletal muscle, ovary, testis, kidney, and fetal brain, and hardly detectable in liver, pancreas, spleen, and fetal liver. Within brain, moderate expression is found in amygdala and caudate nucleus.1 Publication

Gene expression databases

BgeeiENSG00000118407.
CleanExiHS_FILIP1.
ExpressionAtlasiQ7Z7B0. baseline and differential.
GenevisibleiQ7Z7B0. HS.

Organism-specific databases

HPAiHPA053564.

Interactioni

Subunit structurei

Interacts with FLNA. Interacts with RHOD (in GTP-bound form).1 Publication

Protein-protein interaction databases

BioGridi118029. 5 interactors.
MINTiMINT-4725886.
STRINGi9606.ENSP00000237172.

Structurei

3D structure databases

ProteinModelPortaliQ7Z7B0.
SMRiQ7Z7B0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili192 – 591Sequence analysisAdd BLAST400
Coiled coili624 – 781Sequence analysisAdd BLAST158

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi37 – 41Poly-Lys5

Sequence similaritiesi

Belongs to the FILIP1 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IFP9. Eukaryota.
ENOG410ZUI9. LUCA.
GeneTreeiENSGT00680000099614.
HOVERGENiHBG053840.
InParanoidiQ7Z7B0.
OMAiIPWMRKR.
OrthoDBiEOG091G0CSA.
PhylomeDBiQ7Z7B0.
TreeFamiTF331399.

Family and domain databases

InterProiIPR019131. Cortactin-binding_p2_N.
[Graphical view]
PfamiPF09727. CortBP2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7Z7B0-1) [UniParc]FASTAAdd to basket
Also known as: L-FILIP

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRSRNQGGES ASDGHISCPK PSIIGNAGEK SLSEDAKKKK KSNRKEDDVM
60 70 80 90 100
ASGTVKRHLK TSGECERKTK KSLELSKEDL IQLLSIMEGE LQAREDVIHM
110 120 130 140 150
LKTEKTKPEV LEAHYGSAEP EKVLRVLHRD AILAQEKSIG EDVYEKPISE
160 170 180 190 200
LDRLEEKQKE TYRRMLEQLL LAEKCHRRTV YELENEKHKH TDYMNKSDDF
210 220 230 240 250
TNLLEQERER LKKLLEQEKA YQARKEKENA KRLNKLRDEL VKLKSFALML
260 270 280 290 300
VDERQMHIEQ LGLQSQKVQD LTQKLREEEE KLKAITSKSK EDRQKLLKLE
310 320 330 340 350
VDFEHKASRF SQEHEEMNAK LANQESHNRQ LRLKLVGLTQ RIEELEETNK
360 370 380 390 400
NLQKAEEELQ ELRDKIAKGE CGNSSLMAEV ENLRKRVLEM EGKDEEITKT
410 420 430 440 450
ESQCRELRKK LQEEEHHSKE LRLEVEKLQK RMSELEKLEE AFSKSKSECT
460 470 480 490 500
QLHLNLEKEK NLTKDLLNEL EVVKSRVKEL ECSESRLEKA ELSLKDDLTK
510 520 530 540 550
LKSFTVMLVD ERKNMMEKIK QEERKVDGLN KNFKVEQGKV MDVTEKLIEE
560 570 580 590 600
SKKLLKLKSE MEEKVYNLTR ERDELIGKLK SEEEKSSELS CSVDLLKKRL
610 620 630 640 650
DGIEEVEREI TRGRSRKGSE LTCPEDNKIK ELTLEIERLK KRLQQLEVVE
660 670 680 690 700
GDLMKTEDEY DQLEQKFRTE QDKANFLSQQ LEEIKHQIAK NKAIEKGEVV
710 720 730 740 750
SQEAELRHRF RLEEAKSRDL KAEVQALKEK IHELMNKEDQ LSQLQVDYSV
760 770 780 790 800
LQQRFMEEEN KNKNMGQEVL NLTKELELSK RYSRALRPSV NGRRMVDVPV
810 820 830 840 850
TSTGVQTDAV SGEAAEEETP AVFIRKSFQE ENHIMSNLRQ VGLKKPVERS
860 870 880 890 900
SVLDRYPPAA NELTMRKSWI PWMRKRENGP SITQEKGPRT NSSPGHPGEV
910 920 930 940 950
VLSPKQGQPL HIRVTPDHEN STATLEITSP TSEEFFSSTT VIPTLGNQKP
960 970 980 990 1000
RITIIPSPNV MPQKQKSGDT TLGPERAMSP VTITTFSREK TPESGRGAFA
1010 1020 1030 1040 1050
DRPTSPIQIM TVSTSAAPAE IAVSPESQEM PMGRTILKVT PEKQTVPTPV
1060 1070 1080 1090 1100
RKYNSNANII TTEDNKIHIH LGSQFKRSPG TSGEGVSPVI TVRPVNVTAE
1110 1120 1130 1140 1150
KEVSTGTVLR SPRNHLSSRP GASKVTSTIT ITPVTTSSAR GTQSVSGQDG
1160 1170 1180 1190 1200
SSQRPTPTRI PMSKGMKAGK PVVAAPGAGN LTKFEPRAET QSMKIELKKS
1210
AASSTTSLGG GKG
Length:1,213
Mass (Da):138,109
Last modified:October 1, 2003 - v1
Checksum:iEE4329B03516E6AF
GO
Isoform 2 (identifier: Q7Z7B0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1165-1213: GMKAGKPVVAAPGAGNLTKFEPRAETQSMKIELKKSAASSTTSLGGGKG → ESIIIHQLRMNSR

Note: No experimental confirmation available.
Show »
Length:1,177
Mass (Da):134,859
Checksum:iBF9EC236362CE6B4
GO
Isoform 3 (identifier: Q7Z7B0-3) [UniParc]FASTAAdd to basket
Also known as: S-FILIP

The sequence of this isoform differs from the canonical sequence as follows:
     1-248: Missing.

Show »
Length:965
Mass (Da):109,300
Checksum:i75A68B5C76E5E62E
GO

Sequence cautioni

The sequence BAA91763 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAH71818 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAH73614 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti40K → R in CAD89912 (PubMed:17974005).Curated1
Sequence conflicti74 – 90ELSKE…IMEGE → AQYAIYIVSRLILLHFL in BAA86589 (PubMed:14702039).CuratedAdd BLAST17
Sequence conflicti348T → I in CAD89912 (PubMed:17974005).Curated1
Sequence conflicti373N → D in BX647178 (PubMed:17974005).Curated1
Sequence conflicti421L → F in BAC04928 (PubMed:14702039).Curated1
Sequence conflicti723E → G in BAB55310 (PubMed:14702039).Curated1
Sequence conflicti793R → K in BAB55310 (PubMed:14702039).Curated1
Sequence conflicti1045T → A in BX647178 (PubMed:17974005).Curated1
Sequence conflicti1102E → G in CAD89912 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0509951003P → S.Corresponds to variant rs34807169dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0183441 – 248Missing in isoform 3. 1 PublicationAdd BLAST248
Alternative sequenceiVSP_0183451165 – 1213GMKAG…GGGKG → ESIIIHQLRMNSR in isoform 2. 1 PublicationAdd BLAST49

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB086011 mRNA. Translation: BAC77067.1.
AK001570 mRNA. Translation: BAA91763.1. Different initiation.
AK027705 mRNA. Translation: BAB55310.1.
AK097021 mRNA. Translation: BAC04928.1.
AL832009 mRNA. Translation: CAD89912.1.
BX647178 mRNA. No translation available.
AL589649, AL445465 Genomic DNA. Translation: CAH71818.1. Sequence problems.
AL589649, AL445465 Genomic DNA. Translation: CAH71820.1.
AL445465, AL589649 Genomic DNA. Translation: CAH73614.1. Sequence problems.
AL445465, AL589649 Genomic DNA. Translation: CAH73615.1.
CH471051 Genomic DNA. Translation: EAW48737.1.
BC136443 mRNA. Translation: AAI36444.1.
BC136444 mRNA. Translation: AAI36445.1.
AB033101 mRNA. Translation: BAA86589.1.
CCDSiCCDS4984.1. [Q7Z7B0-1]
CCDS75480.1. [Q7Z7B0-2]
RefSeqiNP_001276916.1. NM_001289987.1.
NP_001287795.1. NM_001300866.1. [Q7Z7B0-2]
NP_056502.1. NM_015687.3. [Q7Z7B0-1]
XP_005248770.1. XM_005248713.3. [Q7Z7B0-1]
XP_011534058.1. XM_011535756.2. [Q7Z7B0-3]
UniGeneiHs.696158.

Genome annotation databases

EnsembliENST00000237172; ENSP00000237172; ENSG00000118407. [Q7Z7B0-1]
ENST00000393004; ENSP00000376728; ENSG00000118407. [Q7Z7B0-2]
GeneIDi27145.
KEGGihsa:27145.
UCSCiuc003phy.2. human. [Q7Z7B0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB086011 mRNA. Translation: BAC77067.1.
AK001570 mRNA. Translation: BAA91763.1. Different initiation.
AK027705 mRNA. Translation: BAB55310.1.
AK097021 mRNA. Translation: BAC04928.1.
AL832009 mRNA. Translation: CAD89912.1.
BX647178 mRNA. No translation available.
AL589649, AL445465 Genomic DNA. Translation: CAH71818.1. Sequence problems.
AL589649, AL445465 Genomic DNA. Translation: CAH71820.1.
AL445465, AL589649 Genomic DNA. Translation: CAH73614.1. Sequence problems.
AL445465, AL589649 Genomic DNA. Translation: CAH73615.1.
CH471051 Genomic DNA. Translation: EAW48737.1.
BC136443 mRNA. Translation: AAI36444.1.
BC136444 mRNA. Translation: AAI36445.1.
AB033101 mRNA. Translation: BAA86589.1.
CCDSiCCDS4984.1. [Q7Z7B0-1]
CCDS75480.1. [Q7Z7B0-2]
RefSeqiNP_001276916.1. NM_001289987.1.
NP_001287795.1. NM_001300866.1. [Q7Z7B0-2]
NP_056502.1. NM_015687.3. [Q7Z7B0-1]
XP_005248770.1. XM_005248713.3. [Q7Z7B0-1]
XP_011534058.1. XM_011535756.2. [Q7Z7B0-3]
UniGeneiHs.696158.

3D structure databases

ProteinModelPortaliQ7Z7B0.
SMRiQ7Z7B0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi118029. 5 interactors.
MINTiMINT-4725886.
STRINGi9606.ENSP00000237172.

PTM databases

iPTMnetiQ7Z7B0.
PhosphoSitePlusiQ7Z7B0.
SwissPalmiQ7Z7B0.

Polymorphism and mutation databases

BioMutaiFILIP1.
DMDMi74750226.

Proteomic databases

EPDiQ7Z7B0.
MaxQBiQ7Z7B0.
PaxDbiQ7Z7B0.
PeptideAtlasiQ7Z7B0.
PRIDEiQ7Z7B0.

Protocols and materials databases

DNASUi27145.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000237172; ENSP00000237172; ENSG00000118407. [Q7Z7B0-1]
ENST00000393004; ENSP00000376728; ENSG00000118407. [Q7Z7B0-2]
GeneIDi27145.
KEGGihsa:27145.
UCSCiuc003phy.2. human. [Q7Z7B0-1]

Organism-specific databases

CTDi27145.
DisGeNETi27145.
GeneCardsiFILIP1.
HGNCiHGNC:21015. FILIP1.
HPAiHPA053564.
MIMi607307. gene.
neXtProtiNX_Q7Z7B0.
OpenTargetsiENSG00000118407.
PharmGKBiPA134992638.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IFP9. Eukaryota.
ENOG410ZUI9. LUCA.
GeneTreeiENSGT00680000099614.
HOVERGENiHBG053840.
InParanoidiQ7Z7B0.
OMAiIPWMRKR.
OrthoDBiEOG091G0CSA.
PhylomeDBiQ7Z7B0.
TreeFamiTF331399.

Miscellaneous databases

ChiTaRSiFILIP1. human.
GeneWikiiFILIP1.
GenomeRNAii27145.
PROiQ7Z7B0.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000118407.
CleanExiHS_FILIP1.
ExpressionAtlasiQ7Z7B0. baseline and differential.
GenevisibleiQ7Z7B0. HS.

Family and domain databases

InterProiIPR019131. Cortactin-binding_p2_N.
[Graphical view]
PfamiPF09727. CortBP2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiFLIP1_HUMAN
AccessioniPrimary (citable) accession number: Q7Z7B0
Secondary accession number(s): B2RMU6
, Q5VUL6, Q86TC3, Q8N8B9, Q96SK6, Q9NVI8, Q9ULE5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: October 1, 2003
Last modified: November 2, 2016
This is version 103 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.