Q7Z7B0 (FLIP1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 75.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Filamin-A-interacting protein 1 Short name=FILIP | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1213 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | By acting through a filamin-A/F-actin axis, it controls the start of neocortical cell migration from the ventricular zone. May be able to induce the degradation of filamin-A By similarity. |
| Subunit structure | Interacts with FLNA By similarity. |
| Tissue specificity | Moderately expressed in adult heart and brain. Weakly expressed in lung, skeletal muscle, ovary, testis, kidney, and fetal brain, and hardly detectable in liver, pancreas, spleen, and fetal liver. Within brain, moderate expression is found in amygdala and caudate nucleus. Ref.7 |
| Sequence similarities | Belongs to the FILIP1 family. |
| Sequence caution | The sequence BAA91763.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence CAH71818.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAH73614.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q7Z7B0-1) Also known as: L-FILIP; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q7Z7B0-2) The sequence of this isoform differs from the canonical sequence as follows: 1165-1213: GMKAGKPVVAAPGAGNLTKFEPRAETQSMKIELKKSAASSTTSLGGGKG → ESIIIHQLRMNSR | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q7Z7B0-3) Also known as: S-FILIP; The sequence of this isoform differs from the canonical sequence as follows: 1-248: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1213 | 1213 | Filamin-A-interacting protein 1 | PRO_0000234540 | |||||
Regions | |||||||||
| Coiled coil | 192 – 591 | 400 | Potential | ||||||
| Coiled coil | 624 – 781 | 158 | Potential | ||||||
| Compositional bias | 37 – 41 | 5 | Poly-Lys | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 248 | 248 | Missing in isoform 3. | VSP_018344 | |||||
| Alternative sequence | 1165 – 1213 | 49 | GMKAG…GGGKG → ESIIIHQLRMNSR in isoform 2. | VSP_018345 | |||||
| Natural variant | 1003 | 1 | P → S. Corresponds to variant rs34807169 [ dbSNP | Ensembl ]. | VAR_050995 | |||||
Experimental info | |||||||||
| Sequence conflict | 40 | 1 | K → R in CAD89912. Ref.3 | ||||||
| Sequence conflict | 74 – 90 | 17 | ELSKE…IMEGE → AQYAIYIVSRLILLHFL in BAA86589. Ref.2 | ||||||
| Sequence conflict | 348 | 1 | T → I in CAD89912. Ref.3 | ||||||
| Sequence conflict | 373 | 1 | N → D in BX647178. Ref.3 | ||||||
| Sequence conflict | 421 | 1 | L → F in BAC04928. Ref.2 | ||||||
| Sequence conflict | 723 | 1 | E → G in BAB55310. Ref.2 | ||||||
| Sequence conflict | 793 | 1 | R → K in BAB55310. Ref.2 | ||||||
| Sequence conflict | 1045 | 1 | T → A in BX647178. Ref.3 | ||||||
| Sequence conflict | 1102 | 1 | E → G in CAD89912. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human orthologue of L-FILIP." Nagano T., Sato M. Submitted (MAY-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 550-1213 (ISOFORM 3). Tissue: Small intestine. |
| [3] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Skeletal muscle and Small intestine. |
| [4] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [7] | "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O. DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 74-1213 (ISOFORM 1), TISSUE SPECIFICITY. Tissue: Brain. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB086011 mRNA. Translation: BAC77067.1. AK001570 mRNA. Translation: BAA91763.1. Different initiation. AK027705 mRNA. Translation: BAB55310.1. AK097021 mRNA. Translation: BAC04928.1. AL832009 mRNA. Translation: CAD89912.1. BX647178 mRNA. No translation available. AL589649, AL445465 Genomic DNA. Translation: CAH71818.1. Sequence problems. AL589649, AL445465 Genomic DNA. Translation: CAH71820.1. AL445465, AL589649 Genomic DNA. Translation: CAH73614.1. Sequence problems. AL445465, AL589649 Genomic DNA. Translation: CAH73615.1. CH471051 Genomic DNA. Translation: EAW48737.1. BC136443 mRNA. Translation: AAI36444.1. BC136444 mRNA. Translation: AAI36445.1. AB033101 mRNA. Translation: BAA86589.1. |
| IPI | IPI00297210. IPI00642180. IPI00745798. |
| RefSeq | NP_056502.1. NM_015687.2. |
| UniGene | Hs.696158. |
3D structure databases | |
| ProteinModelPortal | Q7Z7B0. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000237172. |
PTM databases | |
| PhosphoSite | Q7Z7B0. |
Polymorphism databases | |
| DMDM | 74750226. |
Proteomic databases | |
| PaxDb | Q7Z7B0. |
| PRIDE | Q7Z7B0. |
Protocols and materials databases | |
| DNASU | 27145. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000237172; ENSP00000237172; ENSG00000118407. ENST00000370020; ENSP00000359037; ENSG00000118407. ENST00000393004; ENSP00000376728; ENSG00000118407. |
| GeneID | 27145. |
| KEGG | hsa:27145. |
| UCSC | uc003phy.1. human. uc003phz.3. human. |
Organism-specific databases | |
| CTD | 27145. |
| GeneCards | GC06M076005. |
| HGNC | HGNC:21015. FILIP1. |
| MIM | 607307. gene. |
| neXtProt | NX_Q7Z7B0. |
| PharmGKB | PA134992638. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG145980. |
| HOVERGEN | HBG053840. |
| InParanoid | Q7Z7B0. |
| OMA | DERKNMM. |
| OrthoDB | EOG4GTKC7. |
| PhylomeDB | Q7Z7B0. |
Gene expression databases | |
| Bgee | Q7Z7B0. |
| CleanEx | HS_FILIP1. |
| Genevestigator | Q7Z7B0. |
| GermOnline | ENSG00000118407. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR019131. Cortactin-binding_p2_N. [Graphical view] |
| Pfam | PF09727. CortBP2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 27145. |
| NextBio | 49894. |
| SOURCE | Search... |
Entry information
| Entry name | FLIP1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q7Z7B0 Secondary accession number(s): B2RMU6 Q9ULE5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
