Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

FYVE, RhoGEF and PH domain-containing protein 2

Gene

FGD2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Activates CDC42, a member of the Ras-like family of Rho- and Rac proteins, by exchanging bound GDP for free GTP. Activates JNK1 via CDC42 but not RAC1. Binds to phosphatidylinositol 4,5-bisphosphate, phosphatidylinositol 3,4,5-trisphosphate, phosphatidylinositol 5-monophosphate, phosphatidylinositol 4-monophosphate and phosphatidylinositol 3-monophosphate (By similarity).By similarity

Caution

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri458 – 518FYVE-typePROSITE-ProRule annotationAdd BLAST61

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionGuanine-nucleotide releasing factor
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-193648 NRAGE signals death through JNK
R-HSA-194840 Rho GTPase cycle
R-HSA-416482 G alpha (12/13) signalling events

Names & Taxonomyi

Protein namesi
Recommended name:
FYVE, RhoGEF and PH domain-containing protein 2
Alternative name(s):
Zinc finger FYVE domain-containing protein 4
Gene namesi
Name:FGD2
Synonyms:ZFYVE4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000146192.14
HGNCiHGNC:3664 FGD2
MIMi605091 gene
neXtProtiNX_Q7Z6J4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Endosome, Membrane, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi221472
OpenTargetsiENSG00000146192
PharmGKBiPA28103

Polymorphism and mutation databases

BioMutaiFGD2
DMDMi61213572

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000809421 – 655FYVE, RhoGEF and PH domain-containing protein 2Add BLAST655

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei11PhosphoserineBy similarity1
Modified residuei48PhosphoserineBy similarity1
Modified residuei654PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ7Z6J4
PaxDbiQ7Z6J4
PeptideAtlasiQ7Z6J4
PRIDEiQ7Z6J4

PTM databases

iPTMnetiQ7Z6J4
PhosphoSitePlusiQ7Z6J4

Expressioni

Gene expression databases

BgeeiENSG00000146192
CleanExiHS_FGD2
ExpressionAtlasiQ7Z6J4 baseline and differential
GenevisibleiQ7Z6J4 HS

Organism-specific databases

HPAiHPA029145
HPA049692

Interactioni

Binary interactionsi

Show more details

GO - Molecular functioni

Protein-protein interaction databases

BioGridi1287303 interactors.
IntActiQ7Z6J4 5 interactors.
STRINGi9606.ENSP00000274963

Structurei

3D structure databases

ProteinModelPortaliQ7Z6J4
SMRiQ7Z6J4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini102 – 290DHPROSITE-ProRule annotationAdd BLAST189
Domaini319 – 418PH 1PROSITE-ProRule annotationAdd BLAST100
Domaini544 – 641PH 2PROSITE-ProRule annotationAdd BLAST98

Domaini

The FYVE-type zinc-finger is necessary for early endosome localization. Recruitment to endosomal membranes via this domain requires the presence of phosphatidylinositol 3-phosphate or other phosphatidylinositides (By similarity).By similarity
The PH domain is necessary for localization to the ruffle membrane. Recruitment to ruffle membrane occurs through binding of phosphoinositides by the PH domain. This domain also contributes to the lipid-binding properties of the protein (By similarity).By similarity
The DH domain is necessary for its ability to activate JNK1 via CDC42.By similarity

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri458 – 518FYVE-typePROSITE-ProRule annotationAdd BLAST61

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG4424 Eukaryota
ENOG410XRXV LUCA
GeneTreeiENSGT00890000139342
HOVERGENiHBG007506
InParanoidiQ7Z6J4
KOiK05721
OMAiDPMERYL
OrthoDBiEOG091G03FU
PhylomeDBiQ7Z6J4
TreeFamiTF316247

Family and domain databases

CDDicd13386 PH1_FGD2, 1 hit
cd13236 PH2_FGD1-4, 1 hit
cd00160 RhoGEF, 1 hit
Gene3Di1.20.900.101 hit
2.30.29.302 hits
3.30.40.101 hit
InterProiView protein in InterPro
IPR035899 DBL_dom_sf
IPR000219 DH-domain
IPR035941 FGD1-4_PH2
IPR037797 FGD2_PH1
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR000306 Znf_FYVE
IPR017455 Znf_FYVE-rel
IPR011011 Znf_FYVE_PHD
IPR013083 Znf_RING/FYVE/PHD
PfamiView protein in Pfam
PF01363 FYVE, 1 hit
PF00169 PH, 2 hits
PF00621 RhoGEF, 1 hit
SMARTiView protein in SMART
SM00064 FYVE, 1 hit
SM00233 PH, 2 hits
SM00325 RhoGEF, 1 hit
SUPFAMiSSF48065 SSF48065, 1 hit
SSF57903 SSF57903, 1 hit
PROSITEiView protein in PROSITE
PS50010 DH_2, 1 hit
PS50003 PH_DOMAIN, 2 hits
PS50178 ZF_FYVE, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7Z6J4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKGASEEKLA SVSNLVTVFE NSRTPEAAPR GQRLEDVHHR PECRPPESPG
60 70 80 90 100
PREKTNVGEA VGSEPRTVSR RYLNSLKNKL SSEAWRKSCQ PVTLSGSGTQ
110 120 130 140 150
EPEKKIVQEL LETEQAYVAR LHLLDQVFFQ ELLKTARSSK AFPEDVVRVI
160 170 180 190 200
FSNISSIYQF HSQFFLPELQ RRLDDWTANP RIGDVIQKLA PFLKMYSEYV
210 220 230 240 250
KNFERAAELL ATWTDKSPLF QEVLTRIQSS EASGSLTLQH HMLEPVQRIP
260 270 280 290 300
RYELLLKEYI QKLPAQAPDQ ADAQKALDMI FSAAQHSNAA ITEMERLQDL
310 320 330 340 350
WEVYQRLGLE DDIVDPSNTL LREGPVLKIS FRRNDPMERY LFLFNNMLLY
360 370 380 390 400
CVPRVIQVGA QFQVRTRIDV AGMKVRELMD AEFPHSFLVS GKQRTLELQA
410 420 430 440 450
RSQEEMISWM QAFQAAIDQI EKRNETFKAA AQGPEGDIQE QELQSEELGL
460 470 480 490 500
RAPQWVRDKM VTMCMRCQEP FNALTRRRHH CRACGYVVCA RCSDYRAELK
510 520 530 540 550
YDDNRPNRVC LHCYAFLTGN VLPEAKEDKR RGILEKGSSA TPDQSLMCSF
560 570 580 590 600
LQLIGDKWGK SGPRGWCVIP RDDPLVLYVY AAPQDMRAHT SIPLLGYQVT
610 620 630 640 650
VGPQGDPRVF QLQQSGQLYT FKAETEELKG RWVKAMERAA SGWSPSWPND

GDLSD
Length:655
Mass (Da):74,892
Last modified:October 1, 2003 - v1
Checksum:iDB60098249C2B340
GO
Isoform 2 (identifier: Q7Z6J4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-423: Missing.
     424-442: NETFKAAAQGPEGDIQEQE → MGGRRSPRAHSCPTPLNPQ
     585-655: DMRAHTSIPL...SWPNDGDLSD → VRPPPARPPSGPGLPTACV

Note: No experimental confirmation available.
Show »
Length:180
Mass (Da):20,193
Checksum:i96FB2A2E1FE129C5
GO
Isoform 3 (identifier: Q7Z6J4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-372: Missing.
     488-655: VCARCSDYRA...SWPNDGDLSD → STPASTPASTCVTQASTCITQASTFPT

Note: No experimental confirmation available.
Show »
Length:142
Mass (Da):16,086
Checksum:i3BC622A79372D3FA
GO
Isoform 4 (identifier: Q7Z6J4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: MKGASEEKLASVSNLVTVFENS → MFPKKARHPGAPALGICTRQPKSTPGTCCCFPCSPGRKPSGLSLLL
     101-104: EPEK → VPEG
     105-655: Missing.

Note: May be due to an intron retention. No experimental confirmation available.
Show »
Length:128
Mass (Da):13,825
Checksum:iB6EB12FF70E7A602
GO

Sequence cautioni

The sequence BAB15746 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC85129 differs from that shown. Reason: Frameshift at position 460.Curated
The sequence BAC85129 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence CAI20471 differs from that shown. Reason: Erroneous gene model prediction.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02149132Q → H1 PublicationCorresponds to variant dbSNP:rs831510Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0130651 – 423Missing in isoform 2. 1 PublicationAdd BLAST423
Alternative sequenceiVSP_0130661 – 372Missing in isoform 3. 1 PublicationAdd BLAST372
Alternative sequenceiVSP_0130671 – 22MKGAS…VFENS → MFPKKARHPGAPALGICTRQ PKSTPGTCCCFPCSPGRKPS GLSLLL in isoform 4. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_013068101 – 104EPEK → VPEG in isoform 4. 1 Publication4
Alternative sequenceiVSP_038219105 – 655Missing in isoform 4. 1 PublicationAdd BLAST551
Alternative sequenceiVSP_013070424 – 442NETFK…IQEQE → MGGRRSPRAHSCPTPLNPQ in isoform 2. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_013071488 – 655VCARC…GDLSD → STPASTPASTCVTQASTCIT QASTFPT in isoform 3. 1 PublicationAdd BLAST168
Alternative sequenceiVSP_013072585 – 655DMRAH…GDLSD → VRPPPARPPSGPGLPTACV in isoform 2. 1 PublicationAdd BLAST71

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024456 mRNA Translation: BAB15746.1 Different initiation.
AK097230 mRNA Translation: BAC04982.1
AK131079 mRNA Translation: BAC85129.1 Sequence problems.
AL160264 Genomic DNA Translation: CAI20471.1 Sequence problems.
BC023645 mRNA Translation: AAH23645.1
BC053655 mRNA Translation: AAH53655.1
CCDSiCCDS4829.1 [Q7Z6J4-1]
RefSeqiNP_775829.2, NM_173558.3 [Q7Z6J4-1]
UniGeneiHs.509664

Genome annotation databases

EnsembliENST00000274963; ENSP00000274963; ENSG00000146192 [Q7Z6J4-1]
GeneIDi221472
KEGGihsa:221472
UCSCiuc010jwp.2 human [Q7Z6J4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiFGD2_HUMAN
AccessioniPrimary (citable) accession number: Q7Z6J4
Secondary accession number(s): Q5T8I1
, Q6P6A8, Q6ZNL5, Q8IZ32, Q8N868, Q9H7M2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 15, 2005
Last sequence update: October 1, 2003
Last modified: March 28, 2018
This is version 141 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome