Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q7Z6J4

- FGD2_HUMAN

UniProt

Q7Z6J4 - FGD2_HUMAN

Protein

FYVE, RhoGEF and PH domain-containing protein 2

Gene

FGD2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 106 (01 Oct 2014)
      Sequence version 1 (01 Oct 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Activates CDC42, a member of the Ras-like family of Rho- and Rac proteins, by exchanging bound GDP for free GTP. Activates JNK1 via CDC42 but not RAC1. Binds to phosphatidylinositol 4,5-bisphosphate, phosphatidylinositol 3,4,5-trisphosphate, phosphatidylinositol 5-monophosphate, phosphatidylinositol 4-monophosphate and phosphatidylinositol 3-monophosphate By similarity.By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri458 – 51861FYVE-typePROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. guanyl-nucleotide exchange factor activity Source: UniProtKB
    2. metal ion binding Source: UniProtKB-KW
    3. Rho guanyl-nucleotide exchange factor activity Source: InterPro
    4. small GTPase binding Source: UniProtKB

    GO - Biological processi

    1. actin cytoskeleton organization Source: UniProtKB
    2. apoptotic signaling pathway Source: Reactome
    3. cytoskeleton organization Source: UniProtKB
    4. filopodium assembly Source: UniProtKB
    5. neurotrophin TRK receptor signaling pathway Source: Reactome
    6. positive regulation of apoptotic process Source: Reactome
    7. positive regulation of GTPase activity Source: GOC
    8. regulation of Cdc42 GTPase activity Source: UniProtKB
    9. regulation of cell shape Source: UniProtKB
    10. regulation of small GTPase mediated signal transduction Source: Reactome
    11. small GTPase mediated signal transduction Source: Reactome

    Keywords - Molecular functioni

    Guanine-nucleotide releasing factor

    Keywords - Ligandi

    Metal-binding, Zinc

    Enzyme and pathway databases

    ReactomeiREACT_11051. Rho GTPase cycle.
    REACT_13638. NRAGE signals death through JNK.
    REACT_18407. G alpha (12/13) signalling events.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    FYVE, RhoGEF and PH domain-containing protein 2
    Alternative name(s):
    Zinc finger FYVE domain-containing protein 4
    Gene namesi
    Name:FGD2
    Synonyms:ZFYVE4
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 6

    Organism-specific databases

    HGNCiHGNC:3664. FGD2.

    Subcellular locationi

    Cytoplasmcytoskeleton Curated. Cytoplasm By similarity. Nucleus By similarity. Early endosome By similarity. Early endosome membrane By similarity. Cell projectionruffle membrane By similarity
    Note: Recruitment to the endosome and ruffle membrane requires the presence of phosphoinositides.By similarity

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB
    2. cytoskeleton Source: UniProtKB-SubCell
    3. cytosol Source: Reactome
    4. early endosome membrane Source: UniProtKB-SubCell
    5. Golgi apparatus Source: UniProtKB
    6. lamellipodium Source: UniProtKB
    7. nucleus Source: UniProtKB-SubCell
    8. ruffle Source: UniProtKB
    9. ruffle membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Endosome, Membrane, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA28103.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 655655FYVE, RhoGEF and PH domain-containing protein 2PRO_0000080942Add
    BLAST

    Proteomic databases

    MaxQBiQ7Z6J4.
    PaxDbiQ7Z6J4.
    PRIDEiQ7Z6J4.

    PTM databases

    PhosphoSiteiQ7Z6J4.

    Expressioni

    Gene expression databases

    ArrayExpressiQ7Z6J4.
    BgeeiQ7Z6J4.
    CleanExiHS_FGD2.
    GenevestigatoriQ7Z6J4.

    Organism-specific databases

    HPAiHPA029145.

    Interactioni

    Protein-protein interaction databases

    BioGridi128730. 1 interaction.
    STRINGi9606.ENSP00000274963.

    Structurei

    3D structure databases

    ProteinModelPortaliQ7Z6J4.
    SMRiQ7Z6J4. Positions 106-519, 566-639.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini102 – 290189DHPROSITE-ProRule annotationAdd
    BLAST
    Domaini319 – 418100PH 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini544 – 64198PH 2PROSITE-ProRule annotationAdd
    BLAST

    Domaini

    The FYVE-type zinc-finger is necessary for early endosome localization. Recruitment to endosomal membranes via this domain requires the presence of phosphatidylinositol 3-phosphate or other phosphatidylinositides By similarity.By similarity
    The PH domain is necessary for localization to the ruffle membrane. Recruitment to ruffle membrane occurs through binding of phosphoinositides by the PH domain. This domain also contributes to the lipid-binding properties of the protein By similarity.By similarity
    The DH domain is necessary for its ability to activate JNK1 via CDC42.By similarity

    Sequence similaritiesi

    Contains 1 DH (DBL-homology) domain.PROSITE-ProRule annotation
    Contains 1 FYVE-type zinc finger.PROSITE-ProRule annotation
    Contains 2 PH domains.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri458 – 51861FYVE-typePROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiNOG284234.
    HOVERGENiHBG007506.
    KOiK05721.
    OMAiYAAPQDM.
    OrthoDBiEOG7C2R0M.
    PhylomeDBiQ7Z6J4.
    TreeFamiTF316247.

    Family and domain databases

    Gene3Di1.20.900.10. 1 hit.
    2.30.29.30. 2 hits.
    3.30.40.10. 1 hit.
    InterProiIPR000219. DH-domain.
    IPR001849. PH_domain.
    IPR011993. PH_like_dom.
    IPR000306. Znf_FYVE.
    IPR017455. Znf_FYVE-rel.
    IPR011011. Znf_FYVE_PHD.
    IPR013083. Znf_RING/FYVE/PHD.
    [Graphical view]
    PfamiPF01363. FYVE. 1 hit.
    PF00169. PH. 1 hit.
    PF00621. RhoGEF. 1 hit.
    [Graphical view]
    SMARTiSM00064. FYVE. 1 hit.
    SM00233. PH. 2 hits.
    SM00325. RhoGEF. 1 hit.
    [Graphical view]
    SUPFAMiSSF48065. SSF48065. 1 hit.
    SSF57903. SSF57903. 1 hit.
    PROSITEiPS50010. DH_2. 1 hit.
    PS50003. PH_DOMAIN. 2 hits.
    PS50178. ZF_FYVE. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q7Z6J4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKGASEEKLA SVSNLVTVFE NSRTPEAAPR GQRLEDVHHR PECRPPESPG    50
    PREKTNVGEA VGSEPRTVSR RYLNSLKNKL SSEAWRKSCQ PVTLSGSGTQ 100
    EPEKKIVQEL LETEQAYVAR LHLLDQVFFQ ELLKTARSSK AFPEDVVRVI 150
    FSNISSIYQF HSQFFLPELQ RRLDDWTANP RIGDVIQKLA PFLKMYSEYV 200
    KNFERAAELL ATWTDKSPLF QEVLTRIQSS EASGSLTLQH HMLEPVQRIP 250
    RYELLLKEYI QKLPAQAPDQ ADAQKALDMI FSAAQHSNAA ITEMERLQDL 300
    WEVYQRLGLE DDIVDPSNTL LREGPVLKIS FRRNDPMERY LFLFNNMLLY 350
    CVPRVIQVGA QFQVRTRIDV AGMKVRELMD AEFPHSFLVS GKQRTLELQA 400
    RSQEEMISWM QAFQAAIDQI EKRNETFKAA AQGPEGDIQE QELQSEELGL 450
    RAPQWVRDKM VTMCMRCQEP FNALTRRRHH CRACGYVVCA RCSDYRAELK 500
    YDDNRPNRVC LHCYAFLTGN VLPEAKEDKR RGILEKGSSA TPDQSLMCSF 550
    LQLIGDKWGK SGPRGWCVIP RDDPLVLYVY AAPQDMRAHT SIPLLGYQVT 600
    VGPQGDPRVF QLQQSGQLYT FKAETEELKG RWVKAMERAA SGWSPSWPND 650
    GDLSD 655
    Length:655
    Mass (Da):74,892
    Last modified:October 1, 2003 - v1
    Checksum:iDB60098249C2B340
    GO
    Isoform 2 (identifier: Q7Z6J4-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-423: Missing.
         424-442: NETFKAAAQGPEGDIQEQE → MGGRRSPRAHSCPTPLNPQ
         585-655: DMRAHTSIPL...SWPNDGDLSD → VRPPPARPPSGPGLPTACV

    Note: No experimental confirmation available.

    Show »
    Length:180
    Mass (Da):20,193
    Checksum:i96FB2A2E1FE129C5
    GO
    Isoform 3 (identifier: Q7Z6J4-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-372: Missing.
         488-655: VCARCSDYRA...SWPNDGDLSD → STPASTPASTCVTQASTCITQASTFPT

    Note: No experimental confirmation available.

    Show »
    Length:142
    Mass (Da):16,086
    Checksum:i3BC622A79372D3FA
    GO
    Isoform 4 (identifier: Q7Z6J4-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-22: MKGASEEKLASVSNLVTVFENS → MFPKKARHPGAPALGICTRQPKSTPGTCCCFPCSPGRKPSGLSLLL
         101-104: EPEK → VPEG
         105-655: Missing.

    Note: May be due to an intron retention. No experimental confirmation available.

    Show »
    Length:128
    Mass (Da):13,825
    Checksum:iB6EB12FF70E7A602
    GO

    Sequence cautioni

    The sequence BAC85129.1 differs from that shown. Reason: Frameshift at position 460.
    The sequence BAB15746.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAC85129.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence CAI20471.1 differs from that shown. Reason: Erroneous gene model prediction.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti32 – 321Q → H.1 Publication
    Corresponds to variant rs831510 [ dbSNP | Ensembl ].
    VAR_021491

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 423423Missing in isoform 2. 1 PublicationVSP_013065Add
    BLAST
    Alternative sequencei1 – 372372Missing in isoform 3. 1 PublicationVSP_013066Add
    BLAST
    Alternative sequencei1 – 2222MKGAS…VFENS → MFPKKARHPGAPALGICTRQ PKSTPGTCCCFPCSPGRKPS GLSLLL in isoform 4. 1 PublicationVSP_013067Add
    BLAST
    Alternative sequencei101 – 1044EPEK → VPEG in isoform 4. 1 PublicationVSP_013068
    Alternative sequencei105 – 655551Missing in isoform 4. 1 PublicationVSP_038219Add
    BLAST
    Alternative sequencei424 – 44219NETFK…IQEQE → MGGRRSPRAHSCPTPLNPQ in isoform 2. 1 PublicationVSP_013070Add
    BLAST
    Alternative sequencei488 – 655168VCARC…GDLSD → STPASTPASTCVTQASTCIT QASTFPT in isoform 3. 1 PublicationVSP_013071Add
    BLAST
    Alternative sequencei585 – 65571DMRAH…GDLSD → VRPPPARPPSGPGLPTACV in isoform 2. 1 PublicationVSP_013072Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK024456 mRNA. Translation: BAB15746.1. Different initiation.
    AK097230 mRNA. Translation: BAC04982.1.
    AK131079 mRNA. Translation: BAC85129.1. Sequence problems.
    AL160264 Genomic DNA. Translation: CAI20471.1. Sequence problems.
    BC023645 mRNA. Translation: AAH23645.1.
    BC053655 mRNA. Translation: AAH53655.1.
    CCDSiCCDS4829.1. [Q7Z6J4-1]
    RefSeqiNP_775829.2. NM_173558.3. [Q7Z6J4-1]
    UniGeneiHs.509664.

    Genome annotation databases

    EnsembliENST00000274963; ENSP00000274963; ENSG00000146192. [Q7Z6J4-1]
    GeneIDi221472.
    KEGGihsa:221472.
    UCSCiuc003ong.2. human. [Q7Z6J4-1]
    uc003onj.1. human. [Q7Z6J4-2]

    Polymorphism databases

    DMDMi61213572.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK024456 mRNA. Translation: BAB15746.1 . Different initiation.
    AK097230 mRNA. Translation: BAC04982.1 .
    AK131079 mRNA. Translation: BAC85129.1 . Sequence problems.
    AL160264 Genomic DNA. Translation: CAI20471.1 . Sequence problems.
    BC023645 mRNA. Translation: AAH23645.1 .
    BC053655 mRNA. Translation: AAH53655.1 .
    CCDSi CCDS4829.1. [Q7Z6J4-1 ]
    RefSeqi NP_775829.2. NM_173558.3. [Q7Z6J4-1 ]
    UniGenei Hs.509664.

    3D structure databases

    ProteinModelPortali Q7Z6J4.
    SMRi Q7Z6J4. Positions 106-519, 566-639.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 128730. 1 interaction.
    STRINGi 9606.ENSP00000274963.

    PTM databases

    PhosphoSitei Q7Z6J4.

    Polymorphism databases

    DMDMi 61213572.

    Proteomic databases

    MaxQBi Q7Z6J4.
    PaxDbi Q7Z6J4.
    PRIDEi Q7Z6J4.

    Protocols and materials databases

    DNASUi 221472.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000274963 ; ENSP00000274963 ; ENSG00000146192 . [Q7Z6J4-1 ]
    GeneIDi 221472.
    KEGGi hsa:221472.
    UCSCi uc003ong.2. human. [Q7Z6J4-1 ]
    uc003onj.1. human. [Q7Z6J4-2 ]

    Organism-specific databases

    CTDi 221472.
    GeneCardsi GC06P036973.
    HGNCi HGNC:3664. FGD2.
    HPAi HPA029145.
    MIMi 605091. gene.
    neXtProti NX_Q7Z6J4.
    PharmGKBi PA28103.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG284234.
    HOVERGENi HBG007506.
    KOi K05721.
    OMAi YAAPQDM.
    OrthoDBi EOG7C2R0M.
    PhylomeDBi Q7Z6J4.
    TreeFami TF316247.

    Enzyme and pathway databases

    Reactomei REACT_11051. Rho GTPase cycle.
    REACT_13638. NRAGE signals death through JNK.
    REACT_18407. G alpha (12/13) signalling events.

    Miscellaneous databases

    ChiTaRSi FGD2. human.
    GeneWikii FGD2.
    GenomeRNAii 221472.
    NextBioi 91355.
    PROi Q7Z6J4.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q7Z6J4.
    Bgeei Q7Z6J4.
    CleanExi HS_FGD2.
    Genevestigatori Q7Z6J4.

    Family and domain databases

    Gene3Di 1.20.900.10. 1 hit.
    2.30.29.30. 2 hits.
    3.30.40.10. 1 hit.
    InterProi IPR000219. DH-domain.
    IPR001849. PH_domain.
    IPR011993. PH_like_dom.
    IPR000306. Znf_FYVE.
    IPR017455. Znf_FYVE-rel.
    IPR011011. Znf_FYVE_PHD.
    IPR013083. Znf_RING/FYVE/PHD.
    [Graphical view ]
    Pfami PF01363. FYVE. 1 hit.
    PF00169. PH. 1 hit.
    PF00621. RhoGEF. 1 hit.
    [Graphical view ]
    SMARTi SM00064. FYVE. 1 hit.
    SM00233. PH. 2 hits.
    SM00325. RhoGEF. 1 hit.
    [Graphical view ]
    SUPFAMi SSF48065. SSF48065. 1 hit.
    SSF57903. SSF57903. 1 hit.
    PROSITEi PS50010. DH_2. 1 hit.
    PS50003. PH_DOMAIN. 2 hits.
    PS50178. ZF_FYVE. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Characterization of long cDNA clones from human adult spleen."
      Hattori A., Okumura K., Nagase T., Kikuno R., Hirosawa M., Ohara O.
      DNA Res. 7:357-366(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Tissue: Spleen.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
      Tissue: Spleen.
    3. "The DNA sequence and analysis of human chromosome 6."
      Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
      , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
      Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT HIS-32.
      Tissue: Leukocyte and Lymph.

    Entry informationi

    Entry nameiFGD2_HUMAN
    AccessioniPrimary (citable) accession number: Q7Z6J4
    Secondary accession number(s): Q5T8I1
    , Q6P6A8, Q6ZNL5, Q8IZ32, Q8N868, Q9H7M2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 15, 2005
    Last sequence update: October 1, 2003
    Last modified: October 1, 2014
    This is version 106 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 6
      Human chromosome 6: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3