Q7Z6J4 (FGD2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 92.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: FYVE, RhoGEF and PH domain-containing protein 2 Alternative name(s): Zinc finger FYVE domain-containing protein 4 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 655 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Activates CDC42, a member of the Ras-like family of Rho- and Rac proteins, by exchanging bound GDP for free GTP. Activates JNK1 via CDC42 but not RAC1. Binds to phosphatidylinositol 4,5-bisphosphate, phosphatidylinositol 3,4,5-trisphosphate, phosphatidylinositol 5-monophosphate, phosphatidylinositol 4-monophosphate and phosphatidylinositol 3-monophosphate By similarity. |
| Subcellular location | Cytoplasm › cytoskeleton Probable. Cytoplasm By similarity. Nucleus By similarity. Early endosome By similarity. Early endosome membrane By similarity. Cell projection › ruffle membrane By similarity. Note: Recruitment to the endosome and ruffle membrane requires the presence of phosphoinositides By similarity. |
| Domain | The FYVE-type zinc-finger is necessary for early endosome localization. Recruitment to endosomal membranes via this domain requires the presence of phosphatidylinositol 3-phosphate or other phosphatidylinositides By similarity. The PH domain is necessary for localization to the ruffle membrane. Recruitment to ruffle membrane occurs through binding of phosphoinositides by the PH domain. This domain also contributes to the lipid-binding properties of the protein By similarity. The DH domain is necessary for its ability to activate JNK1 via CDC42 By similarity. |
| Sequence similarities | Contains 1 DH (DBL-homology) domain. Contains 1 FYVE-type zinc finger. Contains 2 PH domains. |
| Sequence caution | The sequence BAB15746.1 differs from that shown. Reason: Erroneous initiation. The sequence BAC85129.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence BAC85129.1 differs from that shown. Reason: Frameshift at position 460. The sequence CAI20471.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q7Z6J4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q7Z6J4-2) The sequence of this isoform differs from the canonical sequence as follows: 1-423: Missing. 424-442: NETFKAAAQGPEGDIQEQE → MGGRRSPRAHSCPTPLNPQ 585-655: DMRAHTSIPL...SWPNDGDLSD → VRPPPARPPSGPGLPTACV | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q7Z6J4-4) The sequence of this isoform differs from the canonical sequence as follows: 1-372: Missing. 488-655: VCARCSDYRA...SWPNDGDLSD → STPASTPASTCVTQASTCITQASTFPT | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q7Z6J4-5) The sequence of this isoform differs from the canonical sequence as follows: 1-22: MKGASEEKLASVSNLVTVFENS → MFPKKARHPGAPALGICTRQPKSTPGTCCCFPCSPGRKPSGLSLLL 101-104: EPEK → VPEG 105-655: Missing. | ||||||
| Note: May be due to an intron retention. No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 655 | 655 | FYVE, RhoGEF and PH domain-containing protein 2 | PRO_0000080942 | |||||
Regions | |||||||||
| Domain | 102 – 290 | 189 | DH | ||||||
| Domain | 319 – 418 | 100 | PH 1 | ||||||
| Domain | 544 – 641 | 98 | PH 2 | ||||||
| Zinc finger | 458 – 518 | 61 | FYVE-type | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 423 | 423 | Missing in isoform 2. | VSP_013065 | |||||
| Alternative sequence | 1 – 372 | 372 | Missing in isoform 3. | VSP_013066 | |||||
| Alternative sequence | 1 – 22 | 22 | MKGAS…VFENS → MFPKKARHPGAPALGICTRQ PKSTPGTCCCFPCSPGRKPS GLSLLL in isoform 4. | VSP_013067 | |||||
| Alternative sequence | 101 – 104 | 4 | EPEK → VPEG in isoform 4. | VSP_013068 | |||||
| Alternative sequence | 105 – 655 | 551 | Missing in isoform 4. | VSP_038219 | |||||
| Alternative sequence | 424 – 442 | 19 | NETFK…IQEQE → MGGRRSPRAHSCPTPLNPQ in isoform 2. | VSP_013070 | |||||
| Alternative sequence | 488 – 655 | 168 | VCARC…GDLSD → STPASTPASTCVTQASTCIT QASTFPT in isoform 3. | VSP_013071 | |||||
| Alternative sequence | 585 – 655 | 71 | DMRAH…GDLSD → VRPPPARPPSGPGLPTACV in isoform 2. | VSP_013072 | |||||
| Natural variant | 32 | 1 | Q → H. Ref.4 Corresponds to variant rs831510 [ dbSNP | Ensembl ]. | VAR_021491 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| [1] | "Characterization of long cDNA clones from human adult spleen." Hattori A., Okumura K., Nagase T., Kikuno R., Hirosawa M., Ohara O. DNA Res. 7:357-366(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Spleen. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). Tissue: Spleen. |
| [3] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT HIS-32. Tissue: Leukocyte and Lymph. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK024456 mRNA. Translation: BAB15746.1. Different initiation. AK097230 mRNA. Translation: BAC04982.1. AK131079 mRNA. Translation: BAC85129.1. Sequence problems. AL160264 Genomic DNA. Translation: CAI20471.1. Sequence problems. BC023645 mRNA. Translation: AAH23645.1. BC053655 mRNA. Translation: AAH53655.1. |
| IPI | IPI00217865. IPI00384678. IPI00386320. IPI00442361. |
| RefSeq | NP_775829.2. NM_173558.3. |
| UniGene | Hs.509664. |
3D structure databases | |
| ProteinModelPortal | Q7Z6J4. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000274963. |
PTM databases | |
| PhosphoSite | Q7Z6J4. |
Polymorphism databases | |
| DMDM | 61213572. |
Proteomic databases | |
| PaxDb | Q7Z6J4. |
| PRIDE | Q7Z6J4. |
Protocols and materials databases | |
| DNASU | 221472. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000274963; ENSP00000274963; ENSG00000146192. |
| GeneID | 221472. |
| KEGG | hsa:221472. |
| UCSC | uc003ong.2. human. uc003onj.1. human. |
Organism-specific databases | |
| CTD | 221472. |
| GeneCards | GC06P036973. |
| HGNC | HGNC:3664. FGD2. |
| HPA | HPA029145. |
| MIM | 605091. gene. |
| neXtProt | NX_Q7Z6J4. |
| PharmGKB | PA28103. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG284234. |
| HOVERGEN | HBG007506. |
| KO | K05721. |
| OMA | YAAPQDM. |
| OrthoDB | EOG4R23TD. |
| PhylomeDB | Q7Z6J4. |
Enzyme and pathway databases | |
| Reactome | REACT_111102. Signal Transduction. |
Gene expression databases | |
| ArrayExpress | Q7Z6J4. |
| Bgee | Q7Z6J4. |
| CleanEx | HS_FGD2. |
| Genevestigator | Q7Z6J4. |
| GermOnline | ENSG00000146192. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.20.900.10. 1 hit. 2.30.29.30. 2 hits. 3.30.40.10. 1 hit. |
| InterPro | IPR000219. DH-domain. IPR011993. PH_like_dom. IPR001849. Pleckstrin_homology. IPR000306. Znf_FYVE. IPR017455. Znf_FYVE-rel. IPR011011. Znf_FYVE_PHD. IPR013083. Znf_RING/FYVE/PHD. [Graphical view] |
| Pfam | PF01363. FYVE. 1 hit. PF00169. PH. 1 hit. PF00621. RhoGEF. 1 hit. [Graphical view] |
| SMART | SM00064. FYVE. 1 hit. SM00233. PH. 2 hits. SM00325. RhoGEF. 1 hit. [Graphical view] |
| SUPFAM | SSF48065. DH-domain. 1 hit. SSF57903. FYVE_PHD_ZnF. 1 hit. |
| PROSITE | PS50010. DH_2. 1 hit. PS50003. PH_DOMAIN. 2 hits. PS50178. ZF_FYVE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | FGD2. human. |
| GenomeRNAi | 221472. |
| NextBio | 91355. |
| SOURCE | Search... |
Entry information
| Entry name | FGD2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q7Z6J4 Secondary accession number(s): Q5T8I1 Q9H7M2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
