Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q7Z6J4

- FGD2_HUMAN

UniProt

Q7Z6J4 - FGD2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

FYVE, RhoGEF and PH domain-containing protein 2

Gene

FGD2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

Activates CDC42, a member of the Ras-like family of Rho- and Rac proteins, by exchanging bound GDP for free GTP. Activates JNK1 via CDC42 but not RAC1. Binds to phosphatidylinositol 4,5-bisphosphate, phosphatidylinositol 3,4,5-trisphosphate, phosphatidylinositol 5-monophosphate, phosphatidylinositol 4-monophosphate and phosphatidylinositol 3-monophosphate (By similarity).By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri458 – 51861FYVE-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. guanyl-nucleotide exchange factor activity Source: UniProtKB
  2. metal ion binding Source: UniProtKB-KW
  3. Rho guanyl-nucleotide exchange factor activity Source: InterPro
  4. small GTPase binding Source: UniProtKB

GO - Biological processi

  1. actin cytoskeleton organization Source: UniProtKB
  2. apoptotic signaling pathway Source: Reactome
  3. cytoskeleton organization Source: UniProtKB
  4. filopodium assembly Source: UniProtKB
  5. neurotrophin TRK receptor signaling pathway Source: Reactome
  6. positive regulation of apoptotic process Source: Reactome
  7. positive regulation of GTPase activity Source: GOC
  8. regulation of Cdc42 GTPase activity Source: UniProtKB
  9. regulation of cell shape Source: UniProtKB
  10. regulation of small GTPase mediated signal transduction Source: Reactome
  11. small GTPase mediated signal transduction Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Guanine-nucleotide releasing factor

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiREACT_11051. Rho GTPase cycle.
REACT_13638. NRAGE signals death through JNK.
REACT_18407. G alpha (12/13) signalling events.

Names & Taxonomyi

Protein namesi
Recommended name:
FYVE, RhoGEF and PH domain-containing protein 2
Alternative name(s):
Zinc finger FYVE domain-containing protein 4
Gene namesi
Name:FGD2
Synonyms:ZFYVE4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 6

Organism-specific databases

HGNCiHGNC:3664. FGD2.

Subcellular locationi

Cytoplasmcytoskeleton Curated. Cytoplasm By similarity. Nucleus By similarity. Early endosome By similarity. Early endosome membrane By similarity. Cell projectionruffle membrane By similarity
Note: Recruitment to the endosome and ruffle membrane requires the presence of phosphoinositides.By similarity

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
  2. cytoskeleton Source: UniProtKB-KW
  3. cytosol Source: Reactome
  4. endosome Source: UniProtKB-KW
  5. Golgi apparatus Source: UniProtKB
  6. lamellipodium Source: UniProtKB
  7. nucleus Source: UniProtKB-KW
  8. plasma membrane Source: UniProtKB-KW
  9. ruffle Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Endosome, Membrane, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA28103.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 655655FYVE, RhoGEF and PH domain-containing protein 2PRO_0000080942Add
BLAST

Proteomic databases

MaxQBiQ7Z6J4.
PaxDbiQ7Z6J4.
PRIDEiQ7Z6J4.

PTM databases

PhosphoSiteiQ7Z6J4.

Expressioni

Gene expression databases

BgeeiQ7Z6J4.
CleanExiHS_FGD2.
ExpressionAtlasiQ7Z6J4. baseline and differential.
GenevestigatoriQ7Z6J4.

Organism-specific databases

HPAiHPA029145.

Interactioni

Protein-protein interaction databases

BioGridi128730. 1 interaction.
STRINGi9606.ENSP00000274963.

Structurei

3D structure databases

ProteinModelPortaliQ7Z6J4.
SMRiQ7Z6J4. Positions 75-519, 566-639.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini102 – 290189DHPROSITE-ProRule annotationAdd
BLAST
Domaini319 – 418100PH 1PROSITE-ProRule annotationAdd
BLAST
Domaini544 – 64198PH 2PROSITE-ProRule annotationAdd
BLAST

Domaini

The FYVE-type zinc-finger is necessary for early endosome localization. Recruitment to endosomal membranes via this domain requires the presence of phosphatidylinositol 3-phosphate or other phosphatidylinositides (By similarity).By similarity
The PH domain is necessary for localization to the ruffle membrane. Recruitment to ruffle membrane occurs through binding of phosphoinositides by the PH domain. This domain also contributes to the lipid-binding properties of the protein (By similarity).By similarity
The DH domain is necessary for its ability to activate JNK1 via CDC42.By similarity

Sequence similaritiesi

Contains 1 DH (DBL-homology) domain.PROSITE-ProRule annotation
Contains 1 FYVE-type zinc finger.PROSITE-ProRule annotation
Contains 2 PH domains.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri458 – 51861FYVE-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiNOG284234.
GeneTreeiENSGT00750000117280.
HOVERGENiHBG007506.
InParanoidiQ7Z6J4.
KOiK05721.
OMAiYAAPQDM.
OrthoDBiEOG7C2R0M.
PhylomeDBiQ7Z6J4.
TreeFamiTF316247.

Family and domain databases

Gene3Di1.20.900.10. 1 hit.
2.30.29.30. 2 hits.
3.30.40.10. 1 hit.
InterProiIPR000219. DH-domain.
IPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR000306. Znf_FYVE.
IPR017455. Znf_FYVE-rel.
IPR011011. Znf_FYVE_PHD.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF01363. FYVE. 1 hit.
PF00169. PH. 1 hit.
PF00621. RhoGEF. 1 hit.
[Graphical view]
SMARTiSM00064. FYVE. 1 hit.
SM00233. PH. 2 hits.
SM00325. RhoGEF. 1 hit.
[Graphical view]
SUPFAMiSSF48065. SSF48065. 1 hit.
SSF57903. SSF57903. 1 hit.
PROSITEiPS50010. DH_2. 1 hit.
PS50003. PH_DOMAIN. 2 hits.
PS50178. ZF_FYVE. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q7Z6J4) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKGASEEKLA SVSNLVTVFE NSRTPEAAPR GQRLEDVHHR PECRPPESPG
60 70 80 90 100
PREKTNVGEA VGSEPRTVSR RYLNSLKNKL SSEAWRKSCQ PVTLSGSGTQ
110 120 130 140 150
EPEKKIVQEL LETEQAYVAR LHLLDQVFFQ ELLKTARSSK AFPEDVVRVI
160 170 180 190 200
FSNISSIYQF HSQFFLPELQ RRLDDWTANP RIGDVIQKLA PFLKMYSEYV
210 220 230 240 250
KNFERAAELL ATWTDKSPLF QEVLTRIQSS EASGSLTLQH HMLEPVQRIP
260 270 280 290 300
RYELLLKEYI QKLPAQAPDQ ADAQKALDMI FSAAQHSNAA ITEMERLQDL
310 320 330 340 350
WEVYQRLGLE DDIVDPSNTL LREGPVLKIS FRRNDPMERY LFLFNNMLLY
360 370 380 390 400
CVPRVIQVGA QFQVRTRIDV AGMKVRELMD AEFPHSFLVS GKQRTLELQA
410 420 430 440 450
RSQEEMISWM QAFQAAIDQI EKRNETFKAA AQGPEGDIQE QELQSEELGL
460 470 480 490 500
RAPQWVRDKM VTMCMRCQEP FNALTRRRHH CRACGYVVCA RCSDYRAELK
510 520 530 540 550
YDDNRPNRVC LHCYAFLTGN VLPEAKEDKR RGILEKGSSA TPDQSLMCSF
560 570 580 590 600
LQLIGDKWGK SGPRGWCVIP RDDPLVLYVY AAPQDMRAHT SIPLLGYQVT
610 620 630 640 650
VGPQGDPRVF QLQQSGQLYT FKAETEELKG RWVKAMERAA SGWSPSWPND

GDLSD
Length:655
Mass (Da):74,892
Last modified:October 1, 2003 - v1
Checksum:iDB60098249C2B340
GO
Isoform 2 (identifier: Q7Z6J4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-423: Missing.
     424-442: NETFKAAAQGPEGDIQEQE → MGGRRSPRAHSCPTPLNPQ
     585-655: DMRAHTSIPL...SWPNDGDLSD → VRPPPARPPSGPGLPTACV

Note: No experimental confirmation available.

Show »
Length:180
Mass (Da):20,193
Checksum:i96FB2A2E1FE129C5
GO
Isoform 3 (identifier: Q7Z6J4-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-372: Missing.
     488-655: VCARCSDYRA...SWPNDGDLSD → STPASTPASTCVTQASTCITQASTFPT

Note: No experimental confirmation available.

Show »
Length:142
Mass (Da):16,086
Checksum:i3BC622A79372D3FA
GO
Isoform 4 (identifier: Q7Z6J4-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: MKGASEEKLASVSNLVTVFENS → MFPKKARHPGAPALGICTRQPKSTPGTCCCFPCSPGRKPSGLSLLL
     101-104: EPEK → VPEG
     105-655: Missing.

Note: May be due to an intron retention. No experimental confirmation available.

Show »
Length:128
Mass (Da):13,825
Checksum:iB6EB12FF70E7A602
GO

Sequence cautioni

The sequence BAC85129.1 differs from that shown. Reason: Frameshift at position 460.
The sequence BAB15746.1 differs from that shown. Reason: Erroneous initiation.
The sequence BAC85129.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
The sequence CAI20471.1 differs from that shown. Reason: Erroneous gene model prediction.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti32 – 321Q → H.1 Publication
Corresponds to variant rs831510 [ dbSNP | Ensembl ].
VAR_021491

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 423423Missing in isoform 2. 1 PublicationVSP_013065Add
BLAST
Alternative sequencei1 – 372372Missing in isoform 3. 1 PublicationVSP_013066Add
BLAST
Alternative sequencei1 – 2222MKGAS…VFENS → MFPKKARHPGAPALGICTRQ PKSTPGTCCCFPCSPGRKPS GLSLLL in isoform 4. 1 PublicationVSP_013067Add
BLAST
Alternative sequencei101 – 1044EPEK → VPEG in isoform 4. 1 PublicationVSP_013068
Alternative sequencei105 – 655551Missing in isoform 4. 1 PublicationVSP_038219Add
BLAST
Alternative sequencei424 – 44219NETFK…IQEQE → MGGRRSPRAHSCPTPLNPQ in isoform 2. 1 PublicationVSP_013070Add
BLAST
Alternative sequencei488 – 655168VCARC…GDLSD → STPASTPASTCVTQASTCIT QASTFPT in isoform 3. 1 PublicationVSP_013071Add
BLAST
Alternative sequencei585 – 65571DMRAH…GDLSD → VRPPPARPPSGPGLPTACV in isoform 2. 1 PublicationVSP_013072Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK024456 mRNA. Translation: BAB15746.1. Different initiation.
AK097230 mRNA. Translation: BAC04982.1.
AK131079 mRNA. Translation: BAC85129.1. Sequence problems.
AL160264 Genomic DNA. Translation: CAI20471.1. Sequence problems.
BC023645 mRNA. Translation: AAH23645.1.
BC053655 mRNA. Translation: AAH53655.1.
CCDSiCCDS4829.1. [Q7Z6J4-1]
RefSeqiNP_775829.2. NM_173558.3. [Q7Z6J4-1]
UniGeneiHs.509664.

Genome annotation databases

EnsembliENST00000274963; ENSP00000274963; ENSG00000146192. [Q7Z6J4-1]
GeneIDi221472.
KEGGihsa:221472.
UCSCiuc003ong.2. human. [Q7Z6J4-1]
uc003onj.1. human. [Q7Z6J4-2]

Polymorphism databases

DMDMi61213572.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK024456 mRNA. Translation: BAB15746.1 . Different initiation.
AK097230 mRNA. Translation: BAC04982.1 .
AK131079 mRNA. Translation: BAC85129.1 . Sequence problems.
AL160264 Genomic DNA. Translation: CAI20471.1 . Sequence problems.
BC023645 mRNA. Translation: AAH23645.1 .
BC053655 mRNA. Translation: AAH53655.1 .
CCDSi CCDS4829.1. [Q7Z6J4-1 ]
RefSeqi NP_775829.2. NM_173558.3. [Q7Z6J4-1 ]
UniGenei Hs.509664.

3D structure databases

ProteinModelPortali Q7Z6J4.
SMRi Q7Z6J4. Positions 75-519, 566-639.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 128730. 1 interaction.
STRINGi 9606.ENSP00000274963.

PTM databases

PhosphoSitei Q7Z6J4.

Polymorphism databases

DMDMi 61213572.

Proteomic databases

MaxQBi Q7Z6J4.
PaxDbi Q7Z6J4.
PRIDEi Q7Z6J4.

Protocols and materials databases

DNASUi 221472.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000274963 ; ENSP00000274963 ; ENSG00000146192 . [Q7Z6J4-1 ]
GeneIDi 221472.
KEGGi hsa:221472.
UCSCi uc003ong.2. human. [Q7Z6J4-1 ]
uc003onj.1. human. [Q7Z6J4-2 ]

Organism-specific databases

CTDi 221472.
GeneCardsi GC06P036973.
HGNCi HGNC:3664. FGD2.
HPAi HPA029145.
MIMi 605091. gene.
neXtProti NX_Q7Z6J4.
PharmGKBi PA28103.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG284234.
GeneTreei ENSGT00750000117280.
HOVERGENi HBG007506.
InParanoidi Q7Z6J4.
KOi K05721.
OMAi YAAPQDM.
OrthoDBi EOG7C2R0M.
PhylomeDBi Q7Z6J4.
TreeFami TF316247.

Enzyme and pathway databases

Reactomei REACT_11051. Rho GTPase cycle.
REACT_13638. NRAGE signals death through JNK.
REACT_18407. G alpha (12/13) signalling events.

Miscellaneous databases

ChiTaRSi FGD2. human.
GeneWikii FGD2.
GenomeRNAii 221472.
NextBioi 91355.
PROi Q7Z6J4.
SOURCEi Search...

Gene expression databases

Bgeei Q7Z6J4.
CleanExi HS_FGD2.
ExpressionAtlasi Q7Z6J4. baseline and differential.
Genevestigatori Q7Z6J4.

Family and domain databases

Gene3Di 1.20.900.10. 1 hit.
2.30.29.30. 2 hits.
3.30.40.10. 1 hit.
InterProi IPR000219. DH-domain.
IPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR000306. Znf_FYVE.
IPR017455. Znf_FYVE-rel.
IPR011011. Znf_FYVE_PHD.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view ]
Pfami PF01363. FYVE. 1 hit.
PF00169. PH. 1 hit.
PF00621. RhoGEF. 1 hit.
[Graphical view ]
SMARTi SM00064. FYVE. 1 hit.
SM00233. PH. 2 hits.
SM00325. RhoGEF. 1 hit.
[Graphical view ]
SUPFAMi SSF48065. SSF48065. 1 hit.
SSF57903. SSF57903. 1 hit.
PROSITEi PS50010. DH_2. 1 hit.
PS50003. PH_DOMAIN. 2 hits.
PS50178. ZF_FYVE. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Characterization of long cDNA clones from human adult spleen."
    Hattori A., Okumura K., Nagase T., Kikuno R., Hirosawa M., Ohara O.
    DNA Res. 7:357-366(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Spleen.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Tissue: Spleen.
  3. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT HIS-32.
    Tissue: Leukocyte and Lymph.

Entry informationi

Entry nameiFGD2_HUMAN
AccessioniPrimary (citable) accession number: Q7Z6J4
Secondary accession number(s): Q5T8I1
, Q6P6A8, Q6ZNL5, Q8IZ32, Q8N868, Q9H7M2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 15, 2005
Last sequence update: October 1, 2003
Last modified: October 29, 2014
This is version 107 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3