Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ankyrin repeat and sterile alpha motif domain-containing protein 1B

Gene

ANKS1B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Isoform 2 may participate in the regulation of nucleoplasmic coilin protein interactions in neuronal and transformed cells.
Isoform 3 can regulate global protein synthesis by altering nucleolar numbers.By similarity2 Publications
Isoform 4 may play a role as a modulator of APP processing. Overexpression can down-regulate APP processing.

GO - Molecular functioni

  • ephrin receptor binding Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Ankyrin repeat and sterile alpha motif domain-containing protein 1B
Alternative name(s):
Amyloid-beta protein intracellular domain-associated protein 1
Short name:
AIDA-1
E2A-PBX1-associated protein
Short name:
EB-1
Gene namesi
Name:ANKS1B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:24600. ANKS1B.

Subcellular locationi

Isoform 3 :
Isoform 4 :
  • Nucleus

  • Note: The interaction with APP causes its partial exclusion from the nucleus, when APP is overexpressed.

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Membrane, Nucleus, Postsynaptic cell membrane, Synapse

Pathology & Biotechi

Organism-specific databases

DisGeNETi56899.
OpenTargetsiENSG00000185046.
PharmGKBiPA128394692.

Polymorphism and mutation databases

BioMutaiANKS1B.
DMDMi332278155.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003272591 – 1248Ankyrin repeat and sterile alpha motif domain-containing protein 1BAdd BLAST1248

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei309PhosphoserineBy similarity1
Modified residuei310PhosphoserineBy similarity1
Modified residuei314PhosphoserineBy similarity1
Modified residuei353PhosphoserineBy similarity1
Modified residuei364PhosphoserineBy similarity1
Modified residuei503PhosphothreonineBy similarity1
Modified residuei507PhosphoserineBy similarity1
Modified residuei510PhosphoserineBy similarity1
Modified residuei738PhosphoserineBy similarity1
Modified residuei773PhosphothreonineBy similarity1
Modified residuei775PhosphoserineBy similarity1
Modified residuei901PhosphotyrosineBy similarity1
Modified residuei974PhosphoserineBy similarity1
Modified residuei1007PhosphotyrosineBy similarity1

Post-translational modificationi

Isoform 3 nuclear translocation requires an NMDAR-dependent proteolytic cleavage.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ7Z6G8.
MaxQBiQ7Z6G8.
PaxDbiQ7Z6G8.
PeptideAtlasiQ7Z6G8.
PRIDEiQ7Z6G8.

PTM databases

iPTMnetiQ7Z6G8.
PhosphoSitePlusiQ7Z6G8.
SwissPalmiQ7Z6G8.

Expressioni

Tissue specificityi

Highly expressed in marrow from patients with pre-B ALL associated with the t(1;19) translocation. Strongly expressed in brain and testis. Expressed in fetal brain. Isoform 4 is highly expressed in brain (at protein level). Isoform 6 is expressed in brain and several cancer cell lines.2 Publications

Inductioni

Transcriptionally up-regulated in t(1:19) pre-B cell acute lymphocytic leukemia by the chimeric TCF3-PBX1. Not expressed in pre-B cell that lack this translocation.2 Publications

Gene expression databases

BgeeiENSG00000185046.
ExpressionAtlasiQ7Z6G8. baseline and differential.
GenevisibleiQ7Z6G8. HS.

Organism-specific databases

HPAiHPA044628.

Interactioni

Subunit structurei

Isoform 3 interacts with DLG4 (By similarity). Interacts with EPHA8. Isoform 2 interacts with COIL. Isoform 4 interacts with APP and EPHA8. Isoform 6 interacts with EPHA8.By similarity4 Publications

GO - Molecular functioni

  • ephrin receptor binding Source: UniProtKB

Protein-protein interaction databases

BioGridi121229. 9 interactors.
DIPiDIP-41406N.
IntActiQ7Z6G8. 4 interactors.
MINTiMINT-258807.
STRINGi9606.ENSP00000449629.

Structurei

Secondary structure

11248
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi815 – 822Combined sources8
Helixi825 – 827Combined sources3
Helixi828 – 833Combined sources6
Turni834 – 837Combined sources4
Turni839 – 841Combined sources3
Beta strandi842 – 847Combined sources6
Helixi851 – 854Combined sources4
Helixi860 – 872Combined sources13
Helixi889 – 894Combined sources6
Turni895 – 897Combined sources3
Helixi901 – 908Combined sources8
Helixi913 – 916Combined sources4
Helixi921 – 927Combined sources7
Helixi933 – 943Combined sources11
Turni1056 – 1058Combined sources3
Beta strandi1059 – 1074Combined sources16
Helixi1078 – 1091Combined sources14
Beta strandi1094 – 1097Combined sources4
Beta strandi1104 – 1110Combined sources7
Beta strandi1113 – 1121Combined sources9
Beta strandi1124 – 1128Combined sources5
Helixi1130 – 1132Combined sources3
Beta strandi1133 – 1138Combined sources6
Beta strandi1145 – 1150Combined sources6
Turni1153 – 1155Combined sources3
Beta strandi1156 – 1167Combined sources12
Helixi1168 – 1186Combined sources19

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2EAMNMR-A808-874[»]
2KE7NMR-A808-893[»]
2KIVNMR-A812-946[»]
2M38NMR-A1042-1194[»]
ProteinModelPortaliQ7Z6G8.
SMRiQ7Z6G8.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ7Z6G8.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati2 – 31ANK 1Add BLAST30
Repeati58 – 87ANK 2Add BLAST30
Repeati91 – 120ANK 3Add BLAST30
Repeati127 – 156ANK 4Add BLAST30
Repeati160 – 189ANK 5Add BLAST30
Repeati193 – 222ANK 6Add BLAST30
Repeati225 – 254ANK 7Add BLAST30
Domaini810 – 876SAM 1PROSITE-ProRule annotationAdd BLAST67
Domaini884 – 949SAM 2PROSITE-ProRule annotationAdd BLAST66
Domaini1056 – 1213PIDPROSITE-ProRule annotationAdd BLAST158

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi935 – 938Nuclear localization signal1 Publication4

Sequence similaritiesi

Contains 7 ANK repeats.PROSITE-ProRule annotation
Contains 1 PID domain.PROSITE-ProRule annotation
Contains 2 SAM (sterile alpha motif) domains.PROSITE-ProRule annotation

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

eggNOGiKOG0507. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00530000063104.
HOGENOMiHOG000007214.
HOVERGENiHBG050506.
InParanoidiQ7Z6G8.
OMAiRNGDQWV.
OrthoDBiEOG091G00YV.
TreeFamiTF320582.

Family and domain databases

Gene3Di1.10.150.50. 2 hits.
1.25.40.20. 3 hits.
2.30.29.30. 1 hit.
InterProiIPR033635. ANKS1.
IPR033636. ANKS1B.
IPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR011993. PH_dom-like.
IPR006020. PTB/PI_dom.
IPR001660. SAM.
IPR013761. SAM/pointed.
[Graphical view]
PANTHERiPTHR24174. PTHR24174. 1 hit.
PTHR24174:SF3. PTHR24174:SF3. 1 hit.
PfamiPF12796. Ank_2. 3 hits.
PF00640. PID. 1 hit.
PF00536. SAM_1. 2 hits.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 6 hits.
SM00462. PTB. 1 hit.
SM00454. SAM. 2 hits.
[Graphical view]
SUPFAMiSSF47769. SSF47769. 2 hits.
SSF48403. SSF48403. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 5 hits.
PS01179. PID. 1 hit.
PS50105. SAM_DOMAIN. 2 hits.
[Graphical view]

Sequences (10)i

Sequence statusi: Complete.

This entry describes 10 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7Z6G8-1) [UniParc]FASTAAdd to basket
Also known as: AIDA-1b

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGKDQELLEA ARTGNVALVE KLLSGRKGGI LGGGSGPLPL SNLLSIWRGP
60 70 80 90 100
NVNCTDSSGY TALHHAALNG HKDIVLKLLQ YEASTNVADN KGYFPIHLAA
110 120 130 140 150
WKGDVEIVKI LIHHGPSHSR VNEQNNENET ALHCAAQYGH SEVVAVLLEE
160 170 180 190 200
LTDPTIRNSK LETPLDLAAL YGRLRVVKMI ISAHPNLMSC NTRKHTPLHL
210 220 230 240 250
AARNGHKAVV QVLLEAGMDV SCQTEKGSAL HEAALFGKVD VVRVLLETGI
260 270 280 290 300
DANIKDSLGR TVLDILKEHP SQKSLQIATL LQEYLEGVGR STVLEEPVQE
310 320 330 340 350
DATQETHISS PVESPSQKTK SETVTGELSK LLDEIKLCQE KDYSFEDLCH
360 370 380 390 400
TISDHYLDNL SKISEEELGK NGSQSVRTSS TINLSPGEVE EEDDDENTCG
410 420 430 440 450
PSGLWEALTP CNGCRNLGFP MLAQESYPKK RNYTMEIVPS ASLDTFPSEN
460 470 480 490 500
ENFLCDLMDT AVTKKPCSLE IARAPSPRTD NASEVAVTTP GTSNHRNSST
510 520 530 540 550
GPTPDCSPPS PDTALKNIVK VIRPQPKQRT SIVSSLDFHR MNHNQEYFEI
560 570 580 590 600
NTSTGCTSFT ASPPASPPTS SVGTTEVKNE GTNHTDDLSR QDDNDPPKEY
610 620 630 640 650
DPGQFAGLLH GSSPACESPE NPFHLYGKRE QCEKGQDEVS LANSPLPFKQ
660 670 680 690 700
SPIENNSEPL VKKIKPKVVS RTIFHKKSNQ LENHTIVGTR STRSGSRNGD
710 720 730 740 750
QWVMNAGGFV ERACTLGRIR SLPKALIDMH LSKSVSKSDS DLIAYPSNEK
760 770 780 790 800
TSRVNWSESS TAEHSSKGNS ERTPSFTSEW EEIDKIMSSI DVGINNELKE
810 820 830 840 850
MNGETTRPRC PVQTVGQWLE SIGLPQYENH LMANGFDNVQ FMGSNVMEDQ
860 870 880 890 900
DLLEIGILNS GHRQRILQAI QLLPKMRPIG HDGYHPTSVA EWLDSIELGD
910 920 930 940 950
YTKAFLINGY TSMDLLKKIW EVELINVLKI NLIGHRKRIL ASLGDRLHDD
960 970 980 990 1000
PPQKPPRSIT LREPSGNHTP PQLSPSLSQS TYTTGGSLDV PHIIMQGDAR
1010 1020 1030 1040 1050
RRRNENYFDD IPRSKLERQM AQTGDWGEPS ITLRPPNEAT ASTPVQYWQH
1060 1070 1080 1090 1100
HPEKLIFQSC DYKAFYLGSM LIKELRGTES TQDACAKMRA NCQKSTEQMK
1110 1120 1130 1140 1150
KVPTIILSVS YKGVKFIDAT NKNIIAEHEI RNISCAAQDP EDLSTFAYIT
1160 1170 1180 1190 1200
KDLKSNHHYC HVFTAFDVNL AYEIILTLGQ AFEVAYQLAL QARKGGHSST
1210 1220 1230 1240
LPESFENKPS KPIPKPRVSI RKSVDLLHAS HTGQEPSERH TEEALRKF
Length:1,248
Mass (Da):138,066
Last modified:May 3, 2011 - v2
Checksum:iEC3921C45083426D
GO
Isoform 2 (identifier: Q7Z6G8-2) [UniParc]FASTAAdd to basket
Also known as: AIDA-1c

The sequence of this isoform differs from the canonical sequence as follows:
     1-774: Missing.
     775-807: SFTSEWEEIDKIMSSIDVGINNELKEMNGETTR → MMWQCHLSAQDYRYYPVDGYSLLKRFPLHPLTG
     963-1022: Missing.
     1225-1248: DLLHASHTGQEPSERHTEEALRKF → QIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF

Show »
Length:426
Mass (Da):48,432
Checksum:i0AE12663DD16CAC2
GO
Isoform 3 (identifier: Q7Z6G8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-774: Missing.
     775-807: SFTSEWEEIDKIMSSIDVGINNELKEMNGETTR → MMWQCHLSAQDYRYYPVDGYSLLKRFPLHPLTG
     1022-1022: Q → QSSVCEIWTNQNAGFPFSAIHQVHN
     1225-1248: DLLHASHTGQEPSERHTEEALRKF → QIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF

Show »
Length:510
Mass (Da):57,865
Checksum:i882DB0117D894E54
GO
Isoform 4 (identifier: Q7Z6G8-4) [UniParc]FASTAAdd to basket
Also known as: AIDA-1a

The sequence of this isoform differs from the canonical sequence as follows:
     1-774: Missing.
     775-807: SFTSEWEEIDKIMSSIDVGINNELKEMNGETTR → MMWQCHLSAQDYRYYPVDGYSLLKRFPLHPLTG
     1225-1248: DLLHASHTGQEPSERHTEEALRKF → PFCFKADRPI

Show »
Length:460
Mass (Da):52,273
Checksum:i34A6DD31C86685CD
GO
Isoform 5 (identifier: Q7Z6G8-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-774: Missing.
     775-807: SFTSEWEEIDKIMSSIDVGINNELKEMNGETTR → MMWQCHLSAQDYRYYPVDGYSLLKRFPLHPLTG
     963-1022: EPSGNHTPPQ...RSKLERQMAQ → SSVCEIWTNQNAGFPFSAIHQVHN
     1225-1248: DLLHASHTGQEPSERHTEEALRKF → QIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF

Show »
Length:450
Mass (Da):51,100
Checksum:i7513E87841E4A57C
GO
Isoform 6 (identifier: Q7Z6G8-6) [UniParc]FASTAAdd to basket
Also known as: AIDA-1bDeltaAnk

The sequence of this isoform differs from the canonical sequence as follows:
     1-420: Missing.
     804-807: Missing.
     963-1022: Missing.

Show »
Length:764
Mass (Da):85,202
Checksum:i7C107E6688522EF0
GO
Isoform 7 (identifier: Q7Z6G8-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-774: Missing.
     775-807: SFTSEWEEIDKIMSSIDVGINNELKEMNGETTR → MMWQCHLSAQDYRYYPVDGYSLLKRFPLHPLTG
     963-1022: Missing.

Show »
Length:414
Mass (Da):47,104
Checksum:iAD92EB5F8954E011
GO
Isoform 8 (identifier: Q7Z6G8-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-831: Missing.
     927-1022: VLKINLIGHR...RSKLERQMAQ → QSSVCEIWTNQNAGFPFSAIHQVHN
     1225-1247: DLLHASHTGQEPSERHTEEALRK → IDPSEQKTLANLPWIVEPGQEAKRGINTKYETTI

Show »
Length:357
Mass (Da):40,277
Checksum:i07892A522BFC2835
GO
Isoform 9 (identifier: Q7Z6G8-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-994: Missing.

Note: No experimental confirmation available.
Show »
Length:254
Mass (Da):28,943
Checksum:i33299F04446DCF7F
GO
Isoform 10 (identifier: Q7Z6G8-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     3-807: Missing.
     963-1022: Missing.
     1225-1247: DLLHASHTGQEPSERHTEEALRK → IDPSEQKTLANLPWIVEPGQEAKRGINTKYETTI

Note: No experimental confirmation available.
Show »
Length:394
Mass (Da):44,522
Checksum:iD921575BBFF3C4C6
GO

Sequence cautioni

The sequence AAP38184 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti290 – 291RS → KYA in AAP37612 (PubMed:15004329).Curated2
Sequence conflicti813Q → L in BAF82457 (PubMed:14702039).Curated1
Sequence conflicti854E → G in AAI42670 (PubMed:15489334).Curated1
Sequence conflicti1160C → R in BAG57507 (PubMed:14702039).Curated1
Sequence conflicti1167D → G in BAG58059 (PubMed:14702039).Curated1
Isoform 8 (identifier: Q7Z6G8-8)
Sequence conflicti325P → R in AAH68451 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0464141 – 994Missing in isoform 9. 1 PublicationAdd BLAST994
Alternative sequenceiVSP_0327011 – 831Missing in isoform 8. 1 PublicationAdd BLAST831
Alternative sequenceiVSP_0327021 – 774Missing in isoform 3, isoform 4, isoform 5, isoform 2 and isoform 7. 5 PublicationsAdd BLAST774
Alternative sequenceiVSP_0327031 – 420Missing in isoform 6. 1 PublicationAdd BLAST420
Alternative sequenceiVSP_0464153 – 807Missing in isoform 10. 1 PublicationAdd BLAST805
Alternative sequenceiVSP_032704775 – 807SFTSE…GETTR → MMWQCHLSAQDYRYYPVDGY SLLKRFPLHPLTG in isoform 3, isoform 4, isoform 5, isoform 2 and isoform 7. 5 PublicationsAdd BLAST33
Alternative sequenceiVSP_032705804 – 807Missing in isoform 6. 1 Publication4
Alternative sequenceiVSP_032706927 – 1022VLKIN…RQMAQ → QSSVCEIWTNQNAGFPFSAI HQVHN in isoform 8. 1 PublicationAdd BLAST96
Alternative sequenceiVSP_032707963 – 1022Missing in isoform 2, isoform 6, isoform 7 and isoform 10. 5 PublicationsAdd BLAST60
Alternative sequenceiVSP_032708963 – 1022EPSGN…RQMAQ → SSVCEIWTNQNAGFPFSAIH QVHN in isoform 5. 1 PublicationAdd BLAST60
Alternative sequenceiVSP_0327091022Q → QSSVCEIWTNQNAGFPFSAI HQVHN in isoform 3. 2 Publications1
Alternative sequenceiVSP_0327101225 – 1248DLLHA…ALRKF → QIDPSEQKTLANLPWIVEPG QEAKRGINTKYETTIF in isoform 3, isoform 5 and isoform 2. 3 PublicationsAdd BLAST24
Alternative sequenceiVSP_0327111225 – 1248DLLHA…ALRKF → PFCFKADRPI in isoform 4. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_0327121225 – 1247DLLHA…EALRK → IDPSEQKTLANLPWIVEPGQ EAKRGINTKYETTI in isoform 8 and isoform 10. 2 PublicationsAdd BLAST23

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY281131 mRNA. Translation: AAP37612.1.
AY281132 mRNA. Translation: AAP37613.1.
AY283057 mRNA. Translation: AAP38184.2. Different initiation.
AY753193 mRNA. Translation: AAV28691.1.
AF164792 mRNA. Translation: AAF80756.1.
AK289768 mRNA. Translation: BAF82457.1.
AK294191 mRNA. Translation: BAG57507.1.
AK294994 mRNA. Translation: BAG58059.1.
AC008126 Genomic DNA. No translation available.
AC011248 Genomic DNA. No translation available.
AC021653 Genomic DNA. No translation available.
AC048330 Genomic DNA. No translation available.
AC069437 Genomic DNA. No translation available.
AC078916 Genomic DNA. No translation available.
AC079954 Genomic DNA. No translation available.
AC084374 Genomic DNA. No translation available.
AC117377 Genomic DNA. No translation available.
AC126616 Genomic DNA. No translation available.
AC141554 Genomic DNA. No translation available.
AC141555 Genomic DNA. No translation available.
AC141556 Genomic DNA. No translation available.
BC026313 mRNA. Translation: AAH26313.2.
BC068451 mRNA. Translation: AAH68451.1.
BC142669 mRNA. Translation: AAI42670.1.
BC150204 mRNA. Translation: AAI50205.1.
AF145204 mRNA. Translation: AAD33951.1.
AY620824 mRNA. Translation: AAT39519.1.
CCDSiCCDS55864.1. [Q7Z6G8-9]
CCDS55865.1. [Q7Z6G8-8]
CCDS55866.1. [Q7Z6G8-7]
CCDS55867.1. [Q7Z6G8-2]
CCDS55868.1. [Q7Z6G8-5]
CCDS55869.1. [Q7Z6G8-4]
CCDS55870.1. [Q7Z6G8-3]
CCDS55871.1. [Q7Z6G8-10]
CCDS55872.1. [Q7Z6G8-1]
RefSeqiNP_001190994.1. NM_001204065.1.
NP_001190995.1. NM_001204066.1. [Q7Z6G8-8]
NP_001190996.1. NM_001204067.1. [Q7Z6G8-10]
NP_001190997.1. NM_001204068.1. [Q7Z6G8-4]
NP_001190998.1. NM_001204069.1. [Q7Z6G8-5]
NP_001190999.1. NM_001204070.1. [Q7Z6G8-2]
NP_001191008.1. NM_001204079.1.
NP_001191009.1. NM_001204080.1.
NP_001191010.1. NM_001204081.1. [Q7Z6G8-9]
NP_064525.1. NM_020140.3. [Q7Z6G8-7]
NP_690001.3. NM_152788.4. [Q7Z6G8-1]
NP_858056.2. NM_181670.3. [Q7Z6G8-3]
UniGeneiHs.506458.

Genome annotation databases

EnsembliENST00000341752; ENSP00000345510; ENSG00000185046. [Q7Z6G8-9]
ENST00000546568; ENSP00000448205; ENSG00000185046. [Q7Z6G8-2]
ENST00000546960; ENSP00000447839; ENSG00000185046. [Q7Z6G8-4]
ENST00000547010; ENSP00000448512; ENSG00000185046. [Q7Z6G8-6]
ENST00000547446; ENSP00000450015; ENSG00000185046. [Q7Z6G8-10]
ENST00000547776; ENSP00000449629; ENSG00000185046. [Q7Z6G8-1]
ENST00000549025; ENSP00000447312; ENSG00000185046. [Q7Z6G8-8]
ENST00000549493; ENSP00000448203; ENSG00000185046. [Q7Z6G8-3]
ENST00000549558; ENSP00000448993; ENSG00000185046. [Q7Z6G8-7]
ENST00000550693; ENSP00000447999; ENSG00000185046. [Q7Z6G8-5]
GeneIDi56899.
KEGGihsa:56899.
UCSCiuc001tgd.3. human. [Q7Z6G8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY281131 mRNA. Translation: AAP37612.1.
AY281132 mRNA. Translation: AAP37613.1.
AY283057 mRNA. Translation: AAP38184.2. Different initiation.
AY753193 mRNA. Translation: AAV28691.1.
AF164792 mRNA. Translation: AAF80756.1.
AK289768 mRNA. Translation: BAF82457.1.
AK294191 mRNA. Translation: BAG57507.1.
AK294994 mRNA. Translation: BAG58059.1.
AC008126 Genomic DNA. No translation available.
AC011248 Genomic DNA. No translation available.
AC021653 Genomic DNA. No translation available.
AC048330 Genomic DNA. No translation available.
AC069437 Genomic DNA. No translation available.
AC078916 Genomic DNA. No translation available.
AC079954 Genomic DNA. No translation available.
AC084374 Genomic DNA. No translation available.
AC117377 Genomic DNA. No translation available.
AC126616 Genomic DNA. No translation available.
AC141554 Genomic DNA. No translation available.
AC141555 Genomic DNA. No translation available.
AC141556 Genomic DNA. No translation available.
BC026313 mRNA. Translation: AAH26313.2.
BC068451 mRNA. Translation: AAH68451.1.
BC142669 mRNA. Translation: AAI42670.1.
BC150204 mRNA. Translation: AAI50205.1.
AF145204 mRNA. Translation: AAD33951.1.
AY620824 mRNA. Translation: AAT39519.1.
CCDSiCCDS55864.1. [Q7Z6G8-9]
CCDS55865.1. [Q7Z6G8-8]
CCDS55866.1. [Q7Z6G8-7]
CCDS55867.1. [Q7Z6G8-2]
CCDS55868.1. [Q7Z6G8-5]
CCDS55869.1. [Q7Z6G8-4]
CCDS55870.1. [Q7Z6G8-3]
CCDS55871.1. [Q7Z6G8-10]
CCDS55872.1. [Q7Z6G8-1]
RefSeqiNP_001190994.1. NM_001204065.1.
NP_001190995.1. NM_001204066.1. [Q7Z6G8-8]
NP_001190996.1. NM_001204067.1. [Q7Z6G8-10]
NP_001190997.1. NM_001204068.1. [Q7Z6G8-4]
NP_001190998.1. NM_001204069.1. [Q7Z6G8-5]
NP_001190999.1. NM_001204070.1. [Q7Z6G8-2]
NP_001191008.1. NM_001204079.1.
NP_001191009.1. NM_001204080.1.
NP_001191010.1. NM_001204081.1. [Q7Z6G8-9]
NP_064525.1. NM_020140.3. [Q7Z6G8-7]
NP_690001.3. NM_152788.4. [Q7Z6G8-1]
NP_858056.2. NM_181670.3. [Q7Z6G8-3]
UniGeneiHs.506458.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2EAMNMR-A808-874[»]
2KE7NMR-A808-893[»]
2KIVNMR-A812-946[»]
2M38NMR-A1042-1194[»]
ProteinModelPortaliQ7Z6G8.
SMRiQ7Z6G8.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121229. 9 interactors.
DIPiDIP-41406N.
IntActiQ7Z6G8. 4 interactors.
MINTiMINT-258807.
STRINGi9606.ENSP00000449629.

PTM databases

iPTMnetiQ7Z6G8.
PhosphoSitePlusiQ7Z6G8.
SwissPalmiQ7Z6G8.

Polymorphism and mutation databases

BioMutaiANKS1B.
DMDMi332278155.

Proteomic databases

EPDiQ7Z6G8.
MaxQBiQ7Z6G8.
PaxDbiQ7Z6G8.
PeptideAtlasiQ7Z6G8.
PRIDEiQ7Z6G8.

Protocols and materials databases

DNASUi56899.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000341752; ENSP00000345510; ENSG00000185046. [Q7Z6G8-9]
ENST00000546568; ENSP00000448205; ENSG00000185046. [Q7Z6G8-2]
ENST00000546960; ENSP00000447839; ENSG00000185046. [Q7Z6G8-4]
ENST00000547010; ENSP00000448512; ENSG00000185046. [Q7Z6G8-6]
ENST00000547446; ENSP00000450015; ENSG00000185046. [Q7Z6G8-10]
ENST00000547776; ENSP00000449629; ENSG00000185046. [Q7Z6G8-1]
ENST00000549025; ENSP00000447312; ENSG00000185046. [Q7Z6G8-8]
ENST00000549493; ENSP00000448203; ENSG00000185046. [Q7Z6G8-3]
ENST00000549558; ENSP00000448993; ENSG00000185046. [Q7Z6G8-7]
ENST00000550693; ENSP00000447999; ENSG00000185046. [Q7Z6G8-5]
GeneIDi56899.
KEGGihsa:56899.
UCSCiuc001tgd.3. human. [Q7Z6G8-1]

Organism-specific databases

CTDi56899.
DisGeNETi56899.
GeneCardsiANKS1B.
HGNCiHGNC:24600. ANKS1B.
HPAiHPA044628.
MIMi607815. gene.
neXtProtiNX_Q7Z6G8.
OpenTargetsiENSG00000185046.
PharmGKBiPA128394692.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0507. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00530000063104.
HOGENOMiHOG000007214.
HOVERGENiHBG050506.
InParanoidiQ7Z6G8.
OMAiRNGDQWV.
OrthoDBiEOG091G00YV.
TreeFamiTF320582.

Miscellaneous databases

ChiTaRSiANKS1B. human.
EvolutionaryTraceiQ7Z6G8.
GeneWikiiANKS1B.
GenomeRNAii56899.
PROiQ7Z6G8.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000185046.
ExpressionAtlasiQ7Z6G8. baseline and differential.
GenevisibleiQ7Z6G8. HS.

Family and domain databases

Gene3Di1.10.150.50. 2 hits.
1.25.40.20. 3 hits.
2.30.29.30. 1 hit.
InterProiIPR033635. ANKS1.
IPR033636. ANKS1B.
IPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR011993. PH_dom-like.
IPR006020. PTB/PI_dom.
IPR001660. SAM.
IPR013761. SAM/pointed.
[Graphical view]
PANTHERiPTHR24174. PTHR24174. 1 hit.
PTHR24174:SF3. PTHR24174:SF3. 1 hit.
PfamiPF12796. Ank_2. 3 hits.
PF00640. PID. 1 hit.
PF00536. SAM_1. 2 hits.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 6 hits.
SM00462. PTB. 1 hit.
SM00454. SAM. 2 hits.
[Graphical view]
SUPFAMiSSF47769. SSF47769. 2 hits.
SSF48403. SSF48403. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 5 hits.
PS01179. PID. 1 hit.
PS50105. SAM_DOMAIN. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiANS1B_HUMAN
AccessioniPrimary (citable) accession number: Q7Z6G8
Secondary accession number(s): A5PKY5
, A7E259, A8K153, A8MSN4, B4DFP6, B4DH98, F8VPM3, F8VZR9, F8WC27, Q5XLJ0, Q6IVB5, Q6NUS4, Q7Z6G6, Q7Z6G7, Q8TAP3, Q9NRX7, Q9Y5K9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: May 3, 2011
Last modified: November 2, 2016
This is version 120 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.