Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q7Z6G8

- ANS1B_HUMAN

UniProt

Q7Z6G8 - ANS1B_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Ankyrin repeat and sterile alpha motif domain-containing protein 1B

Gene

ANKS1B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Isoform 2 may participate in the regulation of nucleoplasmic coilin protein interactions in neuronal and transformed cells.
Isoform 3 can regulate global protein synthesis by altering nucleolar numbers.By similarity
Isoform 4 may play a role as a modulator of APP processing. Overexpression can down-regulate APP processing.

GO - Molecular functioni

  1. ephrin receptor binding Source: UniProtKB
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Ankyrin repeat and sterile alpha motif domain-containing protein 1B
Alternative name(s):
Amyloid-beta protein intracellular domain-associated protein 1
Short name:
AIDA-1
E2A-PBX1-associated protein
Short name:
EB-1
Gene namesi
Name:ANKS1B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Unplaced

Organism-specific databases

HGNCiHGNC:24600. ANKS1B.

Subcellular locationi

Cytoplasm 4 Publications
Isoform 3 : Cell junctionsynapsepostsynaptic cell membranepostsynaptic density. Cell projectiondendritic spine. Nucleus. NucleusCajal body
Note: The synaptic localization requires DLG4 interaction. Translocation to the nucleus in response to stimulation of NMDA receptors (NMDARs) in a calcium-independent manner (By similarity).By similarity
Isoform 4 : Nucleus
Note: The interaction with APP causes its partial exclusion from the nucleus, when APP is overexpressed.

GO - Cellular componenti

  1. cell junction Source: UniProtKB-KW
  2. cell projection Source: UniProtKB-KW
  3. cytoplasm Source: UniProtKB-KW
  4. nucleus Source: UniProtKB-KW
  5. postsynaptic membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Membrane, Nucleus, Postsynaptic cell membrane, Synapse

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA128394692.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 12481248Ankyrin repeat and sterile alpha motif domain-containing protein 1BPRO_0000327259Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei901 – 9011PhosphotyrosineBy similarity
Modified residuei1007 – 10071PhosphotyrosineBy similarity

Post-translational modificationi

Isoform 3 nuclear translocation requires an NMDAR-dependent proteolytic cleavage.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ7Z6G8.
PRIDEiQ7Z6G8.

PTM databases

PhosphoSiteiQ7Z6G8.

Expressioni

Tissue specificityi

Highly expressed in marrow from patients with pre-B ALL associated with the t(1;19) translocation. Strongly expressed in brain and testis. Expressed in fetal brain. Isoform 4 is highly expressed in brain (at protein level). Isoform 6 is expressed in brain and several cancer cell lines.2 Publications

Inductioni

Transcriptionally up-regulated in t(1:19) pre-B cell acute lymphocytic leukemia by the chimeric TCF3-PBX1. Not expressed in pre-B cell that lack this translocation.2 Publications

Gene expression databases

BgeeiQ7Z6G8.
ExpressionAtlasiQ7Z6G8. baseline and differential.
GenevestigatoriQ7Z6G8.

Organism-specific databases

HPAiHPA044628.

Interactioni

Subunit structurei

Isoform 3 interacts with DLG4 (By similarity). Interacts with EPHA8. Isoform 2 interacts with COIL. Isoform 4 interacts with APP and EPHA8. Isoform 6 interacts with EPHA8.By similarity4 Publications

Protein-protein interaction databases

BioGridi121229. 7 interactions.
IntActiQ7Z6G8. 3 interactions.
MINTiMINT-258807.

Structurei

Secondary structure

1
1248
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi815 – 8228Combined sources
Helixi825 – 8273Combined sources
Helixi828 – 8336Combined sources
Turni834 – 8374Combined sources
Turni839 – 8413Combined sources
Beta strandi842 – 8476Combined sources
Helixi851 – 8544Combined sources
Helixi860 – 87213Combined sources
Helixi889 – 8946Combined sources
Turni895 – 8973Combined sources
Helixi901 – 9088Combined sources
Helixi913 – 9164Combined sources
Helixi921 – 9277Combined sources
Helixi933 – 94311Combined sources
Turni1056 – 10583Combined sources
Beta strandi1059 – 107416Combined sources
Helixi1078 – 109114Combined sources
Beta strandi1094 – 10974Combined sources
Beta strandi1104 – 11107Combined sources
Beta strandi1113 – 11219Combined sources
Beta strandi1124 – 11285Combined sources
Helixi1130 – 11323Combined sources
Beta strandi1133 – 11386Combined sources
Beta strandi1145 – 11506Combined sources
Turni1153 – 11553Combined sources
Beta strandi1156 – 116712Combined sources
Helixi1168 – 118619Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2EAMNMR-A808-874[»]
2KE7NMR-A808-893[»]
2KIVNMR-A812-946[»]
2M38NMR-A1042-1194[»]
ProteinModelPortaliQ7Z6G8.
SMRiQ7Z6G8. Positions 5-307, 812-946, 1053-1187.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ7Z6G8.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati2 – 3130ANK 1Add
BLAST
Repeati58 – 8730ANK 2Add
BLAST
Repeati91 – 12030ANK 3Add
BLAST
Repeati127 – 15630ANK 4Add
BLAST
Repeati160 – 18930ANK 5Add
BLAST
Repeati193 – 22230ANK 6Add
BLAST
Repeati225 – 25430ANK 7Add
BLAST
Domaini810 – 87667SAM 1PROSITE-ProRule annotationAdd
BLAST
Domaini884 – 94966SAM 2PROSITE-ProRule annotationAdd
BLAST
Domaini1056 – 1213158PIDPROSITE-ProRule annotationAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi935 – 9384Nuclear localization signal1 Publication

Sequence similaritiesi

Contains 7 ANK repeats.PROSITE-ProRule annotation
Contains 1 PID domain.PROSITE-ProRule annotation
Contains 2 SAM (sterile alpha motif) domains.PROSITE-ProRule annotation

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

eggNOGiCOG0666.
GeneTreeiENSGT00530000063104.
HOVERGENiHBG050506.
InParanoidiQ7Z6G8.
OMAiRNGDQWV.
OrthoDBiEOG78H3SN.
TreeFamiTF320582.

Family and domain databases

Gene3Di1.10.150.50. 2 hits.
1.25.40.20. 3 hits.
2.30.29.30. 1 hit.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR011993. PH_like_dom.
IPR006020. PTB/PI_dom.
IPR001660. SAM.
IPR013761. SAM/pointed.
IPR021129. SAM_type1.
[Graphical view]
PfamiPF12796. Ank_2. 2 hits.
PF00640. PID. 1 hit.
PF00536. SAM_1. 2 hits.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 6 hits.
SM00462. PTB. 1 hit.
SM00454. SAM. 2 hits.
[Graphical view]
SUPFAMiSSF47769. SSF47769. 2 hits.
SSF48403. SSF48403. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 5 hits.
PS01179. PID. 1 hit.
PS50105. SAM_DOMAIN. 2 hits.
[Graphical view]

Sequences (10)i

Sequence statusi: Complete.

This entry describes 10 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q7Z6G8-1) [UniParc]FASTAAdd to Basket

Also known as: AIDA-1b

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGKDQELLEA ARTGNVALVE KLLSGRKGGI LGGGSGPLPL SNLLSIWRGP
60 70 80 90 100
NVNCTDSSGY TALHHAALNG HKDIVLKLLQ YEASTNVADN KGYFPIHLAA
110 120 130 140 150
WKGDVEIVKI LIHHGPSHSR VNEQNNENET ALHCAAQYGH SEVVAVLLEE
160 170 180 190 200
LTDPTIRNSK LETPLDLAAL YGRLRVVKMI ISAHPNLMSC NTRKHTPLHL
210 220 230 240 250
AARNGHKAVV QVLLEAGMDV SCQTEKGSAL HEAALFGKVD VVRVLLETGI
260 270 280 290 300
DANIKDSLGR TVLDILKEHP SQKSLQIATL LQEYLEGVGR STVLEEPVQE
310 320 330 340 350
DATQETHISS PVESPSQKTK SETVTGELSK LLDEIKLCQE KDYSFEDLCH
360 370 380 390 400
TISDHYLDNL SKISEEELGK NGSQSVRTSS TINLSPGEVE EEDDDENTCG
410 420 430 440 450
PSGLWEALTP CNGCRNLGFP MLAQESYPKK RNYTMEIVPS ASLDTFPSEN
460 470 480 490 500
ENFLCDLMDT AVTKKPCSLE IARAPSPRTD NASEVAVTTP GTSNHRNSST
510 520 530 540 550
GPTPDCSPPS PDTALKNIVK VIRPQPKQRT SIVSSLDFHR MNHNQEYFEI
560 570 580 590 600
NTSTGCTSFT ASPPASPPTS SVGTTEVKNE GTNHTDDLSR QDDNDPPKEY
610 620 630 640 650
DPGQFAGLLH GSSPACESPE NPFHLYGKRE QCEKGQDEVS LANSPLPFKQ
660 670 680 690 700
SPIENNSEPL VKKIKPKVVS RTIFHKKSNQ LENHTIVGTR STRSGSRNGD
710 720 730 740 750
QWVMNAGGFV ERACTLGRIR SLPKALIDMH LSKSVSKSDS DLIAYPSNEK
760 770 780 790 800
TSRVNWSESS TAEHSSKGNS ERTPSFTSEW EEIDKIMSSI DVGINNELKE
810 820 830 840 850
MNGETTRPRC PVQTVGQWLE SIGLPQYENH LMANGFDNVQ FMGSNVMEDQ
860 870 880 890 900
DLLEIGILNS GHRQRILQAI QLLPKMRPIG HDGYHPTSVA EWLDSIELGD
910 920 930 940 950
YTKAFLINGY TSMDLLKKIW EVELINVLKI NLIGHRKRIL ASLGDRLHDD
960 970 980 990 1000
PPQKPPRSIT LREPSGNHTP PQLSPSLSQS TYTTGGSLDV PHIIMQGDAR
1010 1020 1030 1040 1050
RRRNENYFDD IPRSKLERQM AQTGDWGEPS ITLRPPNEAT ASTPVQYWQH
1060 1070 1080 1090 1100
HPEKLIFQSC DYKAFYLGSM LIKELRGTES TQDACAKMRA NCQKSTEQMK
1110 1120 1130 1140 1150
KVPTIILSVS YKGVKFIDAT NKNIIAEHEI RNISCAAQDP EDLSTFAYIT
1160 1170 1180 1190 1200
KDLKSNHHYC HVFTAFDVNL AYEIILTLGQ AFEVAYQLAL QARKGGHSST
1210 1220 1230 1240
LPESFENKPS KPIPKPRVSI RKSVDLLHAS HTGQEPSERH TEEALRKF
Length:1,248
Mass (Da):138,066
Last modified:May 3, 2011 - v2
Checksum:iEC3921C45083426D
GO
Isoform 2 (identifier: Q7Z6G8-2) [UniParc]FASTAAdd to Basket

Also known as: AIDA-1c

The sequence of this isoform differs from the canonical sequence as follows:
     1-774: Missing.
     775-807: SFTSEWEEIDKIMSSIDVGINNELKEMNGETTR → MMWQCHLSAQDYRYYPVDGYSLLKRFPLHPLTG
     963-1022: Missing.
     1225-1248: DLLHASHTGQEPSERHTEEALRKF → QIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF

Show »
Length:426
Mass (Da):48,432
Checksum:i0AE12663DD16CAC2
GO
Isoform 3 (identifier: Q7Z6G8-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-774: Missing.
     775-807: SFTSEWEEIDKIMSSIDVGINNELKEMNGETTR → MMWQCHLSAQDYRYYPVDGYSLLKRFPLHPLTG
     1022-1022: Q → QSSVCEIWTNQNAGFPFSAIHQVHN
     1225-1248: DLLHASHTGQEPSERHTEEALRKF → QIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF

Show »
Length:510
Mass (Da):57,865
Checksum:i882DB0117D894E54
GO
Isoform 4 (identifier: Q7Z6G8-4) [UniParc]FASTAAdd to Basket

Also known as: AIDA-1a

The sequence of this isoform differs from the canonical sequence as follows:
     1-774: Missing.
     775-807: SFTSEWEEIDKIMSSIDVGINNELKEMNGETTR → MMWQCHLSAQDYRYYPVDGYSLLKRFPLHPLTG
     1225-1248: DLLHASHTGQEPSERHTEEALRKF → PFCFKADRPI

Show »
Length:460
Mass (Da):52,273
Checksum:i34A6DD31C86685CD
GO
Isoform 5 (identifier: Q7Z6G8-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-774: Missing.
     775-807: SFTSEWEEIDKIMSSIDVGINNELKEMNGETTR → MMWQCHLSAQDYRYYPVDGYSLLKRFPLHPLTG
     963-1022: EPSGNHTPPQ...RSKLERQMAQ → SSVCEIWTNQNAGFPFSAIHQVHN
     1225-1248: DLLHASHTGQEPSERHTEEALRKF → QIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF

Show »
Length:450
Mass (Da):51,100
Checksum:i7513E87841E4A57C
GO
Isoform 6 (identifier: Q7Z6G8-6) [UniParc]FASTAAdd to Basket

Also known as: AIDA-1bDeltaAnk

The sequence of this isoform differs from the canonical sequence as follows:
     1-420: Missing.
     804-807: Missing.
     963-1022: Missing.

Show »
Length:764
Mass (Da):85,202
Checksum:i7C107E6688522EF0
GO
Isoform 7 (identifier: Q7Z6G8-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-774: Missing.
     775-807: SFTSEWEEIDKIMSSIDVGINNELKEMNGETTR → MMWQCHLSAQDYRYYPVDGYSLLKRFPLHPLTG
     963-1022: Missing.

Show »
Length:414
Mass (Da):47,104
Checksum:iAD92EB5F8954E011
GO
Isoform 8 (identifier: Q7Z6G8-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-831: Missing.
     927-1022: VLKINLIGHR...RSKLERQMAQ → QSSVCEIWTNQNAGFPFSAIHQVHN
     1225-1247: DLLHASHTGQEPSERHTEEALRK → IDPSEQKTLANLPWIVEPGQEAKRGINTKYETTI

Show »
Length:357
Mass (Da):40,277
Checksum:i07892A522BFC2835
GO
Isoform 9 (identifier: Q7Z6G8-9) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-994: Missing.

Note: No experimental confirmation available.

Show »
Length:254
Mass (Da):28,943
Checksum:i33299F04446DCF7F
GO
Isoform 10 (identifier: Q7Z6G8-10) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     3-807: Missing.
     963-1022: Missing.
     1225-1247: DLLHASHTGQEPSERHTEEALRK → IDPSEQKTLANLPWIVEPGQEAKRGINTKYETTI

Note: No experimental confirmation available.

Show »
Length:394
Mass (Da):44,522
Checksum:iD921575BBFF3C4C6
GO

Sequence cautioni

The sequence AAP38184.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti290 – 2912RS → KYA in AAP37612. (PubMed:15004329)Curated
Sequence conflicti813 – 8131Q → L in BAF82457. (PubMed:14702039)Curated
Sequence conflicti854 – 8541E → G in AAI42670. (PubMed:15489334)Curated
Sequence conflicti1160 – 11601C → R in BAG57507. (PubMed:14702039)Curated
Sequence conflicti1167 – 11671D → G in BAG58059. (PubMed:14702039)Curated
Isoform 8 (identifier: Q7Z6G8-8)
Sequence conflicti325 – 3251P → R in AAH68451. (PubMed:15489334)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 994994Missing in isoform 9. 1 PublicationVSP_046414Add
BLAST
Alternative sequencei1 – 831831Missing in isoform 8. 1 PublicationVSP_032701Add
BLAST
Alternative sequencei1 – 774774Missing in isoform 3, isoform 4, isoform 5, isoform 2 and isoform 7. 5 PublicationsVSP_032702Add
BLAST
Alternative sequencei1 – 420420Missing in isoform 6. 1 PublicationVSP_032703Add
BLAST
Alternative sequencei3 – 807805Missing in isoform 10. 1 PublicationVSP_046415Add
BLAST
Alternative sequencei775 – 80733SFTSE…GETTR → MMWQCHLSAQDYRYYPVDGY SLLKRFPLHPLTG in isoform 3, isoform 4, isoform 5, isoform 2 and isoform 7. 5 PublicationsVSP_032704Add
BLAST
Alternative sequencei804 – 8074Missing in isoform 6. 1 PublicationVSP_032705
Alternative sequencei927 – 102296VLKIN…RQMAQ → QSSVCEIWTNQNAGFPFSAI HQVHN in isoform 8. 1 PublicationVSP_032706Add
BLAST
Alternative sequencei963 – 102260Missing in isoform 2, isoform 6, isoform 7 and isoform 10. 5 PublicationsVSP_032707Add
BLAST
Alternative sequencei963 – 102260EPSGN…RQMAQ → SSVCEIWTNQNAGFPFSAIH QVHN in isoform 5. 1 PublicationVSP_032708Add
BLAST
Alternative sequencei1022 – 10221Q → QSSVCEIWTNQNAGFPFSAI HQVHN in isoform 3. 2 PublicationsVSP_032709
Alternative sequencei1225 – 124824DLLHA…ALRKF → QIDPSEQKTLANLPWIVEPG QEAKRGINTKYETTIF in isoform 3, isoform 5 and isoform 2. 3 PublicationsVSP_032710Add
BLAST
Alternative sequencei1225 – 124824DLLHA…ALRKF → PFCFKADRPI in isoform 4. 1 PublicationVSP_032711Add
BLAST
Alternative sequencei1225 – 124723DLLHA…EALRK → IDPSEQKTLANLPWIVEPGQ EAKRGINTKYETTI in isoform 8 and isoform 10. 2 PublicationsVSP_032712Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY281131 mRNA. Translation: AAP37612.1.
AY281132 mRNA. Translation: AAP37613.1.
AY283057 mRNA. Translation: AAP38184.2. Different initiation.
AY753193 mRNA. Translation: AAV28691.1.
AF164792 mRNA. Translation: AAF80756.1.
AK289768 mRNA. Translation: BAF82457.1.
AK294191 mRNA. Translation: BAG57507.1.
AK294994 mRNA. Translation: BAG58059.1.
AC008126 Genomic DNA. No translation available.
AC011248 Genomic DNA. No translation available.
AC021653 Genomic DNA. No translation available.
AC048330 Genomic DNA. No translation available.
AC069437 Genomic DNA. No translation available.
AC078916 Genomic DNA. No translation available.
AC079954 Genomic DNA. No translation available.
AC084374 Genomic DNA. No translation available.
AC117377 Genomic DNA. No translation available.
AC126616 Genomic DNA. No translation available.
AC141554 Genomic DNA. No translation available.
AC141555 Genomic DNA. No translation available.
AC141556 Genomic DNA. No translation available.
BC026313 mRNA. Translation: AAH26313.2.
BC068451 mRNA. Translation: AAH68451.1.
BC142669 mRNA. Translation: AAI42670.1.
BC150204 mRNA. Translation: AAI50205.1.
AF145204 mRNA. Translation: AAD33951.1.
AY620824 mRNA. Translation: AAT39519.1.
CCDSiCCDS55864.1. [Q7Z6G8-9]
CCDS55865.1. [Q7Z6G8-8]
CCDS55866.1. [Q7Z6G8-7]
CCDS55867.1. [Q7Z6G8-2]
CCDS55868.1. [Q7Z6G8-5]
CCDS55869.1. [Q7Z6G8-4]
CCDS55870.1. [Q7Z6G8-3]
CCDS55871.1. [Q7Z6G8-10]
CCDS55872.1. [Q7Z6G8-1]
RefSeqiNP_001190994.1. NM_001204065.1.
NP_001190995.1. NM_001204066.1. [Q7Z6G8-8]
NP_001190996.1. NM_001204067.1. [Q7Z6G8-10]
NP_001190997.1. NM_001204068.1. [Q7Z6G8-4]
NP_001190998.1. NM_001204069.1. [Q7Z6G8-5]
NP_001190999.1. NM_001204070.1. [Q7Z6G8-2]
NP_001191008.1. NM_001204079.1.
NP_001191009.1. NM_001204080.1.
NP_001191010.1. NM_001204081.1. [Q7Z6G8-9]
NP_064525.1. NM_020140.3. [Q7Z6G8-7]
NP_690001.3. NM_152788.4. [Q7Z6G8-1]
NP_858056.2. NM_181670.3. [Q7Z6G8-3]
UniGeneiHs.506458.

Genome annotation databases

EnsembliENST00000341752; ENSP00000345510; ENSG00000185046. [Q7Z6G8-9]
ENST00000546568; ENSP00000448205; ENSG00000185046. [Q7Z6G8-2]
ENST00000546960; ENSP00000447839; ENSG00000185046. [Q7Z6G8-4]
ENST00000547010; ENSP00000448512; ENSG00000185046. [Q7Z6G8-6]
ENST00000547446; ENSP00000450015; ENSG00000185046. [Q7Z6G8-10]
ENST00000547776; ENSP00000449629; ENSG00000185046. [Q7Z6G8-1]
ENST00000549025; ENSP00000447312; ENSG00000185046. [Q7Z6G8-8]
ENST00000549493; ENSP00000448203; ENSG00000185046. [Q7Z6G8-3]
ENST00000549558; ENSP00000448993; ENSG00000185046. [Q7Z6G8-7]
ENST00000550693; ENSP00000447999; ENSG00000185046. [Q7Z6G8-5]
GeneIDi56899.
KEGGihsa:56899.
UCSCiuc001tgd.2. human. [Q7Z6G8-7]
uc001tge.2. human. [Q7Z6G8-1]
uc001tgf.2. human. [Q7Z6G8-6]
uc001tgi.3. human. [Q7Z6G8-3]
uc001tgj.3. human. [Q7Z6G8-2]
uc009ztr.3. human. [Q7Z6G8-5]
uc009zts.2. human. [Q7Z6G8-4]

Polymorphism databases

DMDMi332278155.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY281131 mRNA. Translation: AAP37612.1 .
AY281132 mRNA. Translation: AAP37613.1 .
AY283057 mRNA. Translation: AAP38184.2 . Different initiation.
AY753193 mRNA. Translation: AAV28691.1 .
AF164792 mRNA. Translation: AAF80756.1 .
AK289768 mRNA. Translation: BAF82457.1 .
AK294191 mRNA. Translation: BAG57507.1 .
AK294994 mRNA. Translation: BAG58059.1 .
AC008126 Genomic DNA. No translation available.
AC011248 Genomic DNA. No translation available.
AC021653 Genomic DNA. No translation available.
AC048330 Genomic DNA. No translation available.
AC069437 Genomic DNA. No translation available.
AC078916 Genomic DNA. No translation available.
AC079954 Genomic DNA. No translation available.
AC084374 Genomic DNA. No translation available.
AC117377 Genomic DNA. No translation available.
AC126616 Genomic DNA. No translation available.
AC141554 Genomic DNA. No translation available.
AC141555 Genomic DNA. No translation available.
AC141556 Genomic DNA. No translation available.
BC026313 mRNA. Translation: AAH26313.2 .
BC068451 mRNA. Translation: AAH68451.1 .
BC142669 mRNA. Translation: AAI42670.1 .
BC150204 mRNA. Translation: AAI50205.1 .
AF145204 mRNA. Translation: AAD33951.1 .
AY620824 mRNA. Translation: AAT39519.1 .
CCDSi CCDS55864.1. [Q7Z6G8-9 ]
CCDS55865.1. [Q7Z6G8-8 ]
CCDS55866.1. [Q7Z6G8-7 ]
CCDS55867.1. [Q7Z6G8-2 ]
CCDS55868.1. [Q7Z6G8-5 ]
CCDS55869.1. [Q7Z6G8-4 ]
CCDS55870.1. [Q7Z6G8-3 ]
CCDS55871.1. [Q7Z6G8-10 ]
CCDS55872.1. [Q7Z6G8-1 ]
RefSeqi NP_001190994.1. NM_001204065.1.
NP_001190995.1. NM_001204066.1. [Q7Z6G8-8 ]
NP_001190996.1. NM_001204067.1. [Q7Z6G8-10 ]
NP_001190997.1. NM_001204068.1. [Q7Z6G8-4 ]
NP_001190998.1. NM_001204069.1. [Q7Z6G8-5 ]
NP_001190999.1. NM_001204070.1. [Q7Z6G8-2 ]
NP_001191008.1. NM_001204079.1.
NP_001191009.1. NM_001204080.1.
NP_001191010.1. NM_001204081.1. [Q7Z6G8-9 ]
NP_064525.1. NM_020140.3. [Q7Z6G8-7 ]
NP_690001.3. NM_152788.4. [Q7Z6G8-1 ]
NP_858056.2. NM_181670.3. [Q7Z6G8-3 ]
UniGenei Hs.506458.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2EAM NMR - A 808-874 [» ]
2KE7 NMR - A 808-893 [» ]
2KIV NMR - A 812-946 [» ]
2M38 NMR - A 1042-1194 [» ]
ProteinModelPortali Q7Z6G8.
SMRi Q7Z6G8. Positions 5-307, 812-946, 1053-1187.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 121229. 7 interactions.
IntActi Q7Z6G8. 3 interactions.
MINTi MINT-258807.

PTM databases

PhosphoSitei Q7Z6G8.

Polymorphism databases

DMDMi 332278155.

Proteomic databases

PaxDbi Q7Z6G8.
PRIDEi Q7Z6G8.

Protocols and materials databases

DNASUi 56899.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000341752 ; ENSP00000345510 ; ENSG00000185046 . [Q7Z6G8-9 ]
ENST00000546568 ; ENSP00000448205 ; ENSG00000185046 . [Q7Z6G8-2 ]
ENST00000546960 ; ENSP00000447839 ; ENSG00000185046 . [Q7Z6G8-4 ]
ENST00000547010 ; ENSP00000448512 ; ENSG00000185046 . [Q7Z6G8-6 ]
ENST00000547446 ; ENSP00000450015 ; ENSG00000185046 . [Q7Z6G8-10 ]
ENST00000547776 ; ENSP00000449629 ; ENSG00000185046 . [Q7Z6G8-1 ]
ENST00000549025 ; ENSP00000447312 ; ENSG00000185046 . [Q7Z6G8-8 ]
ENST00000549493 ; ENSP00000448203 ; ENSG00000185046 . [Q7Z6G8-3 ]
ENST00000549558 ; ENSP00000448993 ; ENSG00000185046 . [Q7Z6G8-7 ]
ENST00000550693 ; ENSP00000447999 ; ENSG00000185046 . [Q7Z6G8-5 ]
GeneIDi 56899.
KEGGi hsa:56899.
UCSCi uc001tgd.2. human. [Q7Z6G8-7 ]
uc001tge.2. human. [Q7Z6G8-1 ]
uc001tgf.2. human. [Q7Z6G8-6 ]
uc001tgi.3. human. [Q7Z6G8-3 ]
uc001tgj.3. human. [Q7Z6G8-2 ]
uc009ztr.3. human. [Q7Z6G8-5 ]
uc009zts.2. human. [Q7Z6G8-4 ]

Organism-specific databases

CTDi 56899.
GeneCardsi GC12M099129.
HGNCi HGNC:24600. ANKS1B.
HPAi HPA044628.
MIMi 607815. gene.
neXtProti NX_Q7Z6G8.
PharmGKBi PA128394692.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0666.
GeneTreei ENSGT00530000063104.
HOVERGENi HBG050506.
InParanoidi Q7Z6G8.
OMAi RNGDQWV.
OrthoDBi EOG78H3SN.
TreeFami TF320582.

Miscellaneous databases

ChiTaRSi ANKS1B. human.
EvolutionaryTracei Q7Z6G8.
GeneWikii ANKS1B.
GenomeRNAii 56899.
NextBioi 62343.
PROi Q7Z6G8.
SOURCEi Search...

Gene expression databases

Bgeei Q7Z6G8.
ExpressionAtlasi Q7Z6G8. baseline and differential.
Genevestigatori Q7Z6G8.

Family and domain databases

Gene3Di 1.10.150.50. 2 hits.
1.25.40.20. 3 hits.
2.30.29.30. 1 hit.
InterProi IPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR011993. PH_like_dom.
IPR006020. PTB/PI_dom.
IPR001660. SAM.
IPR013761. SAM/pointed.
IPR021129. SAM_type1.
[Graphical view ]
Pfami PF12796. Ank_2. 2 hits.
PF00640. PID. 1 hit.
PF00536. SAM_1. 2 hits.
[Graphical view ]
PRINTSi PR01415. ANKYRIN.
SMARTi SM00248. ANK. 6 hits.
SM00462. PTB. 1 hit.
SM00454. SAM. 2 hits.
[Graphical view ]
SUPFAMi SSF47769. SSF47769. 2 hits.
SSF48403. SSF48403. 1 hit.
PROSITEi PS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 5 hits.
PS01179. PID. 1 hit.
PS50105. SAM_DOMAIN. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The intracellular localization of amyloid beta protein precursor (AbetaPP) intracellular domain associated protein-1 (AIDA-1) is regulated by AbetaPP and alternative splicing."
    Ghersi E., Vito P., Lopez P., Abdallah M., D'Adamio L.
    J. Alzheimers Dis. 6:67-78(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 6 AND 4), INTERACTION WITH APP, SUBCELLULAR LOCATION.
    Tissue: Fetal brain.
  2. "A novel EB-1/AIDA-1 isoform, AIDA-1c, interacts with the Cajal body protein coilin."
    Xu H., Hebert M.D.
    BMC Cell Biol. 6:23-23(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, INTERACTION WITH COIL, SUBCELLULAR LOCATION.
    Tissue: Brain.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7).
    Tissue: Adrenal gland.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 9 AND 10).
    Tissue: Amygdala and Brain.
  5. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 5; 7 AND 8).
    Tissue: Brain and Hippocampus.
  7. "EB-1, a tyrosine kinase signal transduction gene, is transcriptionally activated in the t(1;19) subset of pre-B ALL, which express oncoprotein E2a-Pbx1."
    Fu X., McGrath S., Pasillas M., Nakazawa S., Kamps M.P.
    Oncogene 18:4920-4929(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 294-1248 (ISOFORM 1), INDUCTION, TISSUE SPECIFICITY.
  8. "Amyloid-beta protein precursor (AbetaPP) intracellular domain-associated protein-1 proteins bind to AbetaPP and modulate its processing in an isoform-specific manner."
    Ghersi E., Noviello C., D'Adamio L.
    J. Biol. Chem. 279:49105-49112(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 425-1192 (ISOFORM 1), FUNCTION, INTERACTION WITH APP, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  9. "The effects of siRNA-mediated inhibition of E2A-PBX1 on EB-1 and Wnt16b expression in the 697 pre-B leukemia cell line."
    Casagrande G., te Kronnie G., Basso G.
    Haematologica 91:765-771(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION.
  10. "Identification of phosphotyrosine binding domain-containing proteins as novel downstream targets of the EphA8 signaling function."
    Shin J., Gu C., Park E., Park S.
    Mol. Cell. Biol. 27:8113-8126(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH EPHA8.
  11. "A nuclear localization signal at the SAM-SAM domain interface of AIDA-1 suggests a requirement for domain uncoupling prior to nuclear import."
    Kurabi A., Brener S., Mobli M., Kwan J.J., Donaldson L.W.
    J. Mol. Biol. 392:1168-1177(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: STRUCTURE BY NMR OF 813-947, SUBCELLULAR LOCATION, NUCLEAR LOCALIZATION SIGNAL.

Entry informationi

Entry nameiANS1B_HUMAN
AccessioniPrimary (citable) accession number: Q7Z6G8
Secondary accession number(s): A5PKY5
, A7E259, A8K153, A8MSN4, B4DFP6, B4DH98, F8VPM3, F8VZR9, F8WC27, Q5XLJ0, Q6IVB5, Q6NUS4, Q7Z6G6, Q7Z6G7, Q8TAP3, Q9NRX7, Q9Y5K9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: May 3, 2011
Last modified: November 26, 2014
This is version 99 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3