Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q7Z6G8

- ANS1B_HUMAN

UniProt

Q7Z6G8 - ANS1B_HUMAN

Protein

Ankyrin repeat and sterile alpha motif domain-containing protein 1B

Gene

ANKS1B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 97 (01 Oct 2014)
      Sequence version 2 (03 May 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Isoform 2 may participate in the regulation of nucleoplasmic coilin protein interactions in neuronal and transformed cells.
    Isoform 3 can regulate global protein synthesis by altering nucleolar numbers.By similarity
    Isoform 4 may play a role as a modulator of APP processing. Overexpression can down-regulate APP processing.

    GO - Molecular functioni

    1. ephrin receptor binding Source: UniProtKB

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Ankyrin repeat and sterile alpha motif domain-containing protein 1B
    Alternative name(s):
    Amyloid-beta protein intracellular domain-associated protein 1
    Short name:
    AIDA-1
    E2A-PBX1-associated protein
    Short name:
    EB-1
    Gene namesi
    Name:ANKS1B
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:24600. ANKS1B.

    Subcellular locationi

    Cytoplasm 4 Publications
    Isoform 3 : Cell junctionsynapsepostsynaptic cell membranepostsynaptic density. Cell projectiondendritic spine. Nucleus. NucleusCajal body
    Note: The synaptic localization requires DLG4 interaction. Translocation to the nucleus in response to stimulation of NMDA receptors (NMDARs) in a calcium-independent manner By similarity.By similarity
    Isoform 4 : Nucleus
    Note: The interaction with APP causes its partial exclusion from the nucleus, when APP is overexpressed.

    GO - Cellular componenti

    1. Cajal body Source: UniProtKB-SubCell
    2. cell junction Source: UniProtKB-KW
    3. cytoplasm Source: UniProtKB-SubCell
    4. dendritic spine Source: UniProtKB-SubCell
    5. postsynaptic density Source: UniProtKB-SubCell
    6. postsynaptic membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Cell junction, Cell membrane, Cell projection, Cytoplasm, Membrane, Nucleus, Postsynaptic cell membrane, Synapse

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA128394692.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 12481248Ankyrin repeat and sterile alpha motif domain-containing protein 1BPRO_0000327259Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei901 – 9011PhosphotyrosineBy similarity
    Modified residuei1007 – 10071PhosphotyrosineBy similarity

    Post-translational modificationi

    Isoform 3 nuclear translocation requires an NMDAR-dependent proteolytic cleavage.By similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    PaxDbiQ7Z6G8.
    PRIDEiQ7Z6G8.

    PTM databases

    PhosphoSiteiQ7Z6G8.

    Expressioni

    Tissue specificityi

    Highly expressed in marrow from patients with pre-B ALL associated with the t(1;19) translocation. Strongly expressed in brain and testis. Expressed in fetal brain. Isoform 4 is highly expressed in brain (at protein level). Isoform 6 is expressed in brain and several cancer cell lines.2 Publications

    Inductioni

    Transcriptionally up-regulated in t(1:19) pre-B cell acute lymphocytic leukemia by the chimeric TCF3-PBX1. Not expressed in pre-B cell that lack this translocation.2 Publications

    Gene expression databases

    ArrayExpressiQ7Z6G8.
    BgeeiQ7Z6G8.
    GenevestigatoriQ7Z6G8.

    Organism-specific databases

    HPAiHPA044628.

    Interactioni

    Subunit structurei

    Isoform 3 interacts with DLG4 By similarity. Interacts with EPHA8. Isoform 2 interacts with COIL. Isoform 4 interacts with APP and EPHA8. Isoform 6 interacts with EPHA8.By similarity4 Publications

    Protein-protein interaction databases

    BioGridi121229. 7 interactions.
    IntActiQ7Z6G8. 3 interactions.
    MINTiMINT-258807.

    Structurei

    Secondary structure

    1
    1248
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi815 – 8228
    Helixi825 – 8273
    Helixi828 – 8336
    Turni834 – 8374
    Turni839 – 8413
    Beta strandi842 – 8476
    Helixi851 – 8544
    Helixi860 – 87213
    Helixi889 – 8946
    Turni895 – 8973
    Helixi901 – 9088
    Helixi913 – 9164
    Helixi921 – 9277
    Helixi933 – 94311
    Turni1056 – 10583
    Beta strandi1059 – 107416
    Helixi1078 – 109114
    Beta strandi1094 – 10974
    Beta strandi1104 – 11107
    Beta strandi1113 – 11219
    Beta strandi1124 – 11285
    Helixi1130 – 11323
    Beta strandi1133 – 11386
    Beta strandi1145 – 11506
    Turni1153 – 11553
    Beta strandi1156 – 116712
    Helixi1168 – 118619

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2EAMNMR-A808-874[»]
    2KE7NMR-A808-893[»]
    2KIVNMR-A812-946[»]
    2M38NMR-A1042-1194[»]
    ProteinModelPortaliQ7Z6G8.
    SMRiQ7Z6G8. Positions 5-307, 812-946, 1053-1187.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ7Z6G8.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati2 – 3130ANK 1Add
    BLAST
    Repeati58 – 8730ANK 2Add
    BLAST
    Repeati91 – 12030ANK 3Add
    BLAST
    Repeati127 – 15630ANK 4Add
    BLAST
    Repeati160 – 18930ANK 5Add
    BLAST
    Repeati193 – 22230ANK 6Add
    BLAST
    Repeati225 – 25430ANK 7Add
    BLAST
    Domaini810 – 87667SAM 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini884 – 94966SAM 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini1056 – 1213158PIDPROSITE-ProRule annotationAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi935 – 9384Nuclear localization signal1 Publication

    Sequence similaritiesi

    Contains 7 ANK repeats.PROSITE-ProRule annotation
    Contains 1 PID domain.PROSITE-ProRule annotation
    Contains 2 SAM (sterile alpha motif) domains.PROSITE-ProRule annotation

    Keywords - Domaini

    ANK repeat, Repeat

    Phylogenomic databases

    eggNOGiCOG0666.
    HOVERGENiHBG050506.
    InParanoidiQ7Z6G8.
    OMAiRNGDQWV.
    OrthoDBiEOG78H3SN.
    TreeFamiTF320582.

    Family and domain databases

    Gene3Di1.10.150.50. 2 hits.
    1.25.40.20. 3 hits.
    2.30.29.30. 1 hit.
    InterProiIPR002110. Ankyrin_rpt.
    IPR020683. Ankyrin_rpt-contain_dom.
    IPR011993. PH_like_dom.
    IPR006020. PTB/PI_dom.
    IPR001660. SAM.
    IPR013761. SAM/pointed.
    IPR021129. SAM_type1.
    [Graphical view]
    PfamiPF12796. Ank_2. 2 hits.
    PF00640. PID. 1 hit.
    PF00536. SAM_1. 2 hits.
    [Graphical view]
    PRINTSiPR01415. ANKYRIN.
    SMARTiSM00248. ANK. 6 hits.
    SM00462. PTB. 1 hit.
    SM00454. SAM. 2 hits.
    [Graphical view]
    SUPFAMiSSF47769. SSF47769. 2 hits.
    SSF48403. SSF48403. 1 hit.
    PROSITEiPS50297. ANK_REP_REGION. 1 hit.
    PS50088. ANK_REPEAT. 5 hits.
    PS01179. PID. 1 hit.
    PS50105. SAM_DOMAIN. 2 hits.
    [Graphical view]

    Sequences (10)i

    Sequence statusi: Complete.

    This entry describes 10 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q7Z6G8-1) [UniParc]FASTAAdd to Basket

    Also known as: AIDA-1b

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGKDQELLEA ARTGNVALVE KLLSGRKGGI LGGGSGPLPL SNLLSIWRGP     50
    NVNCTDSSGY TALHHAALNG HKDIVLKLLQ YEASTNVADN KGYFPIHLAA 100
    WKGDVEIVKI LIHHGPSHSR VNEQNNENET ALHCAAQYGH SEVVAVLLEE 150
    LTDPTIRNSK LETPLDLAAL YGRLRVVKMI ISAHPNLMSC NTRKHTPLHL 200
    AARNGHKAVV QVLLEAGMDV SCQTEKGSAL HEAALFGKVD VVRVLLETGI 250
    DANIKDSLGR TVLDILKEHP SQKSLQIATL LQEYLEGVGR STVLEEPVQE 300
    DATQETHISS PVESPSQKTK SETVTGELSK LLDEIKLCQE KDYSFEDLCH 350
    TISDHYLDNL SKISEEELGK NGSQSVRTSS TINLSPGEVE EEDDDENTCG 400
    PSGLWEALTP CNGCRNLGFP MLAQESYPKK RNYTMEIVPS ASLDTFPSEN 450
    ENFLCDLMDT AVTKKPCSLE IARAPSPRTD NASEVAVTTP GTSNHRNSST 500
    GPTPDCSPPS PDTALKNIVK VIRPQPKQRT SIVSSLDFHR MNHNQEYFEI 550
    NTSTGCTSFT ASPPASPPTS SVGTTEVKNE GTNHTDDLSR QDDNDPPKEY 600
    DPGQFAGLLH GSSPACESPE NPFHLYGKRE QCEKGQDEVS LANSPLPFKQ 650
    SPIENNSEPL VKKIKPKVVS RTIFHKKSNQ LENHTIVGTR STRSGSRNGD 700
    QWVMNAGGFV ERACTLGRIR SLPKALIDMH LSKSVSKSDS DLIAYPSNEK 750
    TSRVNWSESS TAEHSSKGNS ERTPSFTSEW EEIDKIMSSI DVGINNELKE 800
    MNGETTRPRC PVQTVGQWLE SIGLPQYENH LMANGFDNVQ FMGSNVMEDQ 850
    DLLEIGILNS GHRQRILQAI QLLPKMRPIG HDGYHPTSVA EWLDSIELGD 900
    YTKAFLINGY TSMDLLKKIW EVELINVLKI NLIGHRKRIL ASLGDRLHDD 950
    PPQKPPRSIT LREPSGNHTP PQLSPSLSQS TYTTGGSLDV PHIIMQGDAR 1000
    RRRNENYFDD IPRSKLERQM AQTGDWGEPS ITLRPPNEAT ASTPVQYWQH 1050
    HPEKLIFQSC DYKAFYLGSM LIKELRGTES TQDACAKMRA NCQKSTEQMK 1100
    KVPTIILSVS YKGVKFIDAT NKNIIAEHEI RNISCAAQDP EDLSTFAYIT 1150
    KDLKSNHHYC HVFTAFDVNL AYEIILTLGQ AFEVAYQLAL QARKGGHSST 1200
    LPESFENKPS KPIPKPRVSI RKSVDLLHAS HTGQEPSERH TEEALRKF 1248
    Length:1,248
    Mass (Da):138,066
    Last modified:May 3, 2011 - v2
    Checksum:iEC3921C45083426D
    GO
    Isoform 2 (identifier: Q7Z6G8-2) [UniParc]FASTAAdd to Basket

    Also known as: AIDA-1c

    The sequence of this isoform differs from the canonical sequence as follows:
         1-774: Missing.
         775-807: SFTSEWEEIDKIMSSIDVGINNELKEMNGETTR → MMWQCHLSAQDYRYYPVDGYSLLKRFPLHPLTG
         963-1022: Missing.
         1225-1248: DLLHASHTGQEPSERHTEEALRKF → QIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF

    Show »
    Length:426
    Mass (Da):48,432
    Checksum:i0AE12663DD16CAC2
    GO
    Isoform 3 (identifier: Q7Z6G8-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-774: Missing.
         775-807: SFTSEWEEIDKIMSSIDVGINNELKEMNGETTR → MMWQCHLSAQDYRYYPVDGYSLLKRFPLHPLTG
         1022-1022: Q → QSSVCEIWTNQNAGFPFSAIHQVHN
         1225-1248: DLLHASHTGQEPSERHTEEALRKF → QIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF

    Show »
    Length:510
    Mass (Da):57,865
    Checksum:i882DB0117D894E54
    GO
    Isoform 4 (identifier: Q7Z6G8-4) [UniParc]FASTAAdd to Basket

    Also known as: AIDA-1a

    The sequence of this isoform differs from the canonical sequence as follows:
         1-774: Missing.
         775-807: SFTSEWEEIDKIMSSIDVGINNELKEMNGETTR → MMWQCHLSAQDYRYYPVDGYSLLKRFPLHPLTG
         1225-1248: DLLHASHTGQEPSERHTEEALRKF → PFCFKADRPI

    Show »
    Length:460
    Mass (Da):52,273
    Checksum:i34A6DD31C86685CD
    GO
    Isoform 5 (identifier: Q7Z6G8-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-774: Missing.
         775-807: SFTSEWEEIDKIMSSIDVGINNELKEMNGETTR → MMWQCHLSAQDYRYYPVDGYSLLKRFPLHPLTG
         963-1022: EPSGNHTPPQ...RSKLERQMAQ → SSVCEIWTNQNAGFPFSAIHQVHN
         1225-1248: DLLHASHTGQEPSERHTEEALRKF → QIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF

    Show »
    Length:450
    Mass (Da):51,100
    Checksum:i7513E87841E4A57C
    GO
    Isoform 6 (identifier: Q7Z6G8-6) [UniParc]FASTAAdd to Basket

    Also known as: AIDA-1bDeltaAnk

    The sequence of this isoform differs from the canonical sequence as follows:
         1-420: Missing.
         804-807: Missing.
         963-1022: Missing.

    Show »
    Length:764
    Mass (Da):85,202
    Checksum:i7C107E6688522EF0
    GO
    Isoform 7 (identifier: Q7Z6G8-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-774: Missing.
         775-807: SFTSEWEEIDKIMSSIDVGINNELKEMNGETTR → MMWQCHLSAQDYRYYPVDGYSLLKRFPLHPLTG
         963-1022: Missing.

    Show »
    Length:414
    Mass (Da):47,104
    Checksum:iAD92EB5F8954E011
    GO
    Isoform 8 (identifier: Q7Z6G8-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-831: Missing.
         927-1022: VLKINLIGHR...RSKLERQMAQ → QSSVCEIWTNQNAGFPFSAIHQVHN
         1225-1247: DLLHASHTGQEPSERHTEEALRK → IDPSEQKTLANLPWIVEPGQEAKRGINTKYETTI

    Show »
    Length:357
    Mass (Da):40,277
    Checksum:i07892A522BFC2835
    GO
    Isoform 9 (identifier: Q7Z6G8-9) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-994: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:254
    Mass (Da):28,943
    Checksum:i33299F04446DCF7F
    GO
    Isoform 10 (identifier: Q7Z6G8-10) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         3-807: Missing.
         963-1022: Missing.
         1225-1247: DLLHASHTGQEPSERHTEEALRK → IDPSEQKTLANLPWIVEPGQEAKRGINTKYETTI

    Note: No experimental confirmation available.

    Show »
    Length:394
    Mass (Da):44,522
    Checksum:iD921575BBFF3C4C6
    GO

    Sequence cautioni

    The sequence AAP38184.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti290 – 2912RS → KYA in AAP37612. (PubMed:15004329)Curated
    Sequence conflicti813 – 8131Q → L in BAF82457. (PubMed:14702039)Curated
    Sequence conflicti854 – 8541E → G in AAI42670. (PubMed:15489334)Curated
    Sequence conflicti1160 – 11601C → R in BAG57507. (PubMed:14702039)Curated
    Sequence conflicti1167 – 11671D → G in BAG58059. (PubMed:14702039)Curated
    Isoform 8 (identifier: Q7Z6G8-8)
    Sequence conflicti325 – 3251P → R in AAH68451. (PubMed:15489334)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 994994Missing in isoform 9. 1 PublicationVSP_046414Add
    BLAST
    Alternative sequencei1 – 831831Missing in isoform 8. 1 PublicationVSP_032701Add
    BLAST
    Alternative sequencei1 – 774774Missing in isoform 3, isoform 4, isoform 5, isoform 2 and isoform 7. 5 PublicationsVSP_032702Add
    BLAST
    Alternative sequencei1 – 420420Missing in isoform 6. 1 PublicationVSP_032703Add
    BLAST
    Alternative sequencei3 – 807805Missing in isoform 10. 1 PublicationVSP_046415Add
    BLAST
    Alternative sequencei775 – 80733SFTSE…GETTR → MMWQCHLSAQDYRYYPVDGY SLLKRFPLHPLTG in isoform 3, isoform 4, isoform 5, isoform 2 and isoform 7. 5 PublicationsVSP_032704Add
    BLAST
    Alternative sequencei804 – 8074Missing in isoform 6. 1 PublicationVSP_032705
    Alternative sequencei927 – 102296VLKIN…RQMAQ → QSSVCEIWTNQNAGFPFSAI HQVHN in isoform 8. 1 PublicationVSP_032706Add
    BLAST
    Alternative sequencei963 – 102260Missing in isoform 2, isoform 6, isoform 7 and isoform 10. 5 PublicationsVSP_032707Add
    BLAST
    Alternative sequencei963 – 102260EPSGN…RQMAQ → SSVCEIWTNQNAGFPFSAIH QVHN in isoform 5. 1 PublicationVSP_032708Add
    BLAST
    Alternative sequencei1022 – 10221Q → QSSVCEIWTNQNAGFPFSAI HQVHN in isoform 3. 2 PublicationsVSP_032709
    Alternative sequencei1225 – 124824DLLHA…ALRKF → QIDPSEQKTLANLPWIVEPG QEAKRGINTKYETTIF in isoform 3, isoform 5 and isoform 2. 3 PublicationsVSP_032710Add
    BLAST
    Alternative sequencei1225 – 124824DLLHA…ALRKF → PFCFKADRPI in isoform 4. 1 PublicationVSP_032711Add
    BLAST
    Alternative sequencei1225 – 124723DLLHA…EALRK → IDPSEQKTLANLPWIVEPGQ EAKRGINTKYETTI in isoform 8 and isoform 10. 2 PublicationsVSP_032712Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY281131 mRNA. Translation: AAP37612.1.
    AY281132 mRNA. Translation: AAP37613.1.
    AY283057 mRNA. Translation: AAP38184.2. Different initiation.
    AY753193 mRNA. Translation: AAV28691.1.
    AF164792 mRNA. Translation: AAF80756.1.
    AK289768 mRNA. Translation: BAF82457.1.
    AK294191 mRNA. Translation: BAG57507.1.
    AK294994 mRNA. Translation: BAG58059.1.
    AC008126 Genomic DNA. No translation available.
    AC011248 Genomic DNA. No translation available.
    AC021653 Genomic DNA. No translation available.
    AC048330 Genomic DNA. No translation available.
    AC069437 Genomic DNA. No translation available.
    AC078916 Genomic DNA. No translation available.
    AC079954 Genomic DNA. No translation available.
    AC084374 Genomic DNA. No translation available.
    AC117377 Genomic DNA. No translation available.
    AC126616 Genomic DNA. No translation available.
    AC141554 Genomic DNA. No translation available.
    AC141555 Genomic DNA. No translation available.
    AC141556 Genomic DNA. No translation available.
    BC026313 mRNA. Translation: AAH26313.2.
    BC068451 mRNA. Translation: AAH68451.1.
    BC142669 mRNA. Translation: AAI42670.1.
    BC150204 mRNA. Translation: AAI50205.1.
    AF145204 mRNA. Translation: AAD33951.1.
    AY620824 mRNA. Translation: AAT39519.1.
    CCDSiCCDS55864.1. [Q7Z6G8-9]
    CCDS55865.1. [Q7Z6G8-8]
    CCDS55866.1. [Q7Z6G8-7]
    CCDS55867.1. [Q7Z6G8-2]
    CCDS55868.1. [Q7Z6G8-5]
    CCDS55869.1. [Q7Z6G8-4]
    CCDS55870.1. [Q7Z6G8-3]
    CCDS55871.1. [Q7Z6G8-10]
    CCDS55872.1. [Q7Z6G8-1]
    RefSeqiNP_001190994.1. NM_001204065.1.
    NP_001190995.1. NM_001204066.1. [Q7Z6G8-8]
    NP_001190996.1. NM_001204067.1. [Q7Z6G8-10]
    NP_001190997.1. NM_001204068.1. [Q7Z6G8-4]
    NP_001190998.1. NM_001204069.1. [Q7Z6G8-5]
    NP_001190999.1. NM_001204070.1. [Q7Z6G8-2]
    NP_001191008.1. NM_001204079.1.
    NP_001191009.1. NM_001204080.1.
    NP_001191010.1. NM_001204081.1. [Q7Z6G8-9]
    NP_064525.1. NM_020140.3. [Q7Z6G8-7]
    NP_690001.3. NM_152788.4. [Q7Z6G8-1]
    NP_858056.2. NM_181670.3. [Q7Z6G8-3]
    UniGeneiHs.506458.

    Genome annotation databases

    GeneIDi56899.
    KEGGihsa:56899.
    UCSCiuc001tgd.2. human. [Q7Z6G8-7]
    uc001tge.2. human. [Q7Z6G8-1]
    uc001tgf.2. human. [Q7Z6G8-6]
    uc001tgi.3. human. [Q7Z6G8-3]
    uc001tgj.3. human. [Q7Z6G8-2]
    uc009ztr.3. human. [Q7Z6G8-5]
    uc009zts.2. human. [Q7Z6G8-4]

    Polymorphism databases

    DMDMi332278155.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY281131 mRNA. Translation: AAP37612.1 .
    AY281132 mRNA. Translation: AAP37613.1 .
    AY283057 mRNA. Translation: AAP38184.2 . Different initiation.
    AY753193 mRNA. Translation: AAV28691.1 .
    AF164792 mRNA. Translation: AAF80756.1 .
    AK289768 mRNA. Translation: BAF82457.1 .
    AK294191 mRNA. Translation: BAG57507.1 .
    AK294994 mRNA. Translation: BAG58059.1 .
    AC008126 Genomic DNA. No translation available.
    AC011248 Genomic DNA. No translation available.
    AC021653 Genomic DNA. No translation available.
    AC048330 Genomic DNA. No translation available.
    AC069437 Genomic DNA. No translation available.
    AC078916 Genomic DNA. No translation available.
    AC079954 Genomic DNA. No translation available.
    AC084374 Genomic DNA. No translation available.
    AC117377 Genomic DNA. No translation available.
    AC126616 Genomic DNA. No translation available.
    AC141554 Genomic DNA. No translation available.
    AC141555 Genomic DNA. No translation available.
    AC141556 Genomic DNA. No translation available.
    BC026313 mRNA. Translation: AAH26313.2 .
    BC068451 mRNA. Translation: AAH68451.1 .
    BC142669 mRNA. Translation: AAI42670.1 .
    BC150204 mRNA. Translation: AAI50205.1 .
    AF145204 mRNA. Translation: AAD33951.1 .
    AY620824 mRNA. Translation: AAT39519.1 .
    CCDSi CCDS55864.1. [Q7Z6G8-9 ]
    CCDS55865.1. [Q7Z6G8-8 ]
    CCDS55866.1. [Q7Z6G8-7 ]
    CCDS55867.1. [Q7Z6G8-2 ]
    CCDS55868.1. [Q7Z6G8-5 ]
    CCDS55869.1. [Q7Z6G8-4 ]
    CCDS55870.1. [Q7Z6G8-3 ]
    CCDS55871.1. [Q7Z6G8-10 ]
    CCDS55872.1. [Q7Z6G8-1 ]
    RefSeqi NP_001190994.1. NM_001204065.1.
    NP_001190995.1. NM_001204066.1. [Q7Z6G8-8 ]
    NP_001190996.1. NM_001204067.1. [Q7Z6G8-10 ]
    NP_001190997.1. NM_001204068.1. [Q7Z6G8-4 ]
    NP_001190998.1. NM_001204069.1. [Q7Z6G8-5 ]
    NP_001190999.1. NM_001204070.1. [Q7Z6G8-2 ]
    NP_001191008.1. NM_001204079.1.
    NP_001191009.1. NM_001204080.1.
    NP_001191010.1. NM_001204081.1. [Q7Z6G8-9 ]
    NP_064525.1. NM_020140.3. [Q7Z6G8-7 ]
    NP_690001.3. NM_152788.4. [Q7Z6G8-1 ]
    NP_858056.2. NM_181670.3. [Q7Z6G8-3 ]
    UniGenei Hs.506458.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2EAM NMR - A 808-874 [» ]
    2KE7 NMR - A 808-893 [» ]
    2KIV NMR - A 812-946 [» ]
    2M38 NMR - A 1042-1194 [» ]
    ProteinModelPortali Q7Z6G8.
    SMRi Q7Z6G8. Positions 5-307, 812-946, 1053-1187.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 121229. 7 interactions.
    IntActi Q7Z6G8. 3 interactions.
    MINTi MINT-258807.

    PTM databases

    PhosphoSitei Q7Z6G8.

    Polymorphism databases

    DMDMi 332278155.

    Proteomic databases

    PaxDbi Q7Z6G8.
    PRIDEi Q7Z6G8.

    Protocols and materials databases

    DNASUi 56899.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 56899.
    KEGGi hsa:56899.
    UCSCi uc001tgd.2. human. [Q7Z6G8-7 ]
    uc001tge.2. human. [Q7Z6G8-1 ]
    uc001tgf.2. human. [Q7Z6G8-6 ]
    uc001tgi.3. human. [Q7Z6G8-3 ]
    uc001tgj.3. human. [Q7Z6G8-2 ]
    uc009ztr.3. human. [Q7Z6G8-5 ]
    uc009zts.2. human. [Q7Z6G8-4 ]

    Organism-specific databases

    CTDi 56899.
    GeneCardsi GC12M099129.
    HGNCi HGNC:24600. ANKS1B.
    HPAi HPA044628.
    MIMi 607815. gene.
    neXtProti NX_Q7Z6G8.
    PharmGKBi PA128394692.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0666.
    HOVERGENi HBG050506.
    InParanoidi Q7Z6G8.
    OMAi RNGDQWV.
    OrthoDBi EOG78H3SN.
    TreeFami TF320582.

    Miscellaneous databases

    ChiTaRSi ANKS1B. human.
    EvolutionaryTracei Q7Z6G8.
    GeneWikii ANKS1B.
    GenomeRNAii 56899.
    NextBioi 62343.
    PROi Q7Z6G8.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q7Z6G8.
    Bgeei Q7Z6G8.
    Genevestigatori Q7Z6G8.

    Family and domain databases

    Gene3Di 1.10.150.50. 2 hits.
    1.25.40.20. 3 hits.
    2.30.29.30. 1 hit.
    InterProi IPR002110. Ankyrin_rpt.
    IPR020683. Ankyrin_rpt-contain_dom.
    IPR011993. PH_like_dom.
    IPR006020. PTB/PI_dom.
    IPR001660. SAM.
    IPR013761. SAM/pointed.
    IPR021129. SAM_type1.
    [Graphical view ]
    Pfami PF12796. Ank_2. 2 hits.
    PF00640. PID. 1 hit.
    PF00536. SAM_1. 2 hits.
    [Graphical view ]
    PRINTSi PR01415. ANKYRIN.
    SMARTi SM00248. ANK. 6 hits.
    SM00462. PTB. 1 hit.
    SM00454. SAM. 2 hits.
    [Graphical view ]
    SUPFAMi SSF47769. SSF47769. 2 hits.
    SSF48403. SSF48403. 1 hit.
    PROSITEi PS50297. ANK_REP_REGION. 1 hit.
    PS50088. ANK_REPEAT. 5 hits.
    PS01179. PID. 1 hit.
    PS50105. SAM_DOMAIN. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The intracellular localization of amyloid beta protein precursor (AbetaPP) intracellular domain associated protein-1 (AIDA-1) is regulated by AbetaPP and alternative splicing."
      Ghersi E., Vito P., Lopez P., Abdallah M., D'Adamio L.
      J. Alzheimers Dis. 6:67-78(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 6 AND 4), INTERACTION WITH APP, SUBCELLULAR LOCATION.
      Tissue: Fetal brain.
    2. "A novel EB-1/AIDA-1 isoform, AIDA-1c, interacts with the Cajal body protein coilin."
      Xu H., Hebert M.D.
      BMC Cell Biol. 6:23-23(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, INTERACTION WITH COIL, SUBCELLULAR LOCATION.
      Tissue: Brain.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7).
      Tissue: Adrenal gland.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 9 AND 10).
      Tissue: Amygdala and Brain.
    5. "The finished DNA sequence of human chromosome 12."
      Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
      , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
      Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 5; 7 AND 8).
      Tissue: Brain and Hippocampus.
    7. "EB-1, a tyrosine kinase signal transduction gene, is transcriptionally activated in the t(1;19) subset of pre-B ALL, which express oncoprotein E2a-Pbx1."
      Fu X., McGrath S., Pasillas M., Nakazawa S., Kamps M.P.
      Oncogene 18:4920-4929(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 294-1248 (ISOFORM 1), INDUCTION, TISSUE SPECIFICITY.
    8. "Amyloid-beta protein precursor (AbetaPP) intracellular domain-associated protein-1 proteins bind to AbetaPP and modulate its processing in an isoform-specific manner."
      Ghersi E., Noviello C., D'Adamio L.
      J. Biol. Chem. 279:49105-49112(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 425-1192 (ISOFORM 1), FUNCTION, INTERACTION WITH APP, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    9. "The effects of siRNA-mediated inhibition of E2A-PBX1 on EB-1 and Wnt16b expression in the 697 pre-B leukemia cell line."
      Casagrande G., te Kronnie G., Basso G.
      Haematologica 91:765-771(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: INDUCTION.
    10. "Identification of phosphotyrosine binding domain-containing proteins as novel downstream targets of the EphA8 signaling function."
      Shin J., Gu C., Park E., Park S.
      Mol. Cell. Biol. 27:8113-8126(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH EPHA8.
    11. "A nuclear localization signal at the SAM-SAM domain interface of AIDA-1 suggests a requirement for domain uncoupling prior to nuclear import."
      Kurabi A., Brener S., Mobli M., Kwan J.J., Donaldson L.W.
      J. Mol. Biol. 392:1168-1177(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: STRUCTURE BY NMR OF 813-947, SUBCELLULAR LOCATION, NUCLEAR LOCALIZATION SIGNAL.

    Entry informationi

    Entry nameiANS1B_HUMAN
    AccessioniPrimary (citable) accession number: Q7Z6G8
    Secondary accession number(s): A5PKY5
    , A7E259, A8K153, A8MSN4, B4DFP6, B4DH98, F8VPM3, F8VZR9, F8WC27, Q5XLJ0, Q6IVB5, Q6NUS4, Q7Z6G6, Q7Z6G7, Q8TAP3, Q9NRX7, Q9Y5K9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 8, 2008
    Last sequence update: May 3, 2011
    Last modified: October 1, 2014
    This is version 97 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3