Q7Z6B7 (SRGP1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 97.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: SLIT-ROBO Rho GTPase-activating protein 1 Short name=srGAP1 Alternative name(s): Rho GTPase-activating protein 13 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1085 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | GTPase-activating protein for RhoA and Cdc42 small GTPases. Together with CDC42 seems to be involved in the pathway mediating the repulsive signaling of Robo and Slit proteins in neuronal migration. SLIT2, probably through interaction with ROBO1, increases the interaction of SRGAP1 with ROBO1 and inactivates CDC42. Ref.3 |
| Subunit structure | Homodimer Probable. Forms a heterooligomer with SRGAP2 and SRGAP3 through its F-BAR domain. Interacts with ROBO1, CDC42 and RHOA. Interacts with FASLG. Ref.3 Ref.7 Ref.10 |
| Tissue specificity | Expressed in brain, lung, kidney, and testis. Ref.3 |
| Domain | The F-BAR domain mediates oligomerization, binds membranes, and constrains plasma membrane protrusions. Ref.10 |
| Sequence similarities | Contains 1 FCH domain. Contains 1 Rho-GAP domain. Contains 1 SH3 domain. |
| Sequence caution | The sequence BAA92542.1 differs from that shown. Reason: Erroneous initiation. The sequence BAA92542.1 differs from that shown. Reason: Intron retention. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil SH3 domain |
| Molecular function | GTPase activation |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | Rho protein signal transduction Inferred from electronic annotation. Source: Compara axon guidanceTraceable author statement. Source: Reactome cell migrationInferred from electronic annotation. Source: Compara regulation of small GTPase mediated signal transductionTraceable author statement. Source: Reactome small GTPase mediated signal transductionTraceable author statement. Source: Reactome |
| Cellular_component | cytosol Traceable author statement. Source: Reactome |
| Molecular_function | Rho GTPase activator activity Inferred from electronic annotation. Source: Compara |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q7Z6B7-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q7Z6B7-2) The sequence of this isoform differs from the canonical sequence as follows: 479-513: RPPNVPPKPQKHRKSRPRSQYNTKLFNGDLETFVK → SRGRRNSHTRHQ | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1085 | 1085 | SLIT-ROBO Rho GTPase-activating protein 1 | PRO_0000056765 | |||||
Regions | |||||||||
| Domain | 22 – 87 | 66 | FCH | ||||||
| Domain | 506 – 694 | 189 | Rho-GAP | ||||||
| Domain | 743 – 802 | 60 | SH3 | ||||||
| Region | 1 – 516 | 516 | F-BAR domain | ||||||
| Coiled coil | 351 – 390 | 40 | Potential | ||||||
| Coiled coil | 956 – 985 | 30 | Potential | ||||||
| Compositional bias | 854 – 857 | 4 | Poly-Pro | ||||||
| Compositional bias | 909 – 912 | 4 | Poly-Arg | ||||||
| Compositional bias | 1027 – 1032 | 6 | Poly-Ser | ||||||
Amino acid modifications | |||||||||
| Modified residue | 999 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 1001 | 1 | Phosphothreonine Ref.6 | ||||||
| Modified residue | 1032 | 1 | Phosphoserine Ref.6 | ||||||
Natural variations | |||||||||
| Alternative sequence | 479 – 513 | 35 | RPPNV…ETFVK → SRGRRNSHTRHQ in isoform 2. | VSP_010580 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Uterus. |
| [2] | "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O. DNA Res. 7:65-73(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 23-1085 (ISOFORM 2). Tissue: Brain. |
| [3] | "Signal transduction in neuronal migration: roles of GTPase activating proteins and the small GTPase Cdc42 in the Slit-Robo pathway." Wong K., Ren X.R., Huang Y.Z., Xie Y., Liu G., Saito H., Tang H., Wen L., Brady-Kalnay S.M., Mei L., Wu J.Y., Xiong W.C., Rao Y. Cell 107:209-221(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH ROBO1; CDC42 AND RHOA. |
| [4] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [5] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [6] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-999; THR-1001 AND SER-1032, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [7] | "Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening." Voss M., Lettau M., Janssen O. BMC Immunol. 10:53-53(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH FASLG. |
| [8] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [9] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [10] | "The F-BAR domains from srGAP1, srGAP2, and srGAP3 differentially regulate membrane deformation." Coutinho-Budd J., Ghukasyan V., Zylka M.J., Polleux F. J. Cell Sci. 125:3390-3401(2012) [PubMed] [Europe PMC] [Abstract] Cited for: HETEROOLIGOMERIZATION, F-BAR DOMAIN. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | BC053903 mRNA. Translation: AAH53903.1. AB037725 mRNA. Translation: BAA92542.1. Different initiation. |
| IPI | IPI00376259. IPI00414827. |
| PIR | G59436. |
| RefSeq | NP_065813.1. NM_020762.2. |
| UniGene | Hs.210751. Hs.593803. |
3D structure databases | |
| ProteinModelPortal | Q7Z6B7. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q7Z6B7. 1 interaction. |
| MINT | MINT-3308471. |
| STRING | 9606.ENSP00000347198. |
PTM databases | |
| PhosphoSite | Q7Z6B7. |
Polymorphism databases | |
| DMDM | 48428624. |
Proteomic databases | |
| PaxDb | Q7Z6B7. |
| PRIDE | Q7Z6B7. |
Protocols and materials databases | |
| DNASU | 57522. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000355086; ENSP00000347198; ENSG00000196935. ENST00000357825; ENSP00000350480; ENSG00000196935. |
| GeneID | 57522. |
| KEGG | hsa:57522. |
| UCSC | uc001srv.2. human. uc010ssp.1. human. |
Organism-specific databases | |
| CTD | 57522. |
| GeneCards | GC12P064238. |
| HGNC | HGNC:17382. SRGAP1. |
| HPA | HPA052416. |
| MIM | 606523. gene. |
| neXtProt | NX_Q7Z6B7. |
| PharmGKB | PA134887956. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG264793. |
| HOGENOM | HOG000039980. |
| HOVERGEN | HBG051637. |
| InParanoid | Q7Z6B7. |
| KO | K07526. |
| OMA | ADKSCTM. |
| OrthoDB | EOG4SJ5D1. |
| PhylomeDB | Q7Z6B7. |
Enzyme and pathway databases | |
| Reactome | REACT_111045. Developmental Biology. REACT_111102. Signal Transduction. REACT_96538. Developmental Biology. |
Gene expression databases | |
| ArrayExpress | Q7Z6B7. |
| Bgee | Q7Z6B7. |
| CleanEx | HS_SRGAP1. |
| Genevestigator | Q7Z6B7. |
| GermOnline | ENSG00000196935. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.10.555.10. 1 hit. |
| InterPro | IPR001060. FCH_dom. IPR008936. Rho_GTPase_activation_prot. IPR000198. RhoGAP_dom. IPR001452. SH3_domain. [Graphical view] |
| Pfam | PF00611. FCH. 1 hit. PF00620. RhoGAP. 1 hit. PF00018. SH3_1. 1 hit. [Graphical view] |
| SMART | SM00055. FCH. 1 hit. SM00324. RhoGAP. 1 hit. SM00326. SH3. 1 hit. [Graphical view] |
| SUPFAM | SSF48350. Rho_GAP. 1 hit. SSF50044. SH3. 1 hit. |
| PROSITE | PS50133. FCH. 1 hit. PS50238. RHOGAP. 1 hit. PS50002. SH3. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | SRGAP1. human. |
| GenomeRNAi | 57522. |
| NextBio | 63902. |
| SOURCE | Search... |
Entry information
| Entry name | SRGP1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q7Z6B7 Secondary accession number(s): Q9H8A3, Q9P2P2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
