Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SLIT-ROBO Rho GTPase-activating protein 1

Gene

SRGAP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

GTPase-activating protein for RhoA and Cdc42 small GTPases. Together with CDC42 seems to be involved in the pathway mediating the repulsive signaling of Robo and Slit proteins in neuronal migration. SLIT2, probably through interaction with ROBO1, increases the interaction of SRGAP1 with ROBO1 and inactivates CDC42.1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

GTPase activation

Enzyme and pathway databases

ReactomeiREACT_11051. Rho GTPase cycle.
REACT_19342. Inactivation of Cdc42 and Rac.

Names & Taxonomyi

Protein namesi
Recommended name:
SLIT-ROBO Rho GTPase-activating protein 1
Short name:
srGAP1
Alternative name(s):
Rho GTPase-activating protein 13
Gene namesi
Name:SRGAP1
Synonyms:ARHGAP13, KIAA1304
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:17382. SRGAP1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134887956.

Polymorphism and mutation databases

BioMutaiSRGAP1.
DMDMi48428624.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10851085SLIT-ROBO Rho GTPase-activating protein 1PRO_0000056765Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei999 – 9991Phosphoserine1 Publication
Modified residuei1001 – 10011Phosphothreonine1 Publication
Modified residuei1032 – 10321Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ7Z6B7.
PaxDbiQ7Z6B7.
PRIDEiQ7Z6B7.

PTM databases

PhosphoSiteiQ7Z6B7.

Expressioni

Tissue specificityi

Expressed in brain, lung, kidney, and testis.1 Publication

Gene expression databases

BgeeiQ7Z6B7.
CleanExiHS_SRGAP1.
ExpressionAtlasiQ7Z6B7. baseline and differential.
GenevisibleiQ7Z6B7. HS.

Organism-specific databases

HPAiHPA052416.

Interactioni

Subunit structurei

Homodimer (Probable). Forms a heterooligomer with SRGAP2 and SRGAP3 through its F-BAR domain. Interacts with ROBO1, CDC42 and RHOA. Interacts with FASLG.Curated2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
HTTP428584EBI-2481729,EBI-466029

Protein-protein interaction databases

BioGridi121583. 4 interactions.
DIPiDIP-53826N.
IntActiQ7Z6B7. 3 interactions.
MINTiMINT-3308471.
STRINGi9606.ENSP00000347198.

Structurei

3D structure databases

ProteinModelPortaliQ7Z6B7.
SMRiQ7Z6B7. Positions 482-694, 745-799.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini19 – 314296F-BARPROSITE-ProRule annotationAdd
BLAST
Domaini506 – 694189Rho-GAPPROSITE-ProRule annotationAdd
BLAST
Domaini743 – 80260SH3PROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili351 – 39040Sequence AnalysisAdd
BLAST
Coiled coili956 – 98530Sequence AnalysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi854 – 8574Poly-Pro
Compositional biasi909 – 9124Poly-Arg
Compositional biasi1027 – 10326Poly-Ser

Domaini

The F-BAR domain mediates oligomerization, binds membranes, and constrains plasma membrane protrusions.1 Publication

Sequence similaritiesi

Contains 1 F-BAR domain.PROSITE-ProRule annotation
Contains 1 Rho-GAP domain.PROSITE-ProRule annotation
Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, SH3 domain

Phylogenomic databases

eggNOGiNOG264793.
GeneTreeiENSGT00760000118863.
HOGENOMiHOG000039980.
HOVERGENiHBG051637.
InParanoidiQ7Z6B7.
KOiK07526.
OMAiMEMYPTA.
OrthoDBiEOG7966FQ.
PhylomeDBiQ7Z6B7.
TreeFamiTF315892.

Family and domain databases

Gene3Di1.10.555.10. 1 hit.
InterProiIPR031160. F_BAR.
IPR001060. FCH_dom.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF00611. FCH. 1 hit.
PF00620. RhoGAP. 1 hit.
PF14604. SH3_9. 1 hit.
[Graphical view]
SMARTiSM00055. FCH. 1 hit.
SM00324. RhoGAP. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF48350. SSF48350. 1 hit.
SSF50044. SSF50044. 1 hit.
PROSITEiPS51741. F_BAR. 1 hit.
PS50238. RHOGAP. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7Z6B7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSTPSRFKKD KEIIAEYESQ VKEIRAQLVE QQKCLEQQTE MRVQLLQDLQ
60 70 80 90 100
DFFRKKAEIE TEYSRNLEKL AERFMAKTRS TKDHQQYKKD QNLLSPVNCW
110 120 130 140 150
YLLLNQVRRE SKDHATLSDI YLNNVIMRFM QISEDSTRMF KKSKEIAFQL
160 170 180 190 200
HEDLMKVLNE LYTVMKTYHM YHAESISAES KLKEAEKQEE KQIGRSGDPV
210 220 230 240 250
FHIRLEERHQ RRSSVKKIEK MKEKRQAKYS ENKLKSIKAR NEYLLTLEAT
260 270 280 290 300
NASVFKYYIH DLSDLIDCCD LGYHASLNRA LRTYLSAEYN LETSRHEGLD
310 320 330 340 350
IIENAVDNLE PRSDKQRFME MYPAAFCPPM KFEFQSHMGD EVCQVSAQQP
360 370 380 390 400
VQAELMLRYQ QLQSRLATLK IENEEVKKTT EATLQTIQDM VTIEDYDVSE
410 420 430 440 450
CFQHSRSTES VKSTVSETYL SKPSIAKRRA NQQETEQFYF MKLREYLEGS
460 470 480 490 500
NLITKLQAKH DLLQRTLGEG HRAEYMTTRP PNVPPKPQKH RKSRPRSQYN
510 520 530 540 550
TKLFNGDLET FVKDSGQVIP LIVESCIRFI NLYGLQHQGI FRVSGSQVEV
560 570 580 590 600
NDIKNSFERG ENPLADDQSN HDINSVAGVL KLYFRGLENP LFPKERFNDL
610 620 630 640 650
ISCIRIDNLY ERALHIRKLL LTLPRSVLIV MRYLFAFLNH LSQYSDENMM
660 670 680 690 700
DPYNLAICFG PTLMPVPEIQ DQVSCQAHVN EIIKTIIIHH ETIFPDAKEL
710 720 730 740 750
DGPVYEKCMA GDDYCDSPYS EHGTLEEVDQ DAGTEPHTSE DECEPIEAIA
760 770 780 790 800
KFDYVGRSAR ELSFKKGASL LLYHRASEDW WEGRHNGIDG LVPHQYIVVQ
810 820 830 840 850
DMDDTFSDTL SQKADSEASS GPVTEDKSSS KDMNSPTDRH PDGYLARQRK
860 870 880 890 900
RGEPPPPVRR PGRTSDGHCP LHPPHALSNS SVDLGSPSLA SHPRGLLQNR
910 920 930 940 950
GLNNDSPERR RRPGHGSLTN ISRHDSLKKI DSPPIRRSTS SGQYTGFNDH
960 970 980 990 1000
KPLDPETIAQ DIEETMNTAL NELRELERQS TAKHAPDVVL DTLEQVKNSP
1010 1020 1030 1040 1050
TPATSTESLS PLHNVALRSS EPQIRRSTSS SSDTMSTFKP MVAPRMGVQL
1060 1070 1080
KPPALRPKPA VLPKTNPTIG PAPPPQGPTD KSCTM
Length:1,085
Mass (Da):124,264
Last modified:October 1, 2003 - v1
Checksum:iD7ED1F651344F0D9
GO
Isoform 2 (identifier: Q7Z6B7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     479-513: RPPNVPPKPQKHRKSRPRSQYNTKLFNGDLETFVK → SRGRRNSHTRHQ

Note: No experimental confirmation available.
Show »
Length:1,062
Mass (Da):121,594
Checksum:iC9872F6AA2825358
GO

Sequence cautioni

The sequence BAA92542.1 differs from that shown.Intron retention.Curated
The sequence BAA92542.1 differs from that shown. Reason: Erroneous initiation. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei479 – 51335RPPNV…ETFVK → SRGRRNSHTRHQ in isoform 2. 1 PublicationVSP_010580Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC053903 mRNA. Translation: AAH53903.1.
AB037725 mRNA. Translation: BAA92542.1. Different initiation.
CCDSiCCDS8967.1. [Q7Z6B7-1]
PIRiG59436.
RefSeqiNP_065813.1. NM_020762.2. [Q7Z6B7-1]
XP_005269099.1. XM_005269042.2. [Q7Z6B7-2]
UniGeneiHs.210751.
Hs.593803.

Genome annotation databases

EnsembliENST00000355086; ENSP00000347198; ENSG00000196935.
GeneIDi57522.
KEGGihsa:57522.
UCSCiuc010ssp.1. human. [Q7Z6B7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC053903 mRNA. Translation: AAH53903.1.
AB037725 mRNA. Translation: BAA92542.1. Different initiation.
CCDSiCCDS8967.1. [Q7Z6B7-1]
PIRiG59436.
RefSeqiNP_065813.1. NM_020762.2. [Q7Z6B7-1]
XP_005269099.1. XM_005269042.2. [Q7Z6B7-2]
UniGeneiHs.210751.
Hs.593803.

3D structure databases

ProteinModelPortaliQ7Z6B7.
SMRiQ7Z6B7. Positions 482-694, 745-799.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121583. 4 interactions.
DIPiDIP-53826N.
IntActiQ7Z6B7. 3 interactions.
MINTiMINT-3308471.
STRINGi9606.ENSP00000347198.

PTM databases

PhosphoSiteiQ7Z6B7.

Polymorphism and mutation databases

BioMutaiSRGAP1.
DMDMi48428624.

Proteomic databases

MaxQBiQ7Z6B7.
PaxDbiQ7Z6B7.
PRIDEiQ7Z6B7.

Protocols and materials databases

DNASUi57522.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000355086; ENSP00000347198; ENSG00000196935.
GeneIDi57522.
KEGGihsa:57522.
UCSCiuc010ssp.1. human. [Q7Z6B7-1]

Organism-specific databases

CTDi57522.
GeneCardsiGC12P064238.
HGNCiHGNC:17382. SRGAP1.
HPAiHPA052416.
MIMi606523. gene.
neXtProtiNX_Q7Z6B7.
PharmGKBiPA134887956.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG264793.
GeneTreeiENSGT00760000118863.
HOGENOMiHOG000039980.
HOVERGENiHBG051637.
InParanoidiQ7Z6B7.
KOiK07526.
OMAiMEMYPTA.
OrthoDBiEOG7966FQ.
PhylomeDBiQ7Z6B7.
TreeFamiTF315892.

Enzyme and pathway databases

ReactomeiREACT_11051. Rho GTPase cycle.
REACT_19342. Inactivation of Cdc42 and Rac.

Miscellaneous databases

ChiTaRSiSRGAP1. human.
GeneWikiiSRGAP1.
GenomeRNAii57522.
NextBioi63902.
PROiQ7Z6B7.
SOURCEiSearch...

Gene expression databases

BgeeiQ7Z6B7.
CleanExiHS_SRGAP1.
ExpressionAtlasiQ7Z6B7. baseline and differential.
GenevisibleiQ7Z6B7. HS.

Family and domain databases

Gene3Di1.10.555.10. 1 hit.
InterProiIPR031160. F_BAR.
IPR001060. FCH_dom.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF00611. FCH. 1 hit.
PF00620. RhoGAP. 1 hit.
PF14604. SH3_9. 1 hit.
[Graphical view]
SMARTiSM00055. FCH. 1 hit.
SM00324. RhoGAP. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF48350. SSF48350. 1 hit.
SSF50044. SSF50044. 1 hit.
PROSITEiPS51741. F_BAR. 1 hit.
PS50238. RHOGAP. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Uterus.
  2. "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
    DNA Res. 7:65-73(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 23-1085 (ISOFORM 2).
    Tissue: Brain.
  3. "Signal transduction in neuronal migration: roles of GTPase activating proteins and the small GTPase Cdc42 in the Slit-Robo pathway."
    Wong K., Ren X.R., Huang Y.Z., Xie Y., Liu G., Saito H., Tang H., Wen L., Brady-Kalnay S.M., Mei L., Wu J.Y., Xiong W.C., Rao Y.
    Cell 107:209-221(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH ROBO1; CDC42 AND RHOA.
  4. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  5. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
    Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
    J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-999; THR-1001 AND SER-1032, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. "Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening."
    Voss M., Lettau M., Janssen O.
    BMC Immunol. 10:53-53(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH FASLG.
  8. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  10. "The F-BAR domains from srGAP1, srGAP2, and srGAP3 differentially regulate membrane deformation."
    Coutinho-Budd J., Ghukasyan V., Zylka M.J., Polleux F.
    J. Cell Sci. 125:3390-3401(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: HETEROOLIGOMERIZATION, DOMAIN F-BAR.

Entry informationi

Entry nameiSRGP1_HUMAN
AccessioniPrimary (citable) accession number: Q7Z6B7
Secondary accession number(s): Q9H8A3, Q9P2P2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 7, 2004
Last sequence update: October 1, 2003
Last modified: July 22, 2015
This is version 117 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.