Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q7Z6B7 (SRGP1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 109. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
SLIT-ROBO Rho GTPase-activating protein 1

Short name=srGAP1
Alternative name(s):
Rho GTPase-activating protein 13
Gene names
Name:SRGAP1
Synonyms:ARHGAP13, KIAA1304
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1085 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

GTPase-activating protein for RhoA and Cdc42 small GTPases. Together with CDC42 seems to be involved in the pathway mediating the repulsive signaling of Robo and Slit proteins in neuronal migration. SLIT2, probably through interaction with ROBO1, increases the interaction of SRGAP1 with ROBO1 and inactivates CDC42. Ref.3

Subunit structure

Homodimer Probable. Forms a heterooligomer with SRGAP2 and SRGAP3 through its F-BAR domain. Interacts with ROBO1, CDC42 and RHOA. Interacts with FASLG. Ref.3 Ref.7 Ref.10

Tissue specificity

Expressed in brain, lung, kidney, and testis. Ref.3

Domain

The F-BAR domain mediates oligomerization, binds membranes, and constrains plasma membrane protrusions. Ref.10

Sequence similarities

Contains 1 FCH domain.

Contains 1 Rho-GAP domain.

Contains 1 SH3 domain.

Sequence caution

The sequence BAA92542.1 differs from that shown. Reason: Erroneous initiation.

The sequence BAA92542.1 differs from that shown. Reason: Intron retention.

Binary interactions

With

Entry

#Exp.

IntAct

Notes

HTTP428584EBI-2481729,EBI-466029

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q7Z6B7-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q7Z6B7-2)

The sequence of this isoform differs from the canonical sequence as follows:
     479-513: RPPNVPPKPQKHRKSRPRSQYNTKLFNGDLETFVK → SRGRRNSHTRHQ
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 10851085SLIT-ROBO Rho GTPase-activating protein 1
PRO_0000056765

Regions

Domain22 – 8766FCH
Domain506 – 694189Rho-GAP
Domain743 – 80260SH3
Region1 – 516516F-BAR domain
Coiled coil351 – 39040 Potential
Coiled coil956 – 98530 Potential
Compositional bias854 – 8574Poly-Pro
Compositional bias909 – 9124Poly-Arg
Compositional bias1027 – 10326Poly-Ser

Amino acid modifications

Modified residue9991Phosphoserine Ref.6
Modified residue10011Phosphothreonine Ref.6
Modified residue10321Phosphoserine Ref.6

Natural variations

Alternative sequence479 – 51335RPPNV…ETFVK → SRGRRNSHTRHQ in isoform 2.
VSP_010580

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 1, 2003. Version 1.
Checksum: D7ED1F651344F0D9

FASTA1,085124,264
        10         20         30         40         50         60 
MSTPSRFKKD KEIIAEYESQ VKEIRAQLVE QQKCLEQQTE MRVQLLQDLQ DFFRKKAEIE 

        70         80         90        100        110        120 
TEYSRNLEKL AERFMAKTRS TKDHQQYKKD QNLLSPVNCW YLLLNQVRRE SKDHATLSDI 

       130        140        150        160        170        180 
YLNNVIMRFM QISEDSTRMF KKSKEIAFQL HEDLMKVLNE LYTVMKTYHM YHAESISAES 

       190        200        210        220        230        240 
KLKEAEKQEE KQIGRSGDPV FHIRLEERHQ RRSSVKKIEK MKEKRQAKYS ENKLKSIKAR 

       250        260        270        280        290        300 
NEYLLTLEAT NASVFKYYIH DLSDLIDCCD LGYHASLNRA LRTYLSAEYN LETSRHEGLD 

       310        320        330        340        350        360 
IIENAVDNLE PRSDKQRFME MYPAAFCPPM KFEFQSHMGD EVCQVSAQQP VQAELMLRYQ 

       370        380        390        400        410        420 
QLQSRLATLK IENEEVKKTT EATLQTIQDM VTIEDYDVSE CFQHSRSTES VKSTVSETYL 

       430        440        450        460        470        480 
SKPSIAKRRA NQQETEQFYF MKLREYLEGS NLITKLQAKH DLLQRTLGEG HRAEYMTTRP 

       490        500        510        520        530        540 
PNVPPKPQKH RKSRPRSQYN TKLFNGDLET FVKDSGQVIP LIVESCIRFI NLYGLQHQGI 

       550        560        570        580        590        600 
FRVSGSQVEV NDIKNSFERG ENPLADDQSN HDINSVAGVL KLYFRGLENP LFPKERFNDL 

       610        620        630        640        650        660 
ISCIRIDNLY ERALHIRKLL LTLPRSVLIV MRYLFAFLNH LSQYSDENMM DPYNLAICFG 

       670        680        690        700        710        720 
PTLMPVPEIQ DQVSCQAHVN EIIKTIIIHH ETIFPDAKEL DGPVYEKCMA GDDYCDSPYS 

       730        740        750        760        770        780 
EHGTLEEVDQ DAGTEPHTSE DECEPIEAIA KFDYVGRSAR ELSFKKGASL LLYHRASEDW 

       790        800        810        820        830        840 
WEGRHNGIDG LVPHQYIVVQ DMDDTFSDTL SQKADSEASS GPVTEDKSSS KDMNSPTDRH 

       850        860        870        880        890        900 
PDGYLARQRK RGEPPPPVRR PGRTSDGHCP LHPPHALSNS SVDLGSPSLA SHPRGLLQNR 

       910        920        930        940        950        960 
GLNNDSPERR RRPGHGSLTN ISRHDSLKKI DSPPIRRSTS SGQYTGFNDH KPLDPETIAQ 

       970        980        990       1000       1010       1020 
DIEETMNTAL NELRELERQS TAKHAPDVVL DTLEQVKNSP TPATSTESLS PLHNVALRSS 

      1030       1040       1050       1060       1070       1080 
EPQIRRSTSS SSDTMSTFKP MVAPRMGVQL KPPALRPKPA VLPKTNPTIG PAPPPQGPTD 


KSCTM 

« Hide

Isoform 2 [UniParc].

Checksum: C9872F6AA2825358
Show »

FASTA1,062121,594

References

« Hide 'large scale' references
[1]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Uterus.
[2]"Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
DNA Res. 7:65-73(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 23-1085 (ISOFORM 2).
Tissue: Brain.
[3]"Signal transduction in neuronal migration: roles of GTPase activating proteins and the small GTPase Cdc42 in the Slit-Robo pathway."
Wong K., Ren X.R., Huang Y.Z., Xie Y., Liu G., Saito H., Tang H., Wen L., Brady-Kalnay S.M., Mei L., Wu J.Y., Xiong W.C., Rao Y.
Cell 107:209-221(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH ROBO1; CDC42 AND RHOA.
[4]"Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[5]"Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[6]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-999; THR-1001 AND SER-1032, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[7]"Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening."
Voss M., Lettau M., Janssen O.
BMC Immunol. 10:53-53(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH FASLG.
[8]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[9]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[10]"The F-BAR domains from srGAP1, srGAP2, and srGAP3 differentially regulate membrane deformation."
Coutinho-Budd J., Ghukasyan V., Zylka M.J., Polleux F.
J. Cell Sci. 125:3390-3401(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: HETEROOLIGOMERIZATION, DOMAIN F-BAR.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
BC053903 mRNA. Translation: AAH53903.1.
AB037725 mRNA. Translation: BAA92542.1. Different initiation.
CCDSCCDS8967.1. [Q7Z6B7-1]
PIRG59436.
RefSeqNP_065813.1. NM_020762.2. [Q7Z6B7-1]
XP_005269099.1. XM_005269042.1. [Q7Z6B7-2]
UniGeneHs.210751.
Hs.593803.

3D structure databases

ProteinModelPortalQ7Z6B7.
SMRQ7Z6B7. Positions 482-694, 745-799.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid121583. 4 interactions.
IntActQ7Z6B7. 3 interactions.
MINTMINT-3308471.
STRING9606.ENSP00000347198.

PTM databases

PhosphoSiteQ7Z6B7.

Polymorphism databases

DMDM48428624.

Proteomic databases

MaxQBQ7Z6B7.
PaxDbQ7Z6B7.
PRIDEQ7Z6B7.

Protocols and materials databases

DNASU57522.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000355086; ENSP00000347198; ENSG00000196935. [Q7Z6B7-1]
ENST00000357825; ENSP00000350480; ENSG00000196935. [Q7Z6B7-2]
GeneID57522.
KEGGhsa:57522.
UCSCuc010ssp.1. human. [Q7Z6B7-1]

Organism-specific databases

CTD57522.
GeneCardsGC12P064238.
HGNCHGNC:17382. SRGAP1.
HPAHPA052416.
MIM606523. gene.
neXtProtNX_Q7Z6B7.
PharmGKBPA134887956.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG264793.
HOGENOMHOG000039980.
HOVERGENHBG051637.
InParanoidQ7Z6B7.
KOK07526.
OMAADKSCTM.
OrthoDBEOG7966FQ.
PhylomeDBQ7Z6B7.
TreeFamTF315892.

Enzyme and pathway databases

ReactomeREACT_111045. Developmental Biology.
REACT_111102. Signal Transduction.
REACT_195021. Developmental Biology.

Gene expression databases

ArrayExpressQ7Z6B7.
BgeeQ7Z6B7.
CleanExHS_SRGAP1.
GenevestigatorQ7Z6B7.

Family and domain databases

Gene3D1.10.555.10. 1 hit.
InterProIPR001060. FCH_dom.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
IPR001452. SH3_domain.
[Graphical view]
PfamPF00611. FCH. 1 hit.
PF00620. RhoGAP. 1 hit.
PF14604. SH3_9. 1 hit.
[Graphical view]
SMARTSM00055. FCH. 1 hit.
SM00324. RhoGAP. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMSSF48350. SSF48350. 1 hit.
SSF50044. SSF50044. 1 hit.
PROSITEPS50133. FCH. 1 hit.
PS50238. RHOGAP. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSSRGAP1. human.
GeneWikiSRGAP1.
GenomeRNAi57522.
NextBio63902.
PROQ7Z6B7.
SOURCESearch...

Entry information

Entry nameSRGP1_HUMAN
AccessionPrimary (citable) accession number: Q7Z6B7
Secondary accession number(s): Q9H8A3, Q9P2P2
Entry history
Integrated into UniProtKB/Swiss-Prot: June 7, 2004
Last sequence update: October 1, 2003
Last modified: July 9, 2014
This is version 109 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 12

Human chromosome 12: entries, gene names and cross-references to MIM