Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Coiled-coil domain-containing protein 91

Gene

CCDC91

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Involved in the regulation of membrane traffic through the trans-Golgi network (TGN).

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Protein transport, Transport

Names & Taxonomyi

Protein namesi
Recommended name:
Coiled-coil domain-containing protein 91
Alternative name(s):
GGA-binding partner
p56 accessory protein
Gene namesi
Name:CCDC91
Synonyms:GGABP
ORF Names:HSD8
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:24855. CCDC91.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi55297.
OpenTargetsiENSG00000123106.
PharmGKBiPA144596458.

Polymorphism and mutation databases

BioMutaiCCDC91.
DMDMi296434429.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000874781 – 441Coiled-coil domain-containing protein 91Add BLAST441

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei43PhosphoserineBy similarity1
Modified residuei46PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ7Z6B0.
MaxQBiQ7Z6B0.
PaxDbiQ7Z6B0.
PeptideAtlasiQ7Z6B0.
PRIDEiQ7Z6B0.
TopDownProteomicsiQ7Z6B0-1. [Q7Z6B0-1]

PTM databases

iPTMnetiQ7Z6B0.
PhosphoSitePlusiQ7Z6B0.

Expressioni

Tissue specificityi

Widely expressed.1 Publication

Gene expression databases

BgeeiENSG00000123106.
CleanExiHS_CCDC91.
ExpressionAtlasiQ7Z6B0. baseline and differential.
GenevisibleiQ7Z6B0. HS.

Organism-specific databases

HPAiHPA038169.

Interactioni

Subunit structurei

Homodimer. Interacts with GGA1, GGA2 and AP1G1.2 Publications

Protein-protein interaction databases

BioGridi120584. 12 interactors.
IntActiQ7Z6B0. 5 interactors.
MINTiMINT-1484759.
STRINGi9606.ENSP00000370658.

Structurei

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1OM9X-ray2.50P/Q2-16[»]
ProteinModelPortaliQ7Z6B0.
SMRiQ7Z6B0.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ7Z6B0.

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 16GGA1-binding motifAdd BLAST16
Regioni210 – 413HomodimerizationAdd BLAST204

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili130 – 209Sequence analysisAdd BLAST80
Coiled coili249 – 407Sequence analysisAdd BLAST159

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IJYM. Eukaryota.
ENOG4111XJH. LUCA.
GeneTreeiENSGT00390000015899.
HOVERGENiHBG081051.
InParanoidiQ7Z6B0.
OMAiPENTHAD.
OrthoDBiEOG091G0APS.
PhylomeDBiQ7Z6B0.
TreeFamiTF336441.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7Z6B0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDDDDFGGFE AAETFDGGSG ETQTTSPAIP WAAFPAVSGV HLSPSSPEIV
60 70 80 90 100
LDRDHSSSIG CLSSDAIISS PENTHAANSI VSQTIPKAQI QQSTHTHLDI
110 120 130 140 150
SLFPLGLTDE KSNGTIALVD DSEDPGANVS NIQLQQKISS LEIKLKVSEE
160 170 180 190 200
EKQRIKQDVE SLMEKHNVLE KGFLKEKEQE AISFQDRYKE LQEKHKQELE
210 220 230 240 250
DMRKAGHEAL SIIVDEYKAL LQSSVKQQVE AIEKQYISAI EKQAHKCEEL
260 270 280 290 300
LNAQHQRLLE MLDTEKELLK EKIKEALIQQ SQEQKEILEK CLEEERQRNK
310 320 330 340 350
EALVSAAKLE KEAVKDAVLK VVEEERKNLE KAHAEERELW KTEHAKDQEK
360 370 380 390 400
VSQEIQKAIQ EQRKISQETV KAAIIEEQKR SEKAVEEAVK RTRDELIEYI
410 420 430 440
KEQKRLDQVI RQRSLSSLEL FLSCAQKQLS ALIATEPVDI E
Note: Binds GGAs.
Length:441
Mass (Da):49,971
Last modified:May 18, 2010 - v2
Checksum:iE63AA5D2FB4BEDF1
GO
Isoform 2 (identifier: Q7Z6B0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MDDDDFGGFEAAETFDGGSGETQTTSPAIPWAAFPA → MPMWNK

Note: Does not bind GGAs.
Show »
Length:411
Mass (Da):47,067
Checksum:iD92D40BF423D3CA0
GO
Isoform 3 (identifier: Q7Z6B0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     219-254: Missing.

Show »
Length:405
Mass (Da):45,920
Checksum:iB8A8A0D4DA0BFC8B
GO

Sequence cautioni

The sequence BAA91995 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti36A → T in AAP42284 (PubMed:12808037).Curated1
Sequence conflicti278I → V in CAH18385 (PubMed:17974005).Curated1
Sequence conflicti284Q → R in CAH18385 (PubMed:17974005).Curated1
Sequence conflicti441E → D in CAG33558 (Ref. 6) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_021531261M → V.Corresponds to variant rs1133028dbSNPEnsembl.1
Natural variantiVAR_021532314V → M.5 PublicationsCorresponds to variant rs10771427dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0132431 – 36MDDDD…AAFPA → MPMWNK in isoform 2. 2 PublicationsAdd BLAST36
Alternative sequenceiVSP_013244219 – 254Missing in isoform 3. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY289196 mRNA. Translation: AAP42284.1.
AK001950 mRNA. Translation: BAA91995.1. Different initiation.
AK093152 mRNA. Translation: BAG52665.1.
AC022079 Genomic DNA. No translation available.
AC024939 Genomic DNA. No translation available.
AC084754 Genomic DNA. No translation available.
BC028682 mRNA. Translation: AAH28682.1.
CR749586 mRNA. Translation: CAH18385.1.
CR457277 mRNA. Translation: CAG33558.1.
AY251168 mRNA. Translation: AAP20065.1.
CCDSiCCDS81675.1. [Q7Z6B0-3]
CCDS8716.1. [Q7Z6B0-1]
RefSeqiNP_001317296.1. NM_001330367.1.
NP_060788.3. NM_018318.4. [Q7Z6B0-1]
XP_005253471.1. XM_005253414.1. [Q7Z6B0-1]
XP_005253472.1. XM_005253415.1. [Q7Z6B0-2]
XP_006719167.1. XM_006719104.2. [Q7Z6B0-1]
XP_006719168.1. XM_006719105.1. [Q7Z6B0-1]
XP_011519031.1. XM_011520729.2. [Q7Z6B0-1]
XP_016875058.1. XM_017019569.1. [Q7Z6B0-1]
XP_016875063.1. XM_017019574.1. [Q7Z6B0-2]
XP_016875064.1. XM_017019575.1. [Q7Z6B0-2]
XP_016875065.1. XM_017019576.1. [Q7Z6B0-3]
UniGeneiHs.653125.

Genome annotation databases

EnsembliENST00000381259; ENSP00000370658; ENSG00000123106. [Q7Z6B0-1]
ENST00000539107; ENSP00000440513; ENSG00000123106. [Q7Z6B0-3]
ENST00000545336; ENSP00000438040; ENSG00000123106. [Q7Z6B0-1]
GeneIDi55297.
KEGGihsa:55297.
UCSCiuc001riq.4. human. [Q7Z6B0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY289196 mRNA. Translation: AAP42284.1.
AK001950 mRNA. Translation: BAA91995.1. Different initiation.
AK093152 mRNA. Translation: BAG52665.1.
AC022079 Genomic DNA. No translation available.
AC024939 Genomic DNA. No translation available.
AC084754 Genomic DNA. No translation available.
BC028682 mRNA. Translation: AAH28682.1.
CR749586 mRNA. Translation: CAH18385.1.
CR457277 mRNA. Translation: CAG33558.1.
AY251168 mRNA. Translation: AAP20065.1.
CCDSiCCDS81675.1. [Q7Z6B0-3]
CCDS8716.1. [Q7Z6B0-1]
RefSeqiNP_001317296.1. NM_001330367.1.
NP_060788.3. NM_018318.4. [Q7Z6B0-1]
XP_005253471.1. XM_005253414.1. [Q7Z6B0-1]
XP_005253472.1. XM_005253415.1. [Q7Z6B0-2]
XP_006719167.1. XM_006719104.2. [Q7Z6B0-1]
XP_006719168.1. XM_006719105.1. [Q7Z6B0-1]
XP_011519031.1. XM_011520729.2. [Q7Z6B0-1]
XP_016875058.1. XM_017019569.1. [Q7Z6B0-1]
XP_016875063.1. XM_017019574.1. [Q7Z6B0-2]
XP_016875064.1. XM_017019575.1. [Q7Z6B0-2]
XP_016875065.1. XM_017019576.1. [Q7Z6B0-3]
UniGeneiHs.653125.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1OM9X-ray2.50P/Q2-16[»]
ProteinModelPortaliQ7Z6B0.
SMRiQ7Z6B0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120584. 12 interactors.
IntActiQ7Z6B0. 5 interactors.
MINTiMINT-1484759.
STRINGi9606.ENSP00000370658.

PTM databases

iPTMnetiQ7Z6B0.
PhosphoSitePlusiQ7Z6B0.

Polymorphism and mutation databases

BioMutaiCCDC91.
DMDMi296434429.

Proteomic databases

EPDiQ7Z6B0.
MaxQBiQ7Z6B0.
PaxDbiQ7Z6B0.
PeptideAtlasiQ7Z6B0.
PRIDEiQ7Z6B0.
TopDownProteomicsiQ7Z6B0-1. [Q7Z6B0-1]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000381259; ENSP00000370658; ENSG00000123106. [Q7Z6B0-1]
ENST00000539107; ENSP00000440513; ENSG00000123106. [Q7Z6B0-3]
ENST00000545336; ENSP00000438040; ENSG00000123106. [Q7Z6B0-1]
GeneIDi55297.
KEGGihsa:55297.
UCSCiuc001riq.4. human. [Q7Z6B0-1]

Organism-specific databases

CTDi55297.
DisGeNETi55297.
GeneCardsiCCDC91.
HGNCiHGNC:24855. CCDC91.
HPAiHPA038169.
neXtProtiNX_Q7Z6B0.
OpenTargetsiENSG00000123106.
PharmGKBiPA144596458.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IJYM. Eukaryota.
ENOG4111XJH. LUCA.
GeneTreeiENSGT00390000015899.
HOVERGENiHBG081051.
InParanoidiQ7Z6B0.
OMAiPENTHAD.
OrthoDBiEOG091G0APS.
PhylomeDBiQ7Z6B0.
TreeFamiTF336441.

Miscellaneous databases

ChiTaRSiCCDC91. human.
EvolutionaryTraceiQ7Z6B0.
GenomeRNAii55297.
PROiQ7Z6B0.

Gene expression databases

BgeeiENSG00000123106.
CleanExiHS_CCDC91.
ExpressionAtlasiQ7Z6B0. baseline and differential.
GenevisibleiQ7Z6B0. HS.

Family and domain databases

ProtoNetiSearch...

Entry informationi

Entry nameiCCD91_HUMAN
AccessioniPrimary (citable) accession number: Q7Z6B0
Secondary accession number(s): B3KSA3
, C9JR07, Q68D43, Q6IA78, Q8NEN7, Q9NUW9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 29, 2005
Last sequence update: May 18, 2010
Last modified: November 30, 2016
This is version 112 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.