Q7Z628 (ARHG8_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
December 14, 2011.
Version 76.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Neuroepithelial cell-transforming gene 1 protein Alternative name(s): Proto-oncogene p65 Net1 Rho guanine nucleotide exchange factor 8 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 596 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acts as guanine nucleotide exchange factor (GEF) for RhoA GTPase. May be involved in activation of the SAPK/JNK pathway Stimulates genotoxic stress-induced RHOB activity in breast cancer cells leading to their cell death. Ref.6 |
| Subunit structure | Interacts with RHOA in its GTP- and GDP-bound states, and with CDC42 in its GTP-bound state. Interacts with the PDZ 1 domain of BAIAP1 By similarity. |
| Subcellular location | |
| Tissue specificity | Widely expressed. Ref.1 |
| Induction | By TGFB1. Up-regulated by DNA damaging agents like H2O2 or ionizing radiation (IR). Ref.3 Ref.6 |
| Sequence similarities | Contains 1 DH (DBL-homology) domain. Contains 1 PH domain. |
| Sequence caution | The sequence AAB08847.1 differs from that shown. Reason: Frameshift at position 586. The sequence AAB37683.1 differs from that shown. Reason: Frameshift at positions 15 and 33. The sequence CAA08974.1 differs from that shown. Reason: Frameshift at positions 8, 55, 59, 70 and 586. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q7Z628-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q7Z628-2) The sequence of this isoform differs from the canonical sequence as follows: 1-54: Missing. 55-85: LTPGPNWDFTLKRKRREKDDDVVSLSSLDLK → MVAHDETGGLLPIKRTIRVLDVNNQSFREQE |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 596 | 596 | Neuroepithelial cell-transforming gene 1 protein | PRO_0000080924 | ||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||
| Domain | 174 – 356 | 183 | DH | |||||||||||||||||||||||||||||||
| Domain | 386 – 501 | 116 | PH | |||||||||||||||||||||||||||||||
| Region | 1 – 74 | 74 | Necessary for nuclear localization By similarity | |||||||||||||||||||||||||||||||
| Motif | 12 – 19 | 8 | Nuclear localization signal By similarity | |||||||||||||||||||||||||||||||
| Motif | 66 – 72 | 7 | Nuclear localization signal By similarity | |||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||
| Modified residue | 21 | 1 | Phosphoserine Ref.5 | |||||||||||||||||||||||||||||||
| Modified residue | 32 | 1 | Phosphoserine Ref.5 | |||||||||||||||||||||||||||||||
| Modified residue | 100 | 1 | Phosphoserine Ref.4 Ref.5 | |||||||||||||||||||||||||||||||
| Modified residue | 106 | 1 | Phosphoserine Ref.4 Ref.5 | |||||||||||||||||||||||||||||||
| Modified residue | 508 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 54 | 54 | Missing in isoform 2. | VSP_011619 | ||||||||||||||||||||||||||||||
| Alternative sequence | 55 – 85 | 31 | LTPGP…SLDLK → MVAHDETGGLLPIKRTIRVL DVNNQSFREQE in isoform 2. | VSP_011620 | ||||||||||||||||||||||||||||||
| Natural variant | 202 | 1 | D → N in a breast cancer sample; somatic mutation. Ref.8 | VAR_035972 | ||||||||||||||||||||||||||||||
| Natural variant | 417 | 1 | T → I. Corresponds to variant rs34658946 [ dbSNP | Ensembl ]. | VAR_051982 | ||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||
| Sequence conflict | 39 | 1 | E → R in AAB37683. Ref.1 | |||||||||||||||||||||||||||||||
| Sequence conflict | 61 | 1 | W → C in AAB37683. Ref.1 | |||||||||||||||||||||||||||||||
| Sequence conflict | 143 – 146 | 4 | TVPT → MDGW in AAB08847. Ref.1 | |||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||
| Helix | 170 – 183 | 14 | ||||||||||||||||||||||||||||||||
| Helix | 187 – 199 | 13 | ||||||||||||||||||||||||||||||||
| Helix | 201 – 206 | 6 | ||||||||||||||||||||||||||||||||
| Helix | 212 – 218 | 7 | ||||||||||||||||||||||||||||||||
| Helix | 222 – 235 | 14 | ||||||||||||||||||||||||||||||||
| Helix | 252 – 256 | 5 | ||||||||||||||||||||||||||||||||
| Helix | 257 – 263 | 7 | ||||||||||||||||||||||||||||||||
| Helix | 267 – 269 | 3 | ||||||||||||||||||||||||||||||||
| Helix | 270 – 280 | 11 | ||||||||||||||||||||||||||||||||
| Helix | 284 – 295 | 12 | ||||||||||||||||||||||||||||||||
| Helix | 304 – 308 | 5 | ||||||||||||||||||||||||||||||||
| Helix | 309 – 327 | 19 | ||||||||||||||||||||||||||||||||
| Helix | 335 – 346 | 12 | ||||||||||||||||||||||||||||||||
| Turn | 351 – 353 | 3 | ||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation of a novel oncogene, NET1, from neuroepithelioma cells by expression cDNA cloning." Chan A.M.-L., Takai S., Yamada K., Miki T. Oncogene 12:1259-1266(1996) [PubMed: 8649828] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY. Tissue: Neuroepithelium. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Eye and Placenta. |
| [3] | "The activity of guanine exchange factor NET1 is essential for transforming growth factor-beta-mediated stress fiber formation." Shen X., Li J., Hu P.P.-C., Waddell D., Zhang J., Wang X.-F. J. Biol. Chem. 276:15362-15368(2001) [PubMed: 11278519] [Abstract] Cited for: INDUCTION BY TGFB1. |
| [4] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-100 AND SER-106, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [5] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-21; SER-32; SER-100 AND SER-106, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [6] | "The nuclear guanine nucleotide exchange factors Ect2 and Net1 regulate RhoB-mediated cell death after DNA damage." Srougi M.C., Burridge K. PLoS ONE 6:E17108-E17108(2011) [PubMed: 21373644] [Abstract] Cited for: FUNCTION, INDUCTION. |
| [7] | "Crystal structure of the RhoGEF domain of human neuroepithelial cell-transforming gene 1 protein." Structural genomics consortium (SGC) Submitted (FEB-2009) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 161-373. |
| [8] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed: 16959974] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] ASN-202. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | S82401 mRNA. Translation: AAB37683.1. Frameshift. U02081 mRNA. Translation: AAB08847.1. Frameshift. AJ010046 mRNA. Translation: CAA08974.1. Frameshift. BC010285 mRNA. Translation: AAH10285.1. BC053553 mRNA. Translation: AAH53553.1. | ||||||||||||
| IPI | IPI00180559. IPI00385312. | ||||||||||||
| PIR | G01210. | ||||||||||||
| RefSeq | NP_001040625.1. NM_001047160.1. NP_005854.2. NM_005863.3. | ||||||||||||
| UniGene | Hs.25155. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q7Z628. | ||||||||||||
| SMR | Q7Z628. Positions 166-499. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q7Z628. 2 interactions. | ||||||||||||
| STRING | Q7Z628. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q7Z628. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 52782735. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q7Z628. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000355029; ENSP00000347134; ENSG00000173848. | ||||||||||||
| GeneID | 10276. | ||||||||||||
| KEGG | hsa:10276. | ||||||||||||
| UCSC | uc001iia.1. human. uc001iib.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 10276. | ||||||||||||
| GeneCards | GC10P005444. | ||||||||||||
| H-InvDB | HIX0008610. | ||||||||||||
| HGNC | HGNC:14592. NET1. | ||||||||||||
| MIM | 606450. gene. | ||||||||||||
| neXtProt | NX_Q7Z628. | ||||||||||||
| PharmGKB | PA164742175. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | prNOG17302. | ||||||||||||
| GeneTree | ENSGT00600000084190. | ||||||||||||
| HOVERGEN | HBG050567. | ||||||||||||
| InParanoid | Q7Z628. | ||||||||||||
| OMA | EECEENN. | ||||||||||||
| OrthoDB | EOG4BVRTK. | ||||||||||||
| PhylomeDB | Q7Z628. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_111102. Signal Transduction. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q7Z628. | ||||||||||||
| Bgee | Q7Z628. | ||||||||||||
| CleanEx | HS_NET1. | ||||||||||||
| Genevestigator | Q7Z628. | ||||||||||||
| GermOnline | ENSG00000173848. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR000219. DH-domain. IPR001331. GDS_CDC24_CS. IPR011993. PH_type. IPR001849. Pleckstrin_homology. IPR015721. RhoGEF-like. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:2.30.29.30. PH_type. 1 hit. G3DSA:1.20.900.10. RhoGEF. 1 hit. | ||||||||||||
| PANTHER | PTHR22825. RhoGEF_like. 1 hit. | ||||||||||||
| Pfam | PF00169. PH. 1 hit. PF00621. RhoGEF. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00233. PH. 1 hit. SM00325. RhoGEF. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF48065. DH-domain. 1 hit. | ||||||||||||
| PROSITE | PS00741. DH_1. 1 hit. PS50010. DH_2. 1 hit. PS50003. PH_DOMAIN. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 38926. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | ARHG8_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q7Z628 Secondary accession number(s): Q12773 Q9UEN6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with