Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sorting nexin-20

Gene

SNX20

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May play a role in cellular vesicle trafficking. Has been proposed to function as a sorting protein that targets SELPLG into endosomes, but has no effect on SELPLG internalization from the cell surface, or on SELPLG-mediated cell-cell adhesion.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei116 – 1161Phosphatidylinositol 3-phosphateBy similarity
Binding sitei118 – 1181Phosphatidylinositol 3-phosphate; via amide nitrogen and carbonyl oxygenBy similarity
Binding sitei143 – 1431Phosphatidylinositol 3-phosphateBy similarity
Binding sitei157 – 1571Phosphatidylinositol 3-phosphateBy similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Protein transport, Transport

Keywords - Ligandi

Lipid-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Sorting nexin-20
Alternative name(s):
Selectin ligand-interactor cytoplasmic 11 Publication
Short name:
SLIC-11 Publication
Gene namesi
Name:SNX20
Synonyms:SLIC1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:30390. SNX20.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Endosome, Membrane, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi116 – 1161R → Q: Decreased binding activity to all phospholipids. 1 Publication

Organism-specific databases

PharmGKBiPA162404311.

Polymorphism and mutation databases

BioMutaiSNX20.
DMDMi74713704.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 316316Sorting nexin-20PRO_0000325820Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei3 – 31PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ7Z614.
PeptideAtlasiQ7Z614.
PRIDEiQ7Z614.

PTM databases

iPTMnetiQ7Z614.
PhosphoSiteiQ7Z614.

Expressioni

Gene expression databases

BgeeiENSG00000167208.
CleanExiHS_SNX20.
ExpressionAtlasiQ7Z614. baseline and differential.
GenevisibleiQ7Z614. HS.

Organism-specific databases

HPAiHPA043649.

Interactioni

Subunit structurei

Interacts with SELPLG (PubMed:18196517). Interaction with SELPLG is controversial.Curated1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
ALAS1P131963EBI-744896,EBI-3905054
FAM9BQ8IZU03EBI-744896,EBI-10175124
FLJ13057Q53SE73EBI-744896,EBI-10172181
KLHL12Q53G594EBI-744896,EBI-740929
MAGEA11P43364-23EBI-744896,EBI-10178634
SELPLGQ142425EBI-744896,EBI-1030190
TACC3Q9Y6A53EBI-744896,EBI-2554984
TFIP11Q9UBB93EBI-744896,EBI-1105213

Protein-protein interaction databases

BioGridi125867. 16 interactions.
IntActiQ7Z614. 8 interactions.
MINTiMINT-1450343.
STRINGi9606.ENSP00000332062.

Structurei

3D structure databases

ProteinModelPortaliQ7Z614.
SMRiQ7Z614. Positions 187-315.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini74 – 191118PXPROSITE-ProRule annotationAdd
BLAST

Domaini

The PX domain binds phosphatidylinositol 3-phosphate which is necessary for localization to the endosomes.1 Publication

Sequence similaritiesi

Belongs to the sorting nexin family.Curated
Contains 1 PX (phox homology) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiENOG410IMHU. Eukaryota.
ENOG41114JN. LUCA.
GeneTreeiENSGT00530000063759.
HOGENOMiHOG000154363.
HOVERGENiHBG108497.
InParanoidiQ7Z614.
KOiK17931.
OMAiLTAHCPA.
OrthoDBiEOG091G0S8F.
PhylomeDBiQ7Z614.
TreeFamiTF326807.

Family and domain databases

Gene3Di3.30.1520.10. 1 hit.
InterProiIPR001683. Phox.
[Graphical view]
PfamiPF00787. PX. 1 hit.
[Graphical view]
SMARTiSM00312. PX. 1 hit.
[Graphical view]
SUPFAMiSSF64268. SSF64268. 1 hit.
PROSITEiPS50195. PX. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7Z614-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASPEHPGSP GCMGPITQCT ARTQQEAPAT GPDLPHPGPD GHLDTHSGLS
60 70 80 90 100
SNSSMTTREL QQYWQNQKCR WKHVKLLFEI ASARIEERKV SKFVVYQIIV
110 120 130 140 150
IQTGSFDNNK AVLERRYSDF AKLQKALLKT FREEIEDVEF PRKHLTGNFA
160 170 180 190 200
EEMICERRRA LQEYLGLLYA IRCVRRSREF LDFLTRPELR EAFGCLRAGQ
210 220 230 240 250
YPRALELLLR VLPLQEKLTA HCPAAAVPAL CAVLLCHRDL DRPAEAFAAG
260 270 280 290 300
ERALQRLQAR EGHRYYAPLL DAMVRLAYAL GKDFVTLQER LEESQLRRPT
310
PRGITLKELT VREYLH
Length:316
Mass (Da):36,178
Last modified:October 1, 2003 - v1
Checksum:i48D06CF4490907F4
GO
Isoform 2 (identifier: Q7Z614-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     121-284: Missing.

Show »
Length:152
Mass (Da):17,314
Checksum:iE9E2EE4EDE3AAC46
GO
Isoform 3 (identifier: Q7Z614-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     95-129: VYQIIVIQTGSFDNNKAVLERRYSDFAKLQKALLK → MGKSRPGEMTYPGSRGETGTAPEPDPRCPRQSDML
     130-316: Missing.

Show »
Length:129
Mass (Da):14,186
Checksum:i7037F3ABC0033C43
GO
Isoform 4 (identifier: Q7Z614-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     95-102: VYQIIVIQ → APAPDATP
     103-316: Missing.

Show »
Length:102
Mass (Da):11,131
Checksum:i47D9A565C2C63833
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti35 – 351P → L.1 Publication
Corresponds to variant rs1131716 [ dbSNP | Ensembl ].
VAR_039927

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei95 – 12935VYQII…KALLK → MGKSRPGEMTYPGSRGETGT APEPDPRCPRQSDML in isoform 3. 1 PublicationVSP_032425Add
BLAST
Alternative sequencei95 – 1028VYQIIVIQ → APAPDATP in isoform 4. 2 PublicationsVSP_032426
Alternative sequencei103 – 316214Missing in isoform 4. 2 PublicationsVSP_032427Add
BLAST
Alternative sequencei121 – 284164Missing in isoform 2. 1 PublicationVSP_032428Add
BLAST
Alternative sequencei130 – 316187Missing in isoform 3. 1 PublicationVSP_032429Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY302441 mRNA. Translation: AAP58362.1.
AK292650 mRNA. Translation: BAF85339.1.
AK292705 mRNA. Translation: BAF85394.1.
CH471092 Genomic DNA. Translation: EAW82763.1.
BC063423 mRNA. Translation: AAH63423.1.
BC119626 mRNA. Translation: AAI19627.1.
CCDSiCCDS10744.1. [Q7Z614-3]
CCDS10745.1. [Q7Z614-1]
CCDS45481.1. [Q7Z614-4]
RefSeqiNP_001138444.1. NM_001144972.1. [Q7Z614-4]
NP_699168.1. NM_153337.2. [Q7Z614-3]
NP_878274.1. NM_182854.3. [Q7Z614-1]
UniGeneiHs.460777.
Hs.660456.
Hs.715778.

Genome annotation databases

EnsembliENST00000300590; ENSP00000300590; ENSG00000167208. [Q7Z614-3]
ENST00000330943; ENSP00000332062; ENSG00000167208. [Q7Z614-1]
ENST00000423026; ENSP00000388875; ENSG00000167208. [Q7Z614-4]
ENST00000568993; ENSP00000454863; ENSG00000167208. [Q7Z614-3]
GeneIDi124460.
KEGGihsa:124460.
UCSCiuc002egi.4. human. [Q7Z614-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY302441 mRNA. Translation: AAP58362.1.
AK292650 mRNA. Translation: BAF85339.1.
AK292705 mRNA. Translation: BAF85394.1.
CH471092 Genomic DNA. Translation: EAW82763.1.
BC063423 mRNA. Translation: AAH63423.1.
BC119626 mRNA. Translation: AAI19627.1.
CCDSiCCDS10744.1. [Q7Z614-3]
CCDS10745.1. [Q7Z614-1]
CCDS45481.1. [Q7Z614-4]
RefSeqiNP_001138444.1. NM_001144972.1. [Q7Z614-4]
NP_699168.1. NM_153337.2. [Q7Z614-3]
NP_878274.1. NM_182854.3. [Q7Z614-1]
UniGeneiHs.460777.
Hs.660456.
Hs.715778.

3D structure databases

ProteinModelPortaliQ7Z614.
SMRiQ7Z614. Positions 187-315.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125867. 16 interactions.
IntActiQ7Z614. 8 interactions.
MINTiMINT-1450343.
STRINGi9606.ENSP00000332062.

PTM databases

iPTMnetiQ7Z614.
PhosphoSiteiQ7Z614.

Polymorphism and mutation databases

BioMutaiSNX20.
DMDMi74713704.

Proteomic databases

PaxDbiQ7Z614.
PeptideAtlasiQ7Z614.
PRIDEiQ7Z614.

Protocols and materials databases

DNASUi124460.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000300590; ENSP00000300590; ENSG00000167208. [Q7Z614-3]
ENST00000330943; ENSP00000332062; ENSG00000167208. [Q7Z614-1]
ENST00000423026; ENSP00000388875; ENSG00000167208. [Q7Z614-4]
ENST00000568993; ENSP00000454863; ENSG00000167208. [Q7Z614-3]
GeneIDi124460.
KEGGihsa:124460.
UCSCiuc002egi.4. human. [Q7Z614-1]

Organism-specific databases

CTDi124460.
GeneCardsiSNX20.
H-InvDBHIX0173308.
HGNCiHGNC:30390. SNX20.
HPAiHPA043649.
MIMi613281. gene.
neXtProtiNX_Q7Z614.
PharmGKBiPA162404311.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IMHU. Eukaryota.
ENOG41114JN. LUCA.
GeneTreeiENSGT00530000063759.
HOGENOMiHOG000154363.
HOVERGENiHBG108497.
InParanoidiQ7Z614.
KOiK17931.
OMAiLTAHCPA.
OrthoDBiEOG091G0S8F.
PhylomeDBiQ7Z614.
TreeFamiTF326807.

Miscellaneous databases

GenomeRNAii124460.
PROiQ7Z614.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000167208.
CleanExiHS_SNX20.
ExpressionAtlasiQ7Z614. baseline and differential.
GenevisibleiQ7Z614. HS.

Family and domain databases

Gene3Di3.30.1520.10. 1 hit.
InterProiIPR001683. Phox.
[Graphical view]
PfamiPF00787. PX. 1 hit.
[Graphical view]
SMARTiSM00312. PX. 1 hit.
[Graphical view]
SUPFAMiSSF64268. SSF64268. 1 hit.
PROSITEiPS50195. PX. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSNX20_HUMAN
AccessioniPrimary (citable) accession number: Q7Z614
Secondary accession number(s): A8K9D5
, Q08E98, Q6P4H2, Q8IV59
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: October 1, 2003
Last modified: September 7, 2016
This is version 106 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.