Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DNA polymerase nu

Gene

POLN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Catalytic activityi

Deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1).

GO - Molecular functioni

  • cyclin binding Source: UniProtKB
  • DNA binding Source: UniProtKB-KW
  • DNA-directed DNA polymerase activity Source: UniProtKB

GO - Biological processi

  • DNA-dependent DNA replication Source: InterPro
  • double-strand break repair via homologous recombination Source: UniProtKB
  • interstrand cross-link repair Source: UniProtKB
  • translesion synthesis Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

DNA-directed DNA polymerase, Nucleotidyltransferase, Transferase

Keywords - Biological processi

DNA damage, DNA repair, DNA replication

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
DNA polymerase nu (EC:2.7.7.7)
Gene namesi
Name:POLN
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:18870. POLN.

Subcellular locationi

  • Nucleus 1 Publication

GO - Cellular componenti

  • intracellular membrane-bounded organelle Source: HPA
  • nucleoplasm Source: HPA
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi623 – 6231D → A: No detectable activity. 1 Publication

Organism-specific databases

PharmGKBiPA134979866.

Polymorphism and mutation databases

BioMutaiPOLN.
DMDMi90101282.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 900900DNA polymerase nuPRO_0000227938Add
BLAST

Proteomic databases

PaxDbiQ7Z5Q5.
PRIDEiQ7Z5Q5.

PTM databases

PhosphoSiteiQ7Z5Q5.

Expressioni

Tissue specificityi

Highly expressed in testis and heart. Weakly expressed in skeletal muscle.1 Publication

Gene expression databases

BgeeiQ7Z5Q5.
CleanExiHS_POLN.
ExpressionAtlasiQ7Z5Q5. baseline and differential.
GenevisibleiQ7Z5Q5. HS.

Interactioni

Protein-protein interaction databases

BioGridi131695. 10 interactions.
STRINGi9606.ENSP00000372316.

Structurei

Secondary structure

1
900
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi196 – 1994Combined sources
Helixi200 – 2023Combined sources
Helixi205 – 21713Combined sources
Beta strandi219 – 2279Combined sources
Turni233 – 2353Combined sources
Beta strandi244 – 25310Combined sources
Beta strandi273 – 2753Combined sources
Beta strandi280 – 2845Combined sources
Helixi293 – 31119Combined sources
Beta strandi316 – 3205Combined sources
Helixi321 – 33212Combined sources
Helixi333 – 3353Combined sources
Helixi338 – 3403Combined sources
Helixi349 – 3568Combined sources
Beta strandi358 – 3603Combined sources
Helixi365 – 3728Combined sources
Helixi390 – 41728Combined sources
Helixi421 – 4266Combined sources
Turni427 – 4304Combined sources
Helixi431 – 44010Combined sources
Beta strandi443 – 4453Combined sources
Helixi447 – 47226Combined sources
Helixi481 – 4888Combined sources
Turni489 – 4913Combined sources
Helixi494 – 4974Combined sources
Beta strandi500 – 5067Combined sources
Beta strandi508 – 5114Combined sources
Helixi516 – 5216Combined sources
Turni522 – 5254Combined sources
Helixi528 – 54518Combined sources
Helixi547 – 5504Combined sources
Beta strandi561 – 5666Combined sources
Beta strandi568 – 5703Combined sources
Beta strandi573 – 5775Combined sources
Turni579 – 5813Combined sources
Beta strandi587 – 5904Combined sources
Beta strandi602 – 6054Combined sources
Helixi607 – 6104Combined sources
Beta strandi618 – 6247Combined sources
Helixi627 – 63610Combined sources
Helixi639 – 6435Combined sources
Helixi654 – 6629Combined sources
Helixi666 – 6683Combined sources
Helixi671 – 68515Combined sources
Helixi690 – 6967Combined sources
Helixi701 – 71414Combined sources
Helixi717 – 73216Combined sources
Beta strandi733 – 7364Combined sources
Beta strandi738 – 7403Combined sources
Beta strandi742 – 7443Combined sources
Helixi746 – 7494Combined sources
Helixi753 – 78836Combined sources
Beta strandi796 – 8016Combined sources
Beta strandi804 – 8096Combined sources
Helixi811 – 8133Combined sources
Helixi814 – 82613Combined sources
Helixi827 – 8293Combined sources
Beta strandi832 – 8343Combined sources
Beta strandi844 – 85310Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4XVIX-ray3.10A194-859[»]
4XVKX-ray2.95A194-859[»]
4XVLX-ray3.30A194-859[»]
4XVMX-ray3.20A194-859[»]
ProteinModelPortaliQ7Z5Q5.
SMRiQ7Z5Q5. Positions 346-852.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the DNA polymerase type-A family.Curated

Phylogenomic databases

eggNOGiCOG0749.
GeneTreeiENSGT00790000123130.
HOGENOMiHOG000230904.
HOVERGENiHBG079981.
InParanoidiQ7Z5Q5.
KOiK16618.
OMAiCKCPVIC.
OrthoDBiEOG7QG43B.
PhylomeDBiQ7Z5Q5.
TreeFamiTF337202.

Family and domain databases

Gene3Di3.30.420.10. 1 hit.
InterProiIPR001098. DNA-dir_DNA_pol_A_palm_dom.
IPR002298. DNA_polymerase_A.
IPR012337. RNaseH-like_dom.
[Graphical view]
PfamiPF00476. DNA_pol_A. 1 hit.
[Graphical view]
PRINTSiPR00868. DNAPOLI.
SMARTiSM00482. POLAc. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7Z5Q5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MENYEALVGF DLCNTPLSSV AQKIMSAMHS GDLVDSKTWG KSTETMEVIN
60 70 80 90 100
KSSVKYSVQL EDRKTQSPEK KDLKSLRSQT SRGSAKLSPQ SFSVRLTDQL
110 120 130 140 150
SADQKQKSIS SLTLSSCLIP QYNQEASVLQ KKGHKRKHFL MENINNENKG
160 170 180 190 200
SINLKRKHIT YNNLSEKTSK QMALEEDTDD AEGYLNSGNS GALKKHFCDI
210 220 230 240 250
RHLDDWAKSQ LIEMLKQAAA LVITVMYTDG STQLGADQTP VSSVRGIVVL
260 270 280 290 300
VKRQAEGGHG CPDAPACGPV LEGFVSDDPC IYIQIEHSAI WDQEQEAHQQ
310 320 330 340 350
FARNVLFQTM KCKCPVICFN AKDFVRIVLQ FFGNDGSWKH VADFIGLDPR
360 370 380 390 400
IAAWLIDPSD ATPSFEDLVE KYCEKSITVK VNSTYGNSSR NIVNQNVREN
410 420 430 440 450
LKTLYRLTMD LCSKLKDYGL WQLFRTLELP LIPILAVMES HAIQVNKEEM
460 470 480 490 500
EKTSALLGAR LKELEQEAHF VAGERFLITS NNQLREILFG KLKLHLLSQR
510 520 530 540 550
NSLPRTGLQK YPSTSEAVLN ALRDLHPLPK IILEYRQVHK IKSTFVDGLL
560 570 580 590 600
ACMKKGSISS TWNQTGTVTG RLSAKHPNIQ GISKHPIQIT TPKNFKGKED
610 620 630 640 650
KILTISPRAM FVSSKGHTFL AADFSQIELR ILTHLSGDPE LLKLFQESER
660 670 680 690 700
DDVFSTLTSQ WKDVPVEQVT HADREQTKKV VYAVVYGAGK ERLAACLGVP
710 720 730 740 750
IQEAAQFLES FLQKYKKIKD FARAAIAQCH QTGCVVSIMG RRRPLPRIHA
760 770 780 790 800
HDQQLRAQAE RQAVNFVVQG SAADLCKLAM IHVFTAVAAS HTLTARLVAQ
810 820 830 840 850
IHDELLFEVE DPQIPECAAL VRRTMESLEQ VQALELQLQV PLKVSLSAGR
860 870 880 890 900
SWGHLVPLQE AWGPPPGPCR TESPSNSLAA PGSPASTQPP PLHFSPSFCL
Length:900
Mass (Da):100,307
Last modified:March 21, 2006 - v2
Checksum:iD44758D71BCD3F02
GO
Isoform 2 (identifier: Q7Z5Q5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     578-610: NIQGISKHPIQITTPKNFKGKEDKILTISPRAM → ICARQVASDFQKCVEVSDAMMNSSIFWWLLKLY
     611-899: Missing.

Note: No experimental confirmation available.
Show »
Length:611
Mass (Da):68,690
Checksum:iEB21C241912D8601
GO

Sequence cautioni

The sequence BAD18421.1 differs from that shown.Probable cloning artifact.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti8 – 81V → A in BAG64670 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti121 – 1211Q → H.2 Publications
Corresponds to variant rs2353552 [ dbSNP | Ensembl ].
VAR_025647
Natural varianti201 – 2011R → G.1 Publication
Corresponds to variant rs35884361 [ dbSNP | Ensembl ].
VAR_025648
Natural varianti310 – 3101M → L.1 Publication
Corresponds to variant rs10018786 [ dbSNP | Ensembl ].
VAR_025649
Natural varianti315 – 3151P → S.1 Publication
Corresponds to variant rs11725880 [ dbSNP | Ensembl ].
VAR_025650
Natural varianti336 – 3361G → S.1 Publication
Corresponds to variant rs10011549 [ dbSNP | Ensembl ].
VAR_025651
Natural varianti425 – 4251R → C.2 Publications
Corresponds to variant rs9328764 [ dbSNP | Ensembl ].
VAR_025652
Natural varianti502 – 5021S → G.1 Publication
Corresponds to variant rs34574483 [ dbSNP | Ensembl ].
VAR_025653
Natural varianti711 – 7111F → L.1 Publication
Corresponds to variant rs34554757 [ dbSNP | Ensembl ].
VAR_025654

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei578 – 61033NIQGI…SPRAM → ICARQVASDFQKCVEVSDAM MNSSIFWWLLKLY in isoform 2. 1 PublicationVSP_054402Add
BLAST
Alternative sequencei611 – 899289Missing in isoform 2. 1 PublicationVSP_054403Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY136549 mRNA. Translation: AAN52116.1.
AK131239 mRNA. Translation: BAD18421.1. Sequence problems.
AK303673 mRNA. Translation: BAG64670.1.
DQ060036 Genomic DNA. Translation: AAY43130.1.
AL136360, AL158068 Genomic DNA. Translation: CAM16854.1.
AL158068, AL136360 Genomic DNA. Translation: CAM20461.1.
CH471131 Genomic DNA. Translation: EAW82539.1.
CCDSiCCDS3360.1. [Q7Z5Q5-1]
RefSeqiNP_861524.2. NM_181808.3. [Q7Z5Q5-1]
UniGeneiHs.368454.

Genome annotation databases

EnsembliENST00000382865; ENSP00000372316; ENSG00000130997. [Q7Z5Q5-1]
ENST00000511885; ENSP00000435506; ENSG00000130997. [Q7Z5Q5-1]
GeneIDi353497.
KEGGihsa:353497.
UCSCiuc003ger.2. human. [Q7Z5Q5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY136549 mRNA. Translation: AAN52116.1.
AK131239 mRNA. Translation: BAD18421.1. Sequence problems.
AK303673 mRNA. Translation: BAG64670.1.
DQ060036 Genomic DNA. Translation: AAY43130.1.
AL136360, AL158068 Genomic DNA. Translation: CAM16854.1.
AL158068, AL136360 Genomic DNA. Translation: CAM20461.1.
CH471131 Genomic DNA. Translation: EAW82539.1.
CCDSiCCDS3360.1. [Q7Z5Q5-1]
RefSeqiNP_861524.2. NM_181808.3. [Q7Z5Q5-1]
UniGeneiHs.368454.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4XVIX-ray3.10A194-859[»]
4XVKX-ray2.95A194-859[»]
4XVLX-ray3.30A194-859[»]
4XVMX-ray3.20A194-859[»]
ProteinModelPortaliQ7Z5Q5.
SMRiQ7Z5Q5. Positions 346-852.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi131695. 10 interactions.
STRINGi9606.ENSP00000372316.

Chemistry

BindingDBiQ7Z5Q5.
ChEMBLiCHEMBL2010628.

PTM databases

PhosphoSiteiQ7Z5Q5.

Polymorphism and mutation databases

BioMutaiPOLN.
DMDMi90101282.

Proteomic databases

PaxDbiQ7Z5Q5.
PRIDEiQ7Z5Q5.

Protocols and materials databases

DNASUi353497.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000382865; ENSP00000372316; ENSG00000130997. [Q7Z5Q5-1]
ENST00000511885; ENSP00000435506; ENSG00000130997. [Q7Z5Q5-1]
GeneIDi353497.
KEGGihsa:353497.
UCSCiuc003ger.2. human. [Q7Z5Q5-1]

Organism-specific databases

CTDi353497.
GeneCardsiGC04M002073.
H-InvDBHIX0004033.
HGNCiHGNC:18870. POLN.
MIMi610887. gene.
neXtProtiNX_Q7Z5Q5.
PharmGKBiPA134979866.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG0749.
GeneTreeiENSGT00790000123130.
HOGENOMiHOG000230904.
HOVERGENiHBG079981.
InParanoidiQ7Z5Q5.
KOiK16618.
OMAiCKCPVIC.
OrthoDBiEOG7QG43B.
PhylomeDBiQ7Z5Q5.
TreeFamiTF337202.

Miscellaneous databases

ChiTaRSiPOLN. human.
GeneWikiiDNA_polymerase_nu.
GenomeRNAii353497.
NextBioi35476941.
PROiQ7Z5Q5.
SOURCEiSearch...

Gene expression databases

BgeeiQ7Z5Q5.
CleanExiHS_POLN.
ExpressionAtlasiQ7Z5Q5. baseline and differential.
GenevisibleiQ7Z5Q5. HS.

Family and domain databases

Gene3Di3.30.420.10. 1 hit.
InterProiIPR001098. DNA-dir_DNA_pol_A_palm_dom.
IPR002298. DNA_polymerase_A.
IPR012337. RNaseH-like_dom.
[Graphical view]
PfamiPF00476. DNA_pol_A. 1 hit.
[Graphical view]
PRINTSiPR00868. DNAPOLI.
SMARTiSM00482. POLAc. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "POLN, a nuclear PolA family DNA polymerase homologous to the DNA cross-link sensitivity protein Mus308."
    Marini F., Kim N., Schuffert A., Wood R.D.
    J. Biol. Chem. 278:32014-32019(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT HIS-121, ALTERNATIVE SPLICING, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, MUTAGENESIS OF ASP-623.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT CYS-425.
    Tissue: Brain and Kidney.
  3. NIEHS SNPs program
    Submitted (MAY-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS HIS-121; GLY-201; LEU-310; SER-315; SER-336; CYS-425; GLY-502 AND LEU-711.
  4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

Entry informationi

Entry nameiDPOLN_HUMAN
AccessioniPrimary (citable) accession number: Q7Z5Q5
Secondary accession number(s): A2A336
, B4E158, Q4TTW4, Q6ZNF4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 21, 2006
Last sequence update: March 21, 2006
Last modified: June 24, 2015
This is version 103 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.