Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Podocan

Gene

PODN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Negatively regulates cell proliferation and cell migration.1 Publication

GO - Molecular functioni

  • collagen binding Source: UniProtKB
  • protein kinase inhibitor activity Source: GO_Central

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Podocan
Gene namesi
Name:PODN
Synonyms:SLRR5A
ORF Names:UNQ293/PRO332
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:23174. PODN.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • extracellular space Source: UniProtKB
  • proteinaceous extracellular matrix Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Extracellular matrix, Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134980106.

Polymorphism and mutation databases

BioMutaiPODN.
DMDMi118573110.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1919Sequence analysisAdd
BLAST
Chaini20 – 613594PodocanPRO_0000262524Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi214 – 2141N-linked (GlcNAc...)Sequence analysis
Glycosylationi281 – 2811N-linked (GlcNAc...)1 Publication
Glycosylationi299 – 2991N-linked (GlcNAc...)1 Publication
Glycosylationi410 – 4101N-linked (GlcNAc...)Sequence analysis

Post-translational modificationi

N-glycosylated.2 Publications

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ7Z5L7.
PRIDEiQ7Z5L7.

PTM databases

iPTMnetiQ7Z5L7.
PhosphoSiteiQ7Z5L7.

Expressioni

Tissue specificityi

Kidney, heart, liver, pancreas and vascular smooth muscle cells. Also detected in aortic intima (at protein level).3 Publications

Gene expression databases

BgeeiQ7Z5L7.
CleanExiHS_PODN.
GenevisibleiQ7Z5L7. HS.

Organism-specific databases

HPAiHPA013892.

Interactioni

Subunit structurei

Binds to type I collagen.

GO - Molecular functioni

  • collagen binding Source: UniProtKB

Protein-protein interaction databases

BioGridi126059. 6 interactions.
IntActiQ7Z5L7. 1 interaction.
STRINGi9606.ENSP00000308315.

Structurei

3D structure databases

ProteinModelPortaliQ7Z5L7.
SMRiQ7Z5L7. Positions 64-582.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini59 – 9638LRRNTAdd
BLAST
Repeati97 – 11822LRR 1Add
BLAST
Repeati121 – 14121LRR 2Add
BLAST
Repeati147 – 16822LRR 3Add
BLAST
Repeati169 – 18921LRR 4Add
BLAST
Repeati192 – 21221LRR 5Add
BLAST
Repeati218 – 23821LRR 6Add
BLAST
Repeati239 – 26022LRR 7Add
BLAST
Repeati263 – 28321LRR 8Add
BLAST
Repeati289 – 31022LRR 9Add
BLAST
Repeati311 – 33121LRR 10Add
BLAST
Repeati334 – 35724LRR 11Add
BLAST
Repeati360 – 38021LRR 12Add
BLAST
Repeati381 – 40222LRR 13Add
BLAST
Repeati405 – 42622LRR 14Add
BLAST
Repeati431 – 45222LRR 15Add
BLAST
Repeati476 – 48914LRR 16Add
BLAST
Repeati502 – 52221LRR 17Add
BLAST
Repeati523 – 54422LRR 18Add
BLAST
Repeati547 – 56822LRR 19Add
BLAST
Repeati573 – 59523LRR 20Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi598 – 61114Glu-richAdd
BLAST

Sequence similaritiesi

Contains 20 LRR (leucine-rich) repeats.Curated
Contains 1 LRRNT domain.Curated

Keywords - Domaini

Leucine-rich repeat, Repeat, Signal

Phylogenomic databases

eggNOGiKOG0619. Eukaryota.
COG4886. LUCA.
GeneTreeiENSGT00760000118969.
HOVERGENiHBG059195.
InParanoidiQ7Z5L7.
OMAiGPEENEF.
OrthoDBiEOG7F24SN.
PhylomeDBiQ7Z5L7.
TreeFamiTF336377.

Family and domain databases

Gene3Di3.80.10.10. 3 hits.
InterProiIPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR003591. Leu-rich_rpt_typical-subtyp.
IPR026906. LRR_5.
IPR000372. LRRNT.
[Graphical view]
PfamiPF13306. LRR_5. 1 hit.
PF13855. LRR_8. 4 hits.
[Graphical view]
SMARTiSM00369. LRR_TYP. 13 hits.
SM00013. LRRNT. 1 hit.
[Graphical view]
SUPFAMiSSF52058. SSF52058. 2 hits.
PROSITEiPS51450. LRR. 17 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7Z5L7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAQSRVLLLL LLLPPQLHLG PVLAVRAPGF GRSGGHSLSP EENEFAEEEP
60 70 80 90 100
VLVLSPEEPG PGPAAVSCPR DCACSQEGVV DCGGIDLREF PGDLPEHTNH
110 120 130 140 150
LSLQNNQLEK IYPEELSRLH RLETLNLQNN RLTSRGLPEK AFEHLTNLNY
160 170 180 190 200
LYLANNKLTL APRFLPNALI SVDFAANYLT KIYGLTFGQK PNLRSVYLHN
210 220 230 240 250
NKLADAGLPD NMFNGSSNVE VLILSSNFLR HVPKHLPPAL YKLHLKNNKL
260 270 280 290 300
EKIPPGAFSE LSSLRELYLQ NNYLTDEGLD NETFWKLSSL EYLDLSSNNL
310 320 330 340 350
SRVPAGLPRS LVLLHLEKNA IRSVDANVLT PIRSLEYLLL HSNQLREQGI
360 370 380 390 400
HPLAFQGLKR LHTVHLYNNA LERVPSGLPR RVRTLMILHN QITGIGREDF
410 420 430 440 450
ATTYFLEELN LSYNRITSPQ VHRDAFRKLR LLRSLDLSGN RLHTLPPGLP
460 470 480 490 500
RNVHVLKVKR NELAALARGA LVGMAQLREL YLTSNRLRSR ALGPRAWVDL
510 520 530 540 550
AHLQLLDIAG NQLTEIPEGL PESLEYLYLQ NNKISAVPAN AFDSTPNLKG
560 570 580 590 600
IFLRFNKLAV GSVVDSAFRR LKHLQVLDIE GNLEFGDISK DRGRLGKEKE
610
EEEEEEEEEE ETR
Length:613
Mass (Da):68,976
Last modified:November 28, 2006 - v2
Checksum:iDA574FC77CCDAC91
GO
Isoform 2 (identifier: Q7Z5L7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEGEEAEQPAWFRQPWRPGASDSAPPAGTM

Note: No signal peptide.
Show »
Length:642
Mass (Da):72,114
Checksum:i9B44460D1DB20945
GO
Isoform 3 (identifier: Q7Z5L7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEGARARGAQLRLGERVRPVGRRSAPGRSRFRQPWRPGASDSAPPAGTM

Note: No signal peptide.Curated
Show »
Length:661
Mass (Da):74,142
Checksum:iA051B4E993BE82E7
GO
Isoform 4 (identifier: Q7Z5L7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEGARARGAQLRLGERVRPVGRRSAPGRSRFRQPWRPGASDSAPPAGTM
     105-246: Missing.

Note: No signal peptide. No experimental confirmation available.
Show »
Length:519
Mass (Da):57,896
Checksum:iF942D35CD5BD35F1
GO

Sequence cautioni

The sequence AAH28292.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAH72591.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Isoform 3 (identifier: Q7Z5L7-3)
Sequence conflicti32 – 321R → H in AAH30608 (PubMed:15489334).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti444 – 4441T → M.1 Publication
Corresponds to variant rs12567021 [ dbSNP | Ensembl ].
VAR_029497
Natural varianti472 – 4721V → A.4 Publications
Corresponds to variant rs1288389 [ dbSNP | Ensembl ].
VAR_029498

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MEGEEAEQPAWFRQPWRPGA SDSAPPAGTM in isoform 2. 2 PublicationsVSP_037827
Alternative sequencei1 – 11M → MEGARARGAQLRLGERVRPV GRRSAPGRSRFRQPWRPGAS DSAPPAGTM in isoform 3 and isoform 4. 2 PublicationsVSP_021784
Alternative sequencei105 – 246142Missing in isoform 4. 1 PublicationVSP_039064Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY313607 mRNA. Translation: AAP79898.1.
AY358294 mRNA. Translation: AAQ88661.1.
AK296649 mRNA. Translation: BAG59247.1.
AK299375 mRNA. Translation: BAG61365.1.
AK304599 mRNA. Translation: BAG65385.1.
AL445183 Genomic DNA. Translation: CAH72591.1. Sequence problems.
AL445183 Genomic DNA. Translation: CAH72592.1.
BC028292 mRNA. Translation: AAH28292.1. Different initiation.
BC030608 mRNA. Translation: AAH30608.1.
CCDSiCCDS55601.1. [Q7Z5L7-4]
CCDS55602.1. [Q7Z5L7-2]
CCDS573.1. [Q7Z5L7-3]
RefSeqiNP_001186009.1. NM_001199080.1. [Q7Z5L7-2]
NP_001186010.1. NM_001199081.1. [Q7Z5L7-2]
NP_001186011.1. NM_001199082.1. [Q7Z5L7-4]
NP_714914.2. NM_153703.4. [Q7Z5L7-3]
XP_005270514.1. XM_005270457.2. [Q7Z5L7-1]
UniGeneiHs.586141.
Hs.744361.

Genome annotation databases

EnsembliENST00000312553; ENSP00000308315; ENSG00000174348. [Q7Z5L7-3]
ENST00000371500; ENSP00000360555; ENSG00000174348. [Q7Z5L7-2]
ENST00000395871; ENSP00000379212; ENSG00000174348. [Q7Z5L7-4]
ENST00000618387; ENSP00000479233; ENSG00000174348. [Q7Z5L7-2]
GeneIDi127435.
KEGGihsa:127435.
UCSCiuc001cuv.4. human. [Q7Z5L7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY313607 mRNA. Translation: AAP79898.1.
AY358294 mRNA. Translation: AAQ88661.1.
AK296649 mRNA. Translation: BAG59247.1.
AK299375 mRNA. Translation: BAG61365.1.
AK304599 mRNA. Translation: BAG65385.1.
AL445183 Genomic DNA. Translation: CAH72591.1. Sequence problems.
AL445183 Genomic DNA. Translation: CAH72592.1.
BC028292 mRNA. Translation: AAH28292.1. Different initiation.
BC030608 mRNA. Translation: AAH30608.1.
CCDSiCCDS55601.1. [Q7Z5L7-4]
CCDS55602.1. [Q7Z5L7-2]
CCDS573.1. [Q7Z5L7-3]
RefSeqiNP_001186009.1. NM_001199080.1. [Q7Z5L7-2]
NP_001186010.1. NM_001199081.1. [Q7Z5L7-2]
NP_001186011.1. NM_001199082.1. [Q7Z5L7-4]
NP_714914.2. NM_153703.4. [Q7Z5L7-3]
XP_005270514.1. XM_005270457.2. [Q7Z5L7-1]
UniGeneiHs.586141.
Hs.744361.

3D structure databases

ProteinModelPortaliQ7Z5L7.
SMRiQ7Z5L7. Positions 64-582.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126059. 6 interactions.
IntActiQ7Z5L7. 1 interaction.
STRINGi9606.ENSP00000308315.

PTM databases

iPTMnetiQ7Z5L7.
PhosphoSiteiQ7Z5L7.

Polymorphism and mutation databases

BioMutaiPODN.
DMDMi118573110.

Proteomic databases

PaxDbiQ7Z5L7.
PRIDEiQ7Z5L7.

Protocols and materials databases

DNASUi127435.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000312553; ENSP00000308315; ENSG00000174348. [Q7Z5L7-3]
ENST00000371500; ENSP00000360555; ENSG00000174348. [Q7Z5L7-2]
ENST00000395871; ENSP00000379212; ENSG00000174348. [Q7Z5L7-4]
ENST00000618387; ENSP00000479233; ENSG00000174348. [Q7Z5L7-2]
GeneIDi127435.
KEGGihsa:127435.
UCSCiuc001cuv.4. human. [Q7Z5L7-1]

Organism-specific databases

CTDi127435.
GeneCardsiPODN.
H-InvDBHIX0199924.
HGNCiHGNC:23174. PODN.
HPAiHPA013892.
MIMi608661. gene.
neXtProtiNX_Q7Z5L7.
PharmGKBiPA134980106.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0619. Eukaryota.
COG4886. LUCA.
GeneTreeiENSGT00760000118969.
HOVERGENiHBG059195.
InParanoidiQ7Z5L7.
OMAiGPEENEF.
OrthoDBiEOG7F24SN.
PhylomeDBiQ7Z5L7.
TreeFamiTF336377.

Miscellaneous databases

ChiTaRSiPODN. human.
GenomeRNAii127435.
PROiQ7Z5L7.
SOURCEiSearch...

Gene expression databases

BgeeiQ7Z5L7.
CleanExiHS_PODN.
GenevisibleiQ7Z5L7. HS.

Family and domain databases

Gene3Di3.80.10.10. 3 hits.
InterProiIPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR003591. Leu-rich_rpt_typical-subtyp.
IPR026906. LRR_5.
IPR000372. LRRNT.
[Graphical view]
PfamiPF13306. LRR_5. 1 hit.
PF13855. LRR_8. 4 hits.
[Graphical view]
SMARTiSM00369. LRR_TYP. 13 hits.
SM00013. LRRNT. 1 hit.
[Graphical view]
SUPFAMiSSF52058. SSF52058. 2 hits.
PROSITEiPS51450. LRR. 17 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Podocan, a novel small leucine-rich repeat protein expressed in the sclerotic glomerular lesion of experimental HIV-associated nephropathy."
    Ross M.D., Bruggeman L.A., Hanss B., Sunamoto M., Marras D., Klotman M.E., Klotman P.E.
    J. Biol. Chem. 278:33248-33255(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, VARIANTS MET-444 AND ALA-472.
    Tissue: Kidney.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ALA-472.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4), VARIANT ALA-472.
    Tissue: Colon, Tongue and Uterus.
  4. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT ALA-472.
    Tissue: Brain and Testis.
  6. "Functional characterization of podocan, a member of a new class in the small leucine-rich repeat protein family."
    Shimizu-Hirota R., Sasamura H., Kuroda M., Kobayashi E., Saruta T.
    FEBS Lett. 563:69-74(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, GLYCOSYLATION, INTERACTION WITH TYPE I COLLAGEN.
  7. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
    Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
    J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-281 AND ASN-299.
    Tissue: Liver.
  8. "Proteomics characterization of extracellular space components in the human aorta."
    Didangelos A., Yin X., Mandal K., Baumert M., Jahangiri M., Mayr M.
    Mol. Cell. Proteomics 9:2048-2062(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
  9. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiPODN_HUMAN
AccessioniPrimary (citable) accession number: Q7Z5L7
Secondary accession number(s): B4DKN5
, B4E373, Q5VVZ2, Q5VVZ3, Q6PIR3, Q6UXL8, Q8N641
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: November 28, 2006
Last modified: June 8, 2016
This is version 122 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.