Reviewed,
UniProtKB/Swiss-Prot Q7Z5K2 (WAPL_HUMAN)
Last modified
June 16, 2009.
Version 42.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Wings apart-like protein homolog Alternative name(s): Friend of EBNA2 protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1190 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | May play a role in cell growth. Ref.1 |
| Subunit structure | |
| Subcellular location | |
| Tissue specificity | Isoform 1 is highly expressed in uterine cervix tumor. Isoform 2 is widely espressed with a high level in skeletal muscle and heart. Ref.1 Ref.2 |
| Sequence similarities | Contains 1 WAPL domain. |
| Sequence caution | The sequence CAH73376.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI16708.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Host-virus interaction |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil |
| PTM | Phosphoprotein |
| Gene Ontology (GO) | |
| Biological process | interspecies interaction between organisms Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | nucleus Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | protein binding Inferred from physical interaction. Source: IntAct |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| PDS5B | Q9NTI5 | 2 | EBI-1022242,EBI-1175604 | |
| RAD21 | O60216 | 1 | EBI-1022242,EBI-80739 | |
| XRN1 | Q8IZH2 | 1 | EBI-1022242,EBI-372406 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] Note: Named isoforms=2. | ||||||
| Isoform 1 (identifier: Q7Z5K2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q7Z5K2-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MVQGPVQTPALTIHRRKRRRRRRRRPVAKAPARLRGEYETGVKM 510-515: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q7Z5K2-3) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MVQGPVQTPA...RGEYETGVKM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1190 | 1190 | Wings apart-like protein homolog | PRO_0000245232 | |||||
Regions | |||||||||
| Domain | 626 – 1169 | 544 | WAPL | ||||||
| Coiled coil | 260 – 286 | 27 | Potential | ||||||
| Coiled coil | 749 – 782 | 34 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 77 | 1 | Phosphoserine Ref.6 Ref.7 | ||||||
| Modified residue | 221 | 1 | Phosphoserine Ref.6 Ref.7 Ref.9 | ||||||
| Modified residue | 223 | 1 | Phosphoserine Ref.7 Ref.8 | ||||||
| Modified residue | 226 | 1 | Phosphoserine Ref.6 Ref.7 Ref.9 Ref.5 | ||||||
| Modified residue | 380 | 1 | Phosphoserine Ref.7 | ||||||
| Modified residue | 459 | 1 | Phosphoserine Ref.7 Ref.9 | ||||||
| Modified residue | 461 | 1 | Phosphoserine Ref.7 Ref.9 | ||||||
| Modified residue | 904 | 1 | Phosphoserine Ref.7 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MVQGPVQTPALTIHRRKRRR RRRRRPVAKAPARLRGEYET GVKM in isoform 2. | VSP_019649 | |||||
| Alternative sequence | 1 | 1 | M → MVQGPVQTPALTIHRRKRRR SCPPNRASYLPKAESLASLG SHLPALLSRARVPRPPAGRR ERERRRRPVAKAPARLRGEY ETGVKM in isoform 3. | VSP_019650 | |||||
| Alternative sequence | 510 – 515 | 6 | Missing in isoform 2. | VSP_019651 | |||||
| Natural variant | 124 | 1 | V → I: dbSNP rs10887621. | VAR_026967 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Expression of a novel human gene, human wings apart-like (hWAPL), is associated with cervical carcinogenesis and tumor progression." Oikawa K., Ohbayashi T., Kiyono T., Nishi H., Isaka K., Umezawa A., Kuroda M., Mukai K. Cancer Res. 64:3545-3549(2004) [PubMed: 15150110] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY. |
| [2] | "Identification and cloning of a novel chromatin-associated protein partner of Epstein-Barr nuclear protein 2." Kwiatkowski B.A., Ragoczy T., Ehly J., Schubach W.H. Exp. Cell Res. 300:223-233(2004) [PubMed: 15383329] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), INTERACTION WITH EPSTEIN-BARR VIRUS EBNA2, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [3] | "Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain." Nagase T., Seki N., Ishikawa K., Ohira M., Kawarabayasi Y., Ohara O., Tanaka A., Kotani H., Miyajima N., Nomura N. DNA Res. 3:321-329(1996) [PubMed: 9039502] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Bone marrow. |
| [4] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed: 15164054] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column." Imami K., Sugiyama N., Kyono Y., Tomita M., Ishihama Y. Anal. Sci. 24:161-166(2008) [PubMed: 18187866] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-226, MASS SPECTROMETRY. |
| [6] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed: 18691976] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-77; SER-221 AND SER-226, MASS SPECTROMETRY. |
| [7] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-77; SER-221; SER-223; SER-226; SER-380; SER-459; SER-461 AND SER-904, MASS SPECTROMETRY. |
| [8] | Carrascal M., Abian J. Submitted (JAN-2008) to UniProtKB Cited for: PHOSPHORYLATION AT SER-223, MASS SPECTROMETRY. Tissue: T-cell. |
| [9] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-221; SER-226; SER-459 AND SER-461, MASS SPECTROMETRY. Tissue: Epithelium. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AB065003 mRNA. Translation: BAC78631.1. AF479418 mRNA. Translation: AAO14651.1. D87450 mRNA. Translation: BAA13391.1. Different initiation. AL844892, AL731569 Genomic DNA. Translation: CAH73376.1. Sequence problems. AL731569, AL844892 Genomic DNA. Translation: CAI16708.1. Sequence problems. | |
| IPI | IPI00375330. IPI00412441. IPI00744918. |
| RefSeq | NP_055860.1. |
| UniGene | Hs.203099 Hs.714876 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q7Z5K2. 8 interactions. |
PTM databases | |
| PhosphoSite | Q7Z5K2. |
Proteomic databases | |
| PRIDE | Q7Z5K2. |
Genome annotation databases | |
| Ensembl | ENSG00000062650. Homo sapiens. [Contig view] |
| GeneID | 23063. |
| KEGG | hsa:23063. |
Organism-specific databases | |
| GeneCards | GC10M088185. |
| HGNC | HGNC:23293. WAPAL. |
| MIM | 610754. gene. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | Q7Z5K2. |
| HOVERGEN | Q7Z5K2. |
| OMA | Q7Z5K2. IKGSVRT. |
Gene expression databases | |
| ArrayExpress | Q7Z5K2. |
| Bgee | Q7Z5K2. |
| CleanEx | HS_WAPAL. |
| GermOnline | ENSG00000062650. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR012502. WAPL. [Graphical view] |
| Pfam | PF07814. WAPL. 1 hit. [Graphical view] |
| PROSITE | PS51271. WAPL. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 44141. |
| SOURCE | Search... |
Entry information
| Entry name | WAPL_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q7Z5K2 Secondary accession number(s): Q5VSK5, Q8IX10, Q92549 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


