Q7Z5K2 (WAPL_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 79.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Wings apart-like protein homolog Alternative name(s): Friend of EBNA2 protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1190 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Regulator of sister chromatid cohesion in mitosis which negatively regulates cohesin association with chromatin. Involved in both sister chromatid cohesion during interphase and sister-chromatid resolution during early stages of mitosis. Couples DNA replication to sister chromatid cohesion. Cohesion ensures that chromosome partitioning is accurate in both meiotic and mitotic cells and plays an important role in DNA repair. Ref.1 Ref.8 Ref.9 Ref.13 Ref.15 Ref.18 |
| Subunit structure | Interacts with the cohesin complex throughout the cell cycle; interacts with both chromatin-bound and soluble pools of the complex. Interacts with RAD21; the interaction is direct. Interacts with PDS5A; the interaction is direct, cohesin-dependent and competitive with SORORIN. Interacts (via FGF motifs) with PDS5B; the interaction is direct. Interacts with SMC3. Isoform 2 interacts with Epstein-Barr virus EBNA2. Ref.2 Ref.8 Ref.9 Ref.13 Ref.15 Ref.18 |
| Subcellular location | Nucleus. Chromosome. Cytoplasm. Note: Associates with chromatin through the cohesin complex during interphase. Released in the cytoplasm from nuclear envelope breakdown until anaphase, it reaccumulates in nucleus at telophase. Ref.2 Ref.8 Ref.9 |
| Tissue specificity | Isoform 1 is highly expressed in uterine cervix tumor. Isoform 2 is widely expressed with a high level in skeletal muscle and heart. Ref.1 Ref.2 |
| Sequence similarities | Belongs to the WAPL family. Contains 1 WAPL domain. |
| Sequence caution | The sequence BAA13391.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence CAH73376.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI16708.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| PDS5B | Q9NTI5 | 9 | EBI-1022242,EBI-1175604 | |
| RAD21 | O60216 | 11 | EBI-1022242,EBI-80739 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] Note: Named isoforms=2. | ||||||
| Isoform 1 (identifier: Q7Z5K2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q7Z5K2-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MVQGPVQTPALTIHRRKRRRRRRRRPVAKAPARLRGEYETGVKM 510-515: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q7Z5K2-3) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MVQGPVQTPA...RGEYETGVKM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1190 | 1190 | Wings apart-like protein homolog | PRO_0000245232 | |||||
Regions | |||||||||
| Domain | 626 – 1169 | 544 | WAPL | ||||||
| Region | 1 – 659 | 659 | Mediates interaction with the cohesin complex | ||||||
| Coiled coil | 260 – 286 | 27 | Potential | ||||||
| Coiled coil | 749 – 782 | 34 | Potential | ||||||
| Motif | 73 – 75 | 3 | FGF motif 1 | ||||||
| Motif | 429 – 431 | 3 | FGF motif 2 | ||||||
| Motif | 453 – 455 | 3 | FGF motif 3 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 77 | 1 | Phosphoserine Ref.10 Ref.11 Ref.14 Ref.16 Ref.19 Ref.21 | ||||||
| Modified residue | 168 | 1 | N6-acetyllysine Ref.17 | ||||||
| Modified residue | 221 | 1 | Phosphoserine Ref.11 Ref.19 Ref.21 | ||||||
| Modified residue | 223 | 1 | Phosphoserine Ref.11 Ref.12 | ||||||
| Modified residue | 226 | 1 | Phosphoserine Ref.7 Ref.10 Ref.11 Ref.19 Ref.21 | ||||||
| Modified residue | 380 | 1 | Phosphoserine Ref.11 Ref.16 | ||||||
| Modified residue | 459 | 1 | Phosphoserine Ref.11 | ||||||
| Modified residue | 461 | 1 | Phosphoserine Ref.11 | ||||||
| Modified residue | 904 | 1 | Phosphoserine Ref.11 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MVQGPVQTPALTIHRRKRRR RRRRRPVAKAPARLRGEYET GVKM in isoform 2. | VSP_019649 | |||||
| Alternative sequence | 1 | 1 | M → MVQGPVQTPALTIHRRKRRR SCPPNRASYLPKAESLASLG SHLPALLSRARVPRPPAGRR ERERRRRPVAKAPARLRGEY ETGVKM in isoform 3. | VSP_019650 | |||||
| Alternative sequence | 510 – 515 | 6 | Missing in isoform 2. | VSP_019651 | |||||
| Natural variant | 124 | 1 | V → I. Corresponds to variant rs10887621 [ dbSNP | Ensembl ]. | VAR_026967 | |||||
Experimental info | |||||||||
| Mutagenesis | 73 – 75 | 3 | FGF → EGE: Loss of interaction with PDS5B; when associated with 429-E--E-431 and 453-E--E-455. | ||||||
| Mutagenesis | 429 – 431 | 3 | FGF → EGE: Loss of interaction with PDS5B; when associated with 73-E--E-75 and 453-E--E-455. Ref.13 | ||||||
| Mutagenesis | 453 – 455 | 3 | FGF → EGE: Loss of interaction with PDS5B; when associated with 73-E--E-75 and 429-E--E-431. Ref.13 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Expression of a novel human gene, human wings apart-like (hWAPL), is associated with cervical carcinogenesis and tumor progression." Oikawa K., Ohbayashi T., Kiyono T., Nishi H., Isaka K., Umezawa A., Kuroda M., Mukai K. Cancer Res. 64:3545-3549(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY. |
| [2] | "Identification and cloning of a novel chromatin-associated protein partner of Epstein-Barr nuclear protein 2." Kwiatkowski B.A., Ragoczy T., Ehly J., Schubach W.H. Exp. Cell Res. 300:223-233(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), INTERACTION WITH EPSTEIN-BARR VIRUS EBNA2, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [3] | "Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain." Nagase T., Seki N., Ishikawa K., Ohira M., Kawarabayasi Y., Ohara O., Tanaka A., Kotani H., Miyajima N., Nomura N. DNA Res. 3:321-329(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Bone marrow. |
| [4] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [7] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-226, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "Wapl controls the dynamic association of cohesin with chromatin." Kueng S., Hegemann B., Peters B.H., Lipp J.J., Schleiffer A., Mechtler K., Peters J.M. Cell 127:955-967(2006) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY, FUNCTION, INTERACTION WITH THE COHESIN COMPLEX AND PDS5A, SUBCELLULAR LOCATION. |
| [9] | "Human Wapl is a cohesin-binding protein that promotes sister-chromatid resolution in mitotic prophase." Gandhi R., Gillespie P.J., Hirano T. Curr. Biol. 16:2406-2417(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH THE COHESIN COMPLEX, SUBCELLULAR LOCATION. |
| [10] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-77 AND SER-226, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [11] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-77; SER-221; SER-223; SER-226; SER-380; SER-459; SER-461 AND SER-904, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | Carrascal M., Abian J. Submitted (JAN-2008) to UniProtKB Cited for: PHOSPHORYLATION AT SER-223, MASS SPECTROMETRY. Tissue: T-cell. |
| [13] | "Releasing cohesin from chromosome arms in early mitosis: opposing actions of Wapl-Pds5 and Sgo1." Shintomi K., Hirano T. Genes Dev. 23:2224-2236(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH PDS5B AND RAD21, MUTAGENESIS OF 73-PHE--PHE-75; 429-PHE--PHE-431 AND 453-PHE--PHE-455, FGF MOTIFS. |
| [14] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-77, MASS SPECTROMETRY. |
| [15] | "Cohesin acetylation speeds the replication fork." Terret M.E., Sherwood R., Rahman S., Qin J., Jallepalli P.V. Nature 462:231-234(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH SMC3. |
| [16] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-77 AND SER-380, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [17] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-168, MASS SPECTROMETRY. |
| [18] | "Sororin mediates sister chromatid cohesion by antagonizing wapl." Nishiyama T., Ladurner R., Schmitz J., Kreidl E., Schleiffer A., Bhaskara V., Bando M., Shirahige K., Hyman A.A., Mechtler K., Peters J.M. Cell 143:737-749(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH PDS5A. |
| [19] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-77; SER-221 AND SER-226, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [20] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [21] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-77; SER-221 AND SER-226, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB065003 mRNA. Translation: BAC78631.1. AF479418 mRNA. Translation: AAO14651.1. D87450 mRNA. Translation: BAA13391.1. Different initiation. AL844892, AL731569 Genomic DNA. Translation: CAH73376.1. Sequence problems. AL731569, AL844892 Genomic DNA. Translation: CAI16708.1. Sequence problems. CH471142 Genomic DNA. Translation: EAW80336.1. BC150269 mRNA. Translation: AAI50270.1. |
| IPI | IPI00375330. IPI00412441. IPI00744918. |
| RefSeq | NP_055860.1. NM_015045.2. |
| UniGene | Hs.203099. Hs.714876. |
3D structure databases | |
| ProteinModelPortal | Q7Z5K2. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q7Z5K2. 13 interactions. |
| STRING | 9606.ENSP00000298767. |
PTM databases | |
| PhosphoSite | Q7Z5K2. |
Polymorphism databases | |
| DMDM | 74713658. |
Proteomic databases | |
| PaxDb | Q7Z5K2. |
| PRIDE | Q7Z5K2. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000298767; ENSP00000298767; ENSG00000062650. ENST00000342368; ENSP00000345162; ENSG00000062650. |
| GeneID | 23063. |
| KEGG | hsa:23063. |
| UCSC | uc001kdn.3. human. uc001kdo.3. human. |
Organism-specific databases | |
| CTD | 23063. |
| GeneCards | GC10M088185. |
| HGNC | HGNC:23293. WAPAL. |
| HPA | HPA037874. HPA037875. |
| MIM | 610754. gene. |
| neXtProt | NX_Q7Z5K2. |
| PharmGKB | PA134872402. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG297597. |
| HOGENOM | HOG000001563. |
| HOVERGEN | HBG088338. |
| InParanoid | Q7Z5K2. |
| OMA | NARHWNQ. |
| OrthoDB | EOG4TXBR6. |
Enzyme and pathway databases | |
| Reactome | REACT_115566. Cell Cycle. REACT_21300. Mitotic M-M/G1 phases. |
Gene expression databases | |
| ArrayExpress | Q7Z5K2. |
| Bgee | Q7Z5K2. |
| CleanEx | HS_WAPAL. |
| Genevestigator | Q7Z5K2. |
| GermOnline | ENSG00000062650. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR016024. ARM-type_fold. IPR012502. WAPL_metazoan_plants. IPR022771. WAPL_prot. [Graphical view] |
| Pfam | PF07814. WAPL. 1 hit. [Graphical view] |
| SUPFAM | SSF48371. ARM-type_fold. 1 hit. |
| PROSITE | PS51271. WAPL. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | WAPAL. human. |
| GenomeRNAi | 23063. |
| NextBio | 44141. |
| SOURCE | Search... |
Entry information
| Entry name | WAPL_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q7Z5K2 Secondary accession number(s): A7E2B5 Q92549 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
