Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q7Z5A7

- F19A5_HUMAN

UniProt

Q7Z5A7 - F19A5_HUMAN

Protein

Protein FAM19A5

Gene

FAM19A5

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli
  1. Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein FAM19A5
    Alternative name(s):
    Chemokine-like protein TAFA-5
    Gene namesi
    Name:FAM19A5
    Synonyms:TAFA5
    ORF Names:UNQ5208/PRO34524
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 22

    Organism-specific databases

    HGNCiHGNC:21592. FAM19A5.

    Subcellular locationi

    GO - Cellular componenti

    1. extracellular region Source: UniProtKB-SubCell
    2. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane, Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134887312.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 132132Protein FAM19A5PRO_0000042732Add
    BLAST

    Proteomic databases

    PRIDEiQ7Z5A7.

    Expressioni

    Tissue specificityi

    Isoform 2 is brain-specific.1 Publication

    Gene expression databases

    ArrayExpressiQ7Z5A7.
    BgeeiQ7Z5A7.
    CleanExiHS_FAM19A5.
    GenevestigatoriQ7Z5A7.

    Organism-specific databases

    HPAiCAB025629.
    HPA048727.

    Structurei

    3D structure databases

    ProteinModelPortaliQ7Z5A7.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei15 – 3723HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the FAM19/TAFA family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG43944.
    HOVERGENiHBG081496.
    InParanoidiQ7Z5A7.
    OMAiCEMLPCL.
    OrthoDBiEOG769ZM9.
    PhylomeDBiQ7Z5A7.
    TreeFamiTF331749.

    Family and domain databases

    InterProiIPR020350. Chemokine-like_FAM19A2.
    [Graphical view]
    PfamiPF12020. TAFA. 1 hit.
    [Graphical view]
    ProDomiPD298472. Chemokine-like_2FAM19A2. 1 hit.
    [Graphical view] [Entries sharing at least one domain]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q7Z5A7-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAPSPRTGSR QDATALPSMS STFWAFMILA SLLIAYCSQL AAGTCEIVTL    50
    DRDSSQPRRT IARQTARCAC RKGQIAGTTR ARPACVDARI IKTKQWCDML 100
    PCLEGEGCDL LINRSGWTCT QPGGRIKTTT VS 132
    Length:132
    Mass (Da):14,301
    Last modified:September 2, 2008 - v2
    Checksum:i16BFE9F574FBB066
    GO
    Isoform 2 (identifier: Q7Z5A7-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-38: MAPSPRTGSRQDATALPSMSSTFWAFMILASLLIAYCS → MQLLKALWALAGAALCCFLVLVIHAQFLKEG

    Note: Contains a predicted signal peptide at positions 1-25.Curated

    Show »
    Length:125
    Mass (Da):13,592
    Checksum:iA8BCA8D09F86404A
    GO
    Isoform 3 (identifier: Q7Z5A7-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-87: MAPSPRTGSR...TTRARPACVD → MYHHREWP

    Note: No experimental confirmation available. Gene prediction based on EST data.

    Show »
    Length:53
    Mass (Da):6,119
    Checksum:iBE4717D812247D1D
    GO

    Sequence cautioni

    The sequence AAD20061.1 differs from that shown. Reason: Erroneous initiation.
    The sequence AAH39396.2 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Isoform 2 (identifier: Q7Z5A7-2)
    Sequence conflicti11 – 2313AGAAL…LVLVI → V in AAQ89206. (PubMed:12975309)CuratedAdd
    BLAST

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 8787MAPSP…PACVD → MYHHREWP in isoform 3. CuratedVSP_035191Add
    BLAST
    Alternative sequencei1 – 3838MAPSP…IAYCS → MQLLKALWALAGAALCCFLV LVIHAQFLKEG in isoform 2. 3 PublicationsVSP_016068Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY325118 mRNA. Translation: AAP92410.1.
    AF131851 mRNA. Translation: AAD20061.1. Different initiation.
    AY358847 mRNA. Translation: AAQ89206.1.
    AK123443 mRNA. Translation: BAG53905.1.
    AK125256 mRNA. Translation: BAG54175.1.
    AL096853, AL096843, Z83837 Genomic DNA. Translation: CAO03624.1.
    Z83837, AL096843, AL096853 Genomic DNA. Translation: CAQ09100.1.
    Z83837, AL096843 Genomic DNA. Translation: CAQ09101.1.
    Z83837, AL096843, Z84468 Genomic DNA. Translation: CAQ09102.1.
    Z84468, AL096843, Z83837 Genomic DNA. Translation: CAO03302.1.
    BC039396 mRNA. Translation: AAH39396.2. Different initiation.
    CCDSiCCDS46728.1. [Q7Z5A7-1]
    CCDS46729.1. [Q7Z5A7-2]
    RefSeqiNP_001076436.1. NM_001082967.2. [Q7Z5A7-1]
    NP_056196.2. NM_015381.6. [Q7Z5A7-2]
    UniGeneiHs.436854.

    Genome annotation databases

    EnsembliENST00000358295; ENSP00000351043; ENSG00000219438. [Q7Z5A7-2]
    ENST00000402357; ENSP00000383933; ENSG00000219438. [Q7Z5A7-1]
    ENST00000406880; ENSP00000385603; ENSG00000219438. [Q7Z5A7-3]
    GeneIDi25817.
    KEGGihsa:25817.
    UCSCiuc003bim.4. human. [Q7Z5A7-1]
    uc003bio.4. human. [Q7Z5A7-2]

    Polymorphism databases

    DMDMi205371754.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY325118 mRNA. Translation: AAP92410.1 .
    AF131851 mRNA. Translation: AAD20061.1 . Different initiation.
    AY358847 mRNA. Translation: AAQ89206.1 .
    AK123443 mRNA. Translation: BAG53905.1 .
    AK125256 mRNA. Translation: BAG54175.1 .
    AL096853 , AL096843 , Z83837 Genomic DNA. Translation: CAO03624.1 .
    Z83837 , AL096843 , AL096853 Genomic DNA. Translation: CAQ09100.1 .
    Z83837 , AL096843 Genomic DNA. Translation: CAQ09101.1 .
    Z83837 , AL096843 , Z84468 Genomic DNA. Translation: CAQ09102.1 .
    Z84468 , AL096843 , Z83837 Genomic DNA. Translation: CAO03302.1 .
    BC039396 mRNA. Translation: AAH39396.2 . Different initiation.
    CCDSi CCDS46728.1. [Q7Z5A7-1 ]
    CCDS46729.1. [Q7Z5A7-2 ]
    RefSeqi NP_001076436.1. NM_001082967.2. [Q7Z5A7-1 ]
    NP_056196.2. NM_015381.6. [Q7Z5A7-2 ]
    UniGenei Hs.436854.

    3D structure databases

    ProteinModelPortali Q7Z5A7.
    ModBasei Search...
    MobiDBi Search...

    Polymorphism databases

    DMDMi 205371754.

    Proteomic databases

    PRIDEi Q7Z5A7.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000358295 ; ENSP00000351043 ; ENSG00000219438 . [Q7Z5A7-2 ]
    ENST00000402357 ; ENSP00000383933 ; ENSG00000219438 . [Q7Z5A7-1 ]
    ENST00000406880 ; ENSP00000385603 ; ENSG00000219438 . [Q7Z5A7-3 ]
    GeneIDi 25817.
    KEGGi hsa:25817.
    UCSCi uc003bim.4. human. [Q7Z5A7-1 ]
    uc003bio.4. human. [Q7Z5A7-2 ]

    Organism-specific databases

    CTDi 25817.
    GeneCardsi GC22P048885.
    HGNCi HGNC:21592. FAM19A5.
    HPAi CAB025629.
    HPA048727.
    neXtProti NX_Q7Z5A7.
    PharmGKBi PA134887312.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG43944.
    HOVERGENi HBG081496.
    InParanoidi Q7Z5A7.
    OMAi CEMLPCL.
    OrthoDBi EOG769ZM9.
    PhylomeDBi Q7Z5A7.
    TreeFami TF331749.

    Miscellaneous databases

    GeneWikii FAM19A5.
    GenomeRNAii 25817.
    NextBioi 47053.
    PROi Q7Z5A7.

    Gene expression databases

    ArrayExpressi Q7Z5A7.
    Bgeei Q7Z5A7.
    CleanExi HS_FAM19A5.
    Genevestigatori Q7Z5A7.

    Family and domain databases

    InterProi IPR020350. Chemokine-like_FAM19A2.
    [Graphical view ]
    Pfami PF12020. TAFA. 1 hit.
    [Graphical view ]
    ProDomi PD298472. Chemokine-like_2FAM19A2. 1 hit.
    [Graphical view ] [Entries sharing at least one domain ]
    ProtoNeti Search...

    Publicationsi

    1. "TAFA: a novel secreted family with conserved cysteine residues and restricted expression in the brain."
      Tom Tang Y., Emtage P., Funk W.D., Hu T., Arterburn M., Park E.E., Rupp F.
      Genomics 83:727-734(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
    2. Mei G., Yu W., Gibbs R.A.
      Submitted (FEB-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Neuroblastoma and Subthalamic nucleus.
    5. "The DNA sequence of human chromosome 22."
      Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M.
      , Buck D., Burgess J., Burrill W.D., Burton J., Carder C., Carter N.P., Chen Y., Clark G., Clegg S.M., Cobley V.E., Cole C.G., Collier R.E., Connor R., Conroy D., Corby N.R., Coville G.J., Cox A.V., Davis J., Dawson E., Dhami P.D., Dockree C., Dodsworth S.J., Durbin R.M., Ellington A.G., Evans K.L., Fey J.M., Fleming K., French L., Garner A.A., Gilbert J.G.R., Goward M.E., Grafham D.V., Griffiths M.N.D., Hall C., Hall R.E., Hall-Tamlyn G., Heathcott R.W., Ho S., Holmes S., Hunt S.E., Jones M.C., Kershaw J., Kimberley A.M., King A., Laird G.K., Langford C.F., Leversha M.A., Lloyd C., Lloyd D.M., Martyn I.D., Mashreghi-Mohammadi M., Matthews L.H., Mccann O.T., Mcclay J., Mclaren S., McMurray A.A., Milne S.A., Mortimore B.J., Odell C.N., Pavitt R., Pearce A.V., Pearson D., Phillimore B.J.C.T., Phillips S.H., Plumb R.W., Ramsay H., Ramsey Y., Rogers L., Ross M.T., Scott C.E., Sehra H.K., Skuce C.D., Smalley S., Smith M.L., Soderlund C., Spragon L., Steward C.A., Sulston J.E., Swann R.M., Vaudin M., Wall M., Wallis J.M., Whiteley M.N., Willey D.L., Williams L., Williams S.A., Williamson H., Wilmer T.E., Wilming L., Wright C.L., Hubbard T., Bentley D.R., Beck S., Rogers J., Shimizu N., Minoshima S., Kawasaki K., Sasaki T., Asakawa S., Kudoh J., Shintani A., Shibuya K., Yoshizaki Y., Aoki N., Mitsuyama S., Roe B.A., Chen F., Chu L., Crabtree J., Deschamps S., Do A., Do T., Dorman A., Fang F., Fu Y., Hu P., Hua A., Kenton S., Lai H., Lao H.I., Lewis J., Lewis S., Lin S.-P., Loh P., Malaj E., Nguyen T., Pan H., Phan S., Qi S., Qian Y., Ray L., Ren Q., Shaull S., Sloan D., Song L., Wang Q., Wang Y., Wang Z., White J., Willingham D., Wu H., Yao Z., Zhan M., Zhang G., Chissoe S., Murray J., Miller N., Minx P., Fulton R., Johnson D., Bemis G., Bentley D., Bradshaw H., Bourne S., Cordes M., Du Z., Fulton L., Goela D., Graves T., Hawkins J., Hinds K., Kemp K., Latreille P., Layman D., Ozersky P., Rohlfing T., Scheet P., Walker C., Wamsley A., Wohldmann P., Pepin K., Nelson J., Korf I., Bedell J.A., Hillier L.W., Mardis E., Waterston R., Wilson R., Emanuel B.S., Shaikh T., Kurahashi H., Saitta S., Budarf M.L., McDermid H.E., Johnson A., Wong A.C.C., Morrow B.E., Edelmann L., Kim U.J., Shizuya H., Simon M.I., Dumanski J.P., Peyrard M., Kedra D., Seroussi E., Fransson I., Tapia I., Bruder C.E., O'Brien K.P., Wilkinson P., Bodenteich A., Hartman K., Hu X., Khan A.S., Lane L., Tilahun Y., Wright H.
      Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Hypothalamus.

    Entry informationi

    Entry nameiF19A5_HUMAN
    AccessioniPrimary (citable) accession number: Q7Z5A7
    Secondary accession number(s): A6NII9
    , B0QZ13, B0QZ14, B0QZ15, O95902, Q5H9C4, Q6UWC9, Q8IXR8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 8, 2005
    Last sequence update: September 2, 2008
    Last modified: October 1, 2014
    This is version 77 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 22
      Human chromosome 22: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3