Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q7Z5A7 (F19A5_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 74. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Protein FAM19A5
Alternative name(s):
Chemokine-like protein TAFA-5
Gene names
Name:FAM19A5
Synonyms:TAFA5
ORF Names:UNQ5208/PRO34524
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length132 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Subcellular location

Membrane; Single-pass membrane protein Potential Ref.1.

Isoform 2: Secreted Ref.1.

Tissue specificity

Isoform 2 is brain-specific. Ref.1

Sequence similarities

Belongs to the FAM19/TAFA family.

Sequence caution

The sequence AAD20061.1 differs from that shown. Reason: Erroneous initiation.

The sequence AAH39396.2 differs from that shown. Reason: Erroneous initiation.

Ontologies

Keywords
   Cellular componentMembrane
Secreted
   Coding sequence diversityAlternative splicing
   DomainTransmembrane
Transmembrane helix
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentextracellular region

Inferred from electronic annotation. Source: UniProtKB-SubCell

integral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q7Z5A7-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q7Z5A7-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MAPSPRTGSRQDATALPSMSSTFWAFMILASLLIAYCS → MQLLKALWALAGAALCCFLVLVIHAQFLKEG
Note: Contains a predicted signal peptide at positions 1-25. Ref.3 (AAQ89206) sequence is in conflict in positions: 11-23:AGAALCCFLVLVI->V.
Isoform 3 (identifier: Q7Z5A7-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-87: MAPSPRTGSR...TTRARPACVD → MYHHREWP
Note: No experimental confirmation available. Gene prediction based on EST data.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 132132Protein FAM19A5
PRO_0000042732

Regions

Transmembrane15 – 3723Helical; Potential

Natural variations

Alternative sequence1 – 8787MAPSP…PACVD → MYHHREWP in isoform 3.
VSP_035191
Alternative sequence1 – 3838MAPSP…IAYCS → MQLLKALWALAGAALCCFLV LVIHAQFLKEG in isoform 2.
VSP_016068

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified September 2, 2008. Version 2.
Checksum: 16BFE9F574FBB066

FASTA13214,301
        10         20         30         40         50         60 
MAPSPRTGSR QDATALPSMS STFWAFMILA SLLIAYCSQL AAGTCEIVTL DRDSSQPRRT 

        70         80         90        100        110        120 
IARQTARCAC RKGQIAGTTR ARPACVDARI IKTKQWCDML PCLEGEGCDL LINRSGWTCT 

       130 
QPGGRIKTTT VS 

« Hide

Isoform 2 [UniParc].

Checksum: A8BCA8D09F86404A
Show »

FASTA12513,592
Isoform 3 [UniParc].

Checksum: BE4717D812247D1D
Show »

FASTA536,119

References

« Hide 'large scale' references
[1]"TAFA: a novel secreted family with conserved cysteine residues and restricted expression in the brain."
Tom Tang Y., Emtage P., Funk W.D., Hu T., Arterburn M., Park E.E., Rupp F.
Genomics 83:727-734(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
[2]Mei G., Yu W., Gibbs R.A.
Submitted (FEB-1999) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[3]"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. expand/collapse author list , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.
Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Neuroblastoma and Subthalamic nucleus.
[5]"The DNA sequence of human chromosome 22."
Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M. expand/collapse author list , Buck D., Burgess J., Burrill W.D., Burton J., Carder C., Carter N.P., Chen Y., Clark G., Clegg S.M., Cobley V.E., Cole C.G., Collier R.E., Connor R., Conroy D., Corby N.R., Coville G.J., Cox A.V., Davis J., Dawson E., Dhami P.D., Dockree C., Dodsworth S.J., Durbin R.M., Ellington A.G., Evans K.L., Fey J.M., Fleming K., French L., Garner A.A., Gilbert J.G.R., Goward M.E., Grafham D.V., Griffiths M.N.D., Hall C., Hall R.E., Hall-Tamlyn G., Heathcott R.W., Ho S., Holmes S., Hunt S.E., Jones M.C., Kershaw J., Kimberley A.M., King A., Laird G.K., Langford C.F., Leversha M.A., Lloyd C., Lloyd D.M., Martyn I.D., Mashreghi-Mohammadi M., Matthews L.H., Mccann O.T., Mcclay J., Mclaren S., McMurray A.A., Milne S.A., Mortimore B.J., Odell C.N., Pavitt R., Pearce A.V., Pearson D., Phillimore B.J.C.T., Phillips S.H., Plumb R.W., Ramsay H., Ramsey Y., Rogers L., Ross M.T., Scott C.E., Sehra H.K., Skuce C.D., Smalley S., Smith M.L., Soderlund C., Spragon L., Steward C.A., Sulston J.E., Swann R.M., Vaudin M., Wall M., Wallis J.M., Whiteley M.N., Willey D.L., Williams L., Williams S.A., Williamson H., Wilmer T.E., Wilming L., Wright C.L., Hubbard T., Bentley D.R., Beck S., Rogers J., Shimizu N., Minoshima S., Kawasaki K., Sasaki T., Asakawa S., Kudoh J., Shintani A., Shibuya K., Yoshizaki Y., Aoki N., Mitsuyama S., Roe B.A., Chen F., Chu L., Crabtree J., Deschamps S., Do A., Do T., Dorman A., Fang F., Fu Y., Hu P., Hua A., Kenton S., Lai H., Lao H.I., Lewis J., Lewis S., Lin S.-P., Loh P., Malaj E., Nguyen T., Pan H., Phan S., Qi S., Qian Y., Ray L., Ren Q., Shaull S., Sloan D., Song L., Wang Q., Wang Y., Wang Z., White J., Willingham D., Wu H., Yao Z., Zhan M., Zhang G., Chissoe S., Murray J., Miller N., Minx P., Fulton R., Johnson D., Bemis G., Bentley D., Bradshaw H., Bourne S., Cordes M., Du Z., Fulton L., Goela D., Graves T., Hawkins J., Hinds K., Kemp K., Latreille P., Layman D., Ozersky P., Rohlfing T., Scheet P., Walker C., Wamsley A., Wohldmann P., Pepin K., Nelson J., Korf I., Bedell J.A., Hillier L.W., Mardis E., Waterston R., Wilson R., Emanuel B.S., Shaikh T., Kurahashi H., Saitta S., Budarf M.L., McDermid H.E., Johnson A., Wong A.C.C., Morrow B.E., Edelmann L., Kim U.J., Shizuya H., Simon M.I., Dumanski J.P., Peyrard M., Kedra D., Seroussi E., Fransson I., Tapia I., Bruder C.E., O'Brien K.P., Wilkinson P., Bodenteich A., Hartman K., Hu X., Khan A.S., Lane L., Tilahun Y., Wright H.
Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Hypothalamus.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY325118 mRNA. Translation: AAP92410.1.
AF131851 mRNA. Translation: AAD20061.1. Different initiation.
AY358847 mRNA. Translation: AAQ89206.1.
AK123443 mRNA. Translation: BAG53905.1.
AK125256 mRNA. Translation: BAG54175.1.
AL096853, AL096843, Z83837 Genomic DNA. Translation: CAO03624.1.
Z83837, AL096843, AL096853 Genomic DNA. Translation: CAQ09100.1.
Z83837, AL096843 Genomic DNA. Translation: CAQ09101.1.
Z83837, AL096843, Z84468 Genomic DNA. Translation: CAQ09102.1.
Z84468, AL096843, Z83837 Genomic DNA. Translation: CAO03302.1.
BC039396 mRNA. Translation: AAH39396.2. Different initiation.
RefSeqNP_001076436.1. NM_001082967.2.
NP_056196.2. NM_015381.6.
UniGeneHs.436854.

3D structure databases

ProteinModelPortalQ7Z5A7.
ModBaseSearch...
MobiDBSearch...

Polymorphism databases

DMDM205371754.

Proteomic databases

PRIDEQ7Z5A7.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000358295; ENSP00000351043; ENSG00000219438. [Q7Z5A7-2]
ENST00000402357; ENSP00000383933; ENSG00000219438. [Q7Z5A7-1]
ENST00000406880; ENSP00000385603; ENSG00000219438. [Q7Z5A7-3]
GeneID25817.
KEGGhsa:25817.
UCSCuc003bim.4. human. [Q7Z5A7-1]
uc003bio.4. human. [Q7Z5A7-2]

Organism-specific databases

CTD25817.
GeneCardsGC22P048885.
HGNCHGNC:21592. FAM19A5.
HPACAB025629.
HPA048727.
neXtProtNX_Q7Z5A7.
PharmGKBPA134887312.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG43944.
HOVERGENHBG081496.
InParanoidQ7Z5A7.
OMACEMLPCL.
OrthoDBEOG769ZM9.
PhylomeDBQ7Z5A7.
TreeFamTF331749.

Gene expression databases

ArrayExpressQ7Z5A7.
BgeeQ7Z5A7.
CleanExHS_FAM19A5.
GenevestigatorQ7Z5A7.

Family and domain databases

InterProIPR020350. Chemokine-like_FAM19A2.
[Graphical view]
PfamPF12020. TAFA. 1 hit.
[Graphical view]
ProDomPD298472. Chemokine-like_2FAM19A2. 1 hit.
[Graphical view] [Entries sharing at least one domain]
ProtoNetSearch...

Other

GeneWikiFAM19A5.
GenomeRNAi25817.
NextBio47053.
PROQ7Z5A7.

Entry information

Entry nameF19A5_HUMAN
AccessionPrimary (citable) accession number: Q7Z5A7
Secondary accession number(s): A6NII9 expand/collapse secondary AC list , B0QZ13, B0QZ14, B0QZ15, O95902, Q5H9C4, Q6UWC9, Q8IXR8
Entry history
Integrated into UniProtKB/Swiss-Prot: November 8, 2005
Last sequence update: September 2, 2008
Last modified: April 16, 2014
This is version 74 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human chromosome 22

Human chromosome 22: entries, gene names and cross-references to MIM