Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein FAM19A5

Gene

FAM19A5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Protein FAM19A5
Alternative name(s):
Chemokine-like protein TAFA-5
Gene namesi
Name:FAM19A5
Synonyms:TAFA5
ORF Names:UNQ5208/PRO34524
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

HGNCiHGNC:21592. FAM19A5.

Subcellular locationi

Isoform 2 :

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei15 – 37HelicalSequence analysisAdd BLAST23

GO - Cellular componenti

Keywords - Cellular componenti

Membrane, Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi25817.
OpenTargetsiENSG00000219438.
PharmGKBiPA134887312.

Polymorphism and mutation databases

BioMutaiFAM19A5.
DMDMi205371754.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000427321 – 132Protein FAM19A5Add BLAST132

Proteomic databases

PaxDbiQ7Z5A7.
PeptideAtlasiQ7Z5A7.
PRIDEiQ7Z5A7.

PTM databases

iPTMnetiQ7Z5A7.
PhosphoSitePlusiQ7Z5A7.

Expressioni

Tissue specificityi

Isoform 2 is brain-specific.1 Publication

Gene expression databases

BgeeiENSG00000219438.
CleanExiHS_FAM19A5.
ExpressionAtlasiQ7Z5A7. baseline and differential.
GenevisibleiQ7Z5A7. HS.

Organism-specific databases

HPAiCAB025629.

Interactioni

Protein-protein interaction databases

BioGridi117345. 17 interactors.
STRINGi9606.ENSP00000383933.

Structurei

3D structure databases

ProteinModelPortaliQ7Z5A7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the FAM19/TAFA family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IZKE. Eukaryota.
ENOG410YTJG. LUCA.
GeneTreeiENSGT00390000001768.
HOVERGENiHBG081496.
InParanoidiQ7Z5A7.
OMAiCEMLPCL.
PhylomeDBiQ7Z5A7.
TreeFamiTF331749.

Family and domain databases

InterProiView protein in InterPro
IPR020350. Chemokine-like_FAM19A2.
PfamiView protein in Pfam
PF12020. TAFA. 1 hit.
ProDomiView protein in ProDom or Entries sharing at least one domain
PD298472. Chemokine-like_2FAM19A2. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7Z5A7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPSPRTGSR QDATALPSMS STFWAFMILA SLLIAYCSQL AAGTCEIVTL
60 70 80 90 100
DRDSSQPRRT IARQTARCAC RKGQIAGTTR ARPACVDARI IKTKQWCDML
110 120 130
PCLEGEGCDL LINRSGWTCT QPGGRIKTTT VS
Length:132
Mass (Da):14,301
Last modified:September 2, 2008 - v2
Checksum:i16BFE9F574FBB066
GO
Isoform 2 (identifier: Q7Z5A7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MAPSPRTGSRQDATALPSMSSTFWAFMILASLLIAYCS → MQLLKALWALAGAALCCFLVLVIHAQFLKEG

Note: Contains a predicted signal peptide at positions 1-25.Curated
Show »
Length:125
Mass (Da):13,592
Checksum:iA8BCA8D09F86404A
GO
Isoform 3 (identifier: Q7Z5A7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-87: MAPSPRTGSR...TTRARPACVD → MYHHREWP

Note: No experimental confirmation available. Gene prediction based on EST data.
Show »
Length:53
Mass (Da):6,119
Checksum:iBE4717D812247D1D
GO

Sequence cautioni

The sequence AAD20061 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAH39396 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 2 (identifier: Q7Z5A7-2)
Sequence conflicti11 – 23AGAAL…LVLVI → V in AAQ89206 (PubMed:12975309).CuratedAdd BLAST13

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0351911 – 87MAPSP…PACVD → MYHHREWP in isoform 3. CuratedAdd BLAST87
Alternative sequenceiVSP_0160681 – 38MAPSP…IAYCS → MQLLKALWALAGAALCCFLV LVIHAQFLKEG in isoform 2. 3 PublicationsAdd BLAST38

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY325118 mRNA. Translation: AAP92410.1.
AF131851 mRNA. Translation: AAD20061.1. Different initiation.
AY358847 mRNA. Translation: AAQ89206.1.
AK123443 mRNA. Translation: BAG53905.1.
AK125256 mRNA. Translation: BAG54175.1.
AL096853, AL096843, Z83837 Genomic DNA. Translation: CAO03624.1.
Z83837, AL096843, AL096853 Genomic DNA. Translation: CAQ09100.1.
Z83837, AL096843 Genomic DNA. Translation: CAQ09101.1.
Z83837, AL096843, Z84468 Genomic DNA. Translation: CAQ09102.1.
Z84468, AL096843, Z83837 Genomic DNA. Translation: CAO03302.1.
BC039396 mRNA. Translation: AAH39396.2. Different initiation.
CCDSiCCDS46728.1. [Q7Z5A7-1]
CCDS46729.1. [Q7Z5A7-2]
RefSeqiNP_001076436.1. NM_001082967.2. [Q7Z5A7-1]
NP_056196.2. NM_015381.6. [Q7Z5A7-2]
UniGeneiHs.436854.

Genome annotation databases

EnsembliENST00000358295; ENSP00000351043; ENSG00000219438. [Q7Z5A7-2]
ENST00000402357; ENSP00000383933; ENSG00000219438. [Q7Z5A7-1]
ENST00000406880; ENSP00000385603; ENSG00000219438. [Q7Z5A7-3]
GeneIDi25817.
KEGGihsa:25817.
UCSCiuc003bim.6. human. [Q7Z5A7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiF19A5_HUMAN
AccessioniPrimary (citable) accession number: Q7Z5A7
Secondary accession number(s): A6NII9
, B0QZ13, B0QZ14, B0QZ15, O95902, Q5H9C4, Q6UWC9, Q8IXR8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 8, 2005
Last sequence update: September 2, 2008
Last modified: August 30, 2017
This is version 95 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families