SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q7Z5A7

- F19A5_HUMAN

UniProt

Q7Z5A7 - F19A5_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Protein FAM19A5
Gene
FAM19A5, TAFA5, UNQ5208/PRO34524
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Protein FAM19A5
Alternative name(s):
Chemokine-like protein TAFA-5
Gene namesi
Name:FAM19A5
Synonyms:TAFA5
ORF Names:UNQ5208/PRO34524
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 22

Organism-specific databases

HGNCiHGNC:21592. FAM19A5.

Subcellular locationi

Membrane; Single-pass membrane protein Reviewed prediction 1 Publication
Isoform 2 : Secreted 1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei15 – 3723Helical; Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. extracellular region Source: UniProtKB-SubCell
  2. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane, Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134887312.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 132132Protein FAM19A5
PRO_0000042732Add
BLAST

Proteomic databases

PRIDEiQ7Z5A7.

Expressioni

Tissue specificityi

Isoform 2 is brain-specific.1 Publication

Gene expression databases

ArrayExpressiQ7Z5A7.
BgeeiQ7Z5A7.
CleanExiHS_FAM19A5.
GenevestigatoriQ7Z5A7.

Organism-specific databases

HPAiCAB025629.
HPA048727.

Structurei

3D structure databases

ProteinModelPortaliQ7Z5A7.

Family & Domainsi

Sequence similaritiesi

Belongs to the FAM19/TAFA family.

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG43944.
HOVERGENiHBG081496.
InParanoidiQ7Z5A7.
OMAiCEMLPCL.
OrthoDBiEOG769ZM9.
PhylomeDBiQ7Z5A7.
TreeFamiTF331749.

Family and domain databases

InterProiIPR020350. Chemokine-like_FAM19A2.
[Graphical view]
PfamiPF12020. TAFA. 1 hit.
[Graphical view]
ProDomiPD298472. Chemokine-like_2FAM19A2. 1 hit.
[Graphical view] [Entries sharing at least one domain]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q7Z5A7-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAPSPRTGSR QDATALPSMS STFWAFMILA SLLIAYCSQL AAGTCEIVTL    50
DRDSSQPRRT IARQTARCAC RKGQIAGTTR ARPACVDARI IKTKQWCDML 100
PCLEGEGCDL LINRSGWTCT QPGGRIKTTT VS 132
Length:132
Mass (Da):14,301
Last modified:September 2, 2008 - v2
Checksum:i16BFE9F574FBB066
GO
Isoform 2 (identifier: Q7Z5A7-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MAPSPRTGSRQDATALPSMSSTFWAFMILASLLIAYCS → MQLLKALWALAGAALCCFLVLVIHAQFLKEG

Note: Contains a predicted signal peptide at positions 1-25. Ref.3 (AAQ89206) sequence is in conflict in positions: 11-23:AGAALCCFLVLVI->V.

Show »
Length:125
Mass (Da):13,592
Checksum:iA8BCA8D09F86404A
GO
Isoform 3 (identifier: Q7Z5A7-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-87: MAPSPRTGSR...TTRARPACVD → MYHHREWP

Note: No experimental confirmation available. Gene prediction based on EST data.

Show »
Length:53
Mass (Da):6,119
Checksum:iBE4717D812247D1D
GO

Sequence cautioni

The sequence AAD20061.1 differs from that shown. Reason: Erroneous initiation.
The sequence AAH39396.2 differs from that shown. Reason: Erroneous initiation.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 8787MAPSP…PACVD → MYHHREWP in isoform 3.
VSP_035191Add
BLAST
Alternative sequencei1 – 3838MAPSP…IAYCS → MQLLKALWALAGAALCCFLV LVIHAQFLKEG in isoform 2.
VSP_016068Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY325118 mRNA. Translation: AAP92410.1.
AF131851 mRNA. Translation: AAD20061.1. Different initiation.
AY358847 mRNA. Translation: AAQ89206.1.
AK123443 mRNA. Translation: BAG53905.1.
AK125256 mRNA. Translation: BAG54175.1.
AL096853, AL096843, Z83837 Genomic DNA. Translation: CAO03624.1.
Z83837, AL096843, AL096853 Genomic DNA. Translation: CAQ09100.1.
Z83837, AL096843 Genomic DNA. Translation: CAQ09101.1.
Z83837, AL096843, Z84468 Genomic DNA. Translation: CAQ09102.1.
Z84468, AL096843, Z83837 Genomic DNA. Translation: CAO03302.1.
BC039396 mRNA. Translation: AAH39396.2. Different initiation.
CCDSiCCDS46728.1. [Q7Z5A7-1]
CCDS46729.1. [Q7Z5A7-2]
RefSeqiNP_001076436.1. NM_001082967.2. [Q7Z5A7-1]
NP_056196.2. NM_015381.6. [Q7Z5A7-2]
UniGeneiHs.436854.

Genome annotation databases

EnsembliENST00000358295; ENSP00000351043; ENSG00000219438. [Q7Z5A7-2]
ENST00000402357; ENSP00000383933; ENSG00000219438. [Q7Z5A7-1]
ENST00000406880; ENSP00000385603; ENSG00000219438. [Q7Z5A7-3]
GeneIDi25817.
KEGGihsa:25817.
UCSCiuc003bim.4. human. [Q7Z5A7-1]
uc003bio.4. human. [Q7Z5A7-2]

Polymorphism databases

DMDMi205371754.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY325118 mRNA. Translation: AAP92410.1 .
AF131851 mRNA. Translation: AAD20061.1 . Different initiation.
AY358847 mRNA. Translation: AAQ89206.1 .
AK123443 mRNA. Translation: BAG53905.1 .
AK125256 mRNA. Translation: BAG54175.1 .
AL096853 , AL096843 , Z83837 Genomic DNA. Translation: CAO03624.1 .
Z83837 , AL096843 , AL096853 Genomic DNA. Translation: CAQ09100.1 .
Z83837 , AL096843 Genomic DNA. Translation: CAQ09101.1 .
Z83837 , AL096843 , Z84468 Genomic DNA. Translation: CAQ09102.1 .
Z84468 , AL096843 , Z83837 Genomic DNA. Translation: CAO03302.1 .
BC039396 mRNA. Translation: AAH39396.2 . Different initiation.
CCDSi CCDS46728.1. [Q7Z5A7-1 ]
CCDS46729.1. [Q7Z5A7-2 ]
RefSeqi NP_001076436.1. NM_001082967.2. [Q7Z5A7-1 ]
NP_056196.2. NM_015381.6. [Q7Z5A7-2 ]
UniGenei Hs.436854.

3D structure databases

ProteinModelPortali Q7Z5A7.
ModBasei Search...
MobiDBi Search...

Polymorphism databases

DMDMi 205371754.

Proteomic databases

PRIDEi Q7Z5A7.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000358295 ; ENSP00000351043 ; ENSG00000219438 . [Q7Z5A7-2 ]
ENST00000402357 ; ENSP00000383933 ; ENSG00000219438 . [Q7Z5A7-1 ]
ENST00000406880 ; ENSP00000385603 ; ENSG00000219438 . [Q7Z5A7-3 ]
GeneIDi 25817.
KEGGi hsa:25817.
UCSCi uc003bim.4. human. [Q7Z5A7-1 ]
uc003bio.4. human. [Q7Z5A7-2 ]

Organism-specific databases

CTDi 25817.
GeneCardsi GC22P048885.
HGNCi HGNC:21592. FAM19A5.
HPAi CAB025629.
HPA048727.
neXtProti NX_Q7Z5A7.
PharmGKBi PA134887312.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG43944.
HOVERGENi HBG081496.
InParanoidi Q7Z5A7.
OMAi CEMLPCL.
OrthoDBi EOG769ZM9.
PhylomeDBi Q7Z5A7.
TreeFami TF331749.

Miscellaneous databases

GeneWikii FAM19A5.
GenomeRNAii 25817.
NextBioi 47053.
PROi Q7Z5A7.

Gene expression databases

ArrayExpressi Q7Z5A7.
Bgeei Q7Z5A7.
CleanExi HS_FAM19A5.
Genevestigatori Q7Z5A7.

Family and domain databases

InterProi IPR020350. Chemokine-like_FAM19A2.
[Graphical view ]
Pfami PF12020. TAFA. 1 hit.
[Graphical view ]
ProDomi PD298472. Chemokine-like_2FAM19A2. 1 hit.
[Graphical view ] [Entries sharing at least one domain ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "TAFA: a novel secreted family with conserved cysteine residues and restricted expression in the brain."
    Tom Tang Y., Emtage P., Funk W.D., Hu T., Arterburn M., Park E.E., Rupp F.
    Genomics 83:727-734(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
  2. Mei G., Yu W., Gibbs R.A.
    Submitted (FEB-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Neuroblastoma and Subthalamic nucleus.
  5. "The DNA sequence of human chromosome 22."
    Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M.
    , Buck D., Burgess J., Burrill W.D., Burton J., Carder C., Carter N.P., Chen Y., Clark G., Clegg S.M., Cobley V.E., Cole C.G., Collier R.E., Connor R., Conroy D., Corby N.R., Coville G.J., Cox A.V., Davis J., Dawson E., Dhami P.D., Dockree C., Dodsworth S.J., Durbin R.M., Ellington A.G., Evans K.L., Fey J.M., Fleming K., French L., Garner A.A., Gilbert J.G.R., Goward M.E., Grafham D.V., Griffiths M.N.D., Hall C., Hall R.E., Hall-Tamlyn G., Heathcott R.W., Ho S., Holmes S., Hunt S.E., Jones M.C., Kershaw J., Kimberley A.M., King A., Laird G.K., Langford C.F., Leversha M.A., Lloyd C., Lloyd D.M., Martyn I.D., Mashreghi-Mohammadi M., Matthews L.H., Mccann O.T., Mcclay J., Mclaren S., McMurray A.A., Milne S.A., Mortimore B.J., Odell C.N., Pavitt R., Pearce A.V., Pearson D., Phillimore B.J.C.T., Phillips S.H., Plumb R.W., Ramsay H., Ramsey Y., Rogers L., Ross M.T., Scott C.E., Sehra H.K., Skuce C.D., Smalley S., Smith M.L., Soderlund C., Spragon L., Steward C.A., Sulston J.E., Swann R.M., Vaudin M., Wall M., Wallis J.M., Whiteley M.N., Willey D.L., Williams L., Williams S.A., Williamson H., Wilmer T.E., Wilming L., Wright C.L., Hubbard T., Bentley D.R., Beck S., Rogers J., Shimizu N., Minoshima S., Kawasaki K., Sasaki T., Asakawa S., Kudoh J., Shintani A., Shibuya K., Yoshizaki Y., Aoki N., Mitsuyama S., Roe B.A., Chen F., Chu L., Crabtree J., Deschamps S., Do A., Do T., Dorman A., Fang F., Fu Y., Hu P., Hua A., Kenton S., Lai H., Lao H.I., Lewis J., Lewis S., Lin S.-P., Loh P., Malaj E., Nguyen T., Pan H., Phan S., Qi S., Qian Y., Ray L., Ren Q., Shaull S., Sloan D., Song L., Wang Q., Wang Y., Wang Z., White J., Willingham D., Wu H., Yao Z., Zhan M., Zhang G., Chissoe S., Murray J., Miller N., Minx P., Fulton R., Johnson D., Bemis G., Bentley D., Bradshaw H., Bourne S., Cordes M., Du Z., Fulton L., Goela D., Graves T., Hawkins J., Hinds K., Kemp K., Latreille P., Layman D., Ozersky P., Rohlfing T., Scheet P., Walker C., Wamsley A., Wohldmann P., Pepin K., Nelson J., Korf I., Bedell J.A., Hillier L.W., Mardis E., Waterston R., Wilson R., Emanuel B.S., Shaikh T., Kurahashi H., Saitta S., Budarf M.L., McDermid H.E., Johnson A., Wong A.C.C., Morrow B.E., Edelmann L., Kim U.J., Shizuya H., Simon M.I., Dumanski J.P., Peyrard M., Kedra D., Seroussi E., Fransson I., Tapia I., Bruder C.E., O'Brien K.P., Wilkinson P., Bodenteich A., Hartman K., Hu X., Khan A.S., Lane L., Tilahun Y., Wright H.
    Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Hypothalamus.

Entry informationi

Entry nameiF19A5_HUMAN
AccessioniPrimary (citable) accession number: Q7Z5A7
Secondary accession number(s): A6NII9
, B0QZ13, B0QZ14, B0QZ15, O95902, Q5H9C4, Q6UWC9, Q8IXR8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 8, 2005
Last sequence update: September 2, 2008
Last modified: July 9, 2014
This is version 76 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi