Q7Z5A7 (F19A5_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 67.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein FAM19A5 Alternative name(s): Chemokine-like protein TAFA-5 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 132 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subcellular location | Membrane; Single-pass membrane protein Potential Ref.1. |
| Tissue specificity | |
| Sequence similarities | Belongs to the FAM19/TAFA family. |
| Sequence caution | The sequence AAD20061.1 differs from that shown. Reason: Erroneous initiation. The sequence AAH39396.2 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane Secreted |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | extracellular region Inferred from electronic annotation. Source: UniProtKB-SubCell integral to membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q7Z5A7-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q7Z5A7-2) The sequence of this isoform differs from the canonical sequence as follows: 1-38: MAPSPRTGSRQDATALPSMSSTFWAFMILASLLIAYCS → MQLLKALWALAGAALCCFLVLVIHAQFLKEG | ||||||
| Note: Contains a predicted signal peptide at positions 1-25. Ref.3 (AAQ89206) sequence is in conflict in positions: 11-23:AGAALCCFLVLVI->V. | ||||||
| Isoform 3 (identifier: Q7Z5A7-3) The sequence of this isoform differs from the canonical sequence as follows: 1-87: MAPSPRTGSR...TTRARPACVD → MYHHREWP | ||||||
| Note: No experimental confirmation available. Gene prediction based on EST data. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 132 | 132 | Protein FAM19A5 | PRO_0000042732 | |||||
Regions | |||||||||
| Transmembrane | 15 – 37 | 23 | Helical; Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 87 | 87 | MAPSP…PACVD → MYHHREWP in isoform 3. | VSP_035191 | |||||
| Alternative sequence | 1 – 38 | 38 | MAPSP…IAYCS → MQLLKALWALAGAALCCFLV LVIHAQFLKEG in isoform 2. | VSP_016068 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "TAFA: a novel secreted family with conserved cysteine residues and restricted expression in the brain." Tom Tang Y., Emtage P., Funk W.D., Hu T., Arterburn M., Park E.E., Rupp F. Genomics 83:727-734(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY, SUBCELLULAR LOCATION. |
| [2] | Mei G., Yu W., Gibbs R.A. Submitted (FEB-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [3] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Neuroblastoma and Subthalamic nucleus. |
| [5] | "The DNA sequence of human chromosome 22." Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M. Wright H.Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Hypothalamus. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY325118 mRNA. Translation: AAP92410.1. AF131851 mRNA. Translation: AAD20061.1. Different initiation. AY358847 mRNA. Translation: AAQ89206.1. AK123443 mRNA. Translation: BAG53905.1. AK125256 mRNA. Translation: BAG54175.1. AL096853, AL096843, Z83837 Genomic DNA. Translation: CAO03624.1. Z83837, AL096843, AL096853 Genomic DNA. Translation: CAQ09100.1. Z83837, AL096843 Genomic DNA. Translation: CAQ09101.1. Z83837, AL096843, Z84468 Genomic DNA. Translation: CAQ09102.1. Z84468, AL096843, Z83837 Genomic DNA. Translation: CAO03302.1. BC039396 mRNA. Translation: AAH39396.2. Different initiation. |
| IPI | IPI00385234. IPI00879246. IPI00879801. |
| RefSeq | NP_001076436.1. NM_001082967.1. NP_056196.2. NM_015381.5. |
| UniGene | Hs.436854. |
3D structure databases | |
| ProteinModelPortal | Q7Z5A7. |
| ModBase | Search... |
Polymorphism databases | |
| DMDM | 205371754. |
Proteomic databases | |
| PRIDE | Q7Z5A7. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000358295; ENSP00000351043; ENSG00000219438. ENST00000402357; ENSP00000383933; ENSG00000219438. ENST00000406880; ENSP00000385603; ENSG00000219438. |
| GeneID | 25817. |
| KEGG | hsa:25817. |
| UCSC | uc003bim.4. human. uc003bio.4. human. |
Organism-specific databases | |
| CTD | 25817. |
| GeneCards | GC22P048885. |
| HGNC | HGNC:21592. FAM19A5. |
| HPA | CAB025629. |
| neXtProt | NX_Q7Z5A7. |
| PharmGKB | PA134887312. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG43944. |
| HOVERGEN | HBG081496. |
| InParanoid | Q7Z5A7. |
| OMA | CEMLPCL. |
| OrthoDB | EOG4XPQHB. |
Gene expression databases | |
| ArrayExpress | Q7Z5A7. |
| Bgee | Q7Z5A7. |
| CleanEx | HS_FAM19A5. |
| Genevestigator | Q7Z5A7. |
Family and domain databases | |
| InterPro | IPR020350. Chemokine-like_FAM19A2. [Graphical view] |
| Pfam | PF12020. TAFA. 1 hit. [Graphical view] |
| ProDom | PD298472. Chemokine-like_2FAM19A2. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 25817. |
| NextBio | 47053. |
Entry information
| Entry name | F19A5_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q7Z5A7 Secondary accession number(s): A6NII9 Q8IXR8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 22 Human chromosome 22: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with
