Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein FAM19A5

Gene

FAM19A5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Protein FAM19A5
Alternative name(s):
Chemokine-like protein TAFA-5
Gene namesi
Name:FAM19A5
Synonyms:TAFA5
ORF Names:UNQ5208/PRO34524
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

EuPathDBiHostDB:ENSG00000219438.8
HGNCiHGNC:21592 FAM19A5
MIMi617499 gene
neXtProtiNX_Q7Z5A7

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei15 – 37HelicalSequence analysisAdd BLAST23

Keywords - Cellular componenti

Membrane, Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi25817
OpenTargetsiENSG00000219438
PharmGKBiPA134887312

Polymorphism and mutation databases

BioMutaiFAM19A5
DMDMi205371754

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000427321 – 132Protein FAM19A5Add BLAST132

Proteomic databases

PaxDbiQ7Z5A7
PeptideAtlasiQ7Z5A7
PRIDEiQ7Z5A7
ProteomicsDBi69275
69276 [Q7Z5A7-2]
69277 [Q7Z5A7-3]

PTM databases

iPTMnetiQ7Z5A7
PhosphoSitePlusiQ7Z5A7

Expressioni

Tissue specificityi

Isoform 2 is brain-specific.1 Publication

Gene expression databases

BgeeiENSG00000219438
CleanExiHS_FAM19A5
ExpressionAtlasiQ7Z5A7 baseline and differential
GenevisibleiQ7Z5A7 HS

Organism-specific databases

HPAiCAB025629

Interactioni

Protein-protein interaction databases

BioGridi117345, 17 interactors
STRINGi9606.ENSP00000383933

Structurei

3D structure databases

ProteinModelPortaliQ7Z5A7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the FAM19/TAFA family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IZKE Eukaryota
ENOG410YTJG LUCA
GeneTreeiENSGT00390000001768
HOVERGENiHBG081496
InParanoidiQ7Z5A7
OMAiCEMLPCL
PhylomeDBiQ7Z5A7
TreeFamiTF331749

Family and domain databases

InterProiView protein in InterPro
IPR020350 Chemokine-like_FAM19A2
PfamiView protein in Pfam
PF12020 TAFA, 1 hit
ProDomiView protein in ProDom or Entries sharing at least one domain
PD298472 Chemokine-like_2FAM19A2, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7Z5A7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPSPRTGSR QDATALPSMS STFWAFMILA SLLIAYCSQL AAGTCEIVTL
60 70 80 90 100
DRDSSQPRRT IARQTARCAC RKGQIAGTTR ARPACVDARI IKTKQWCDML
110 120 130
PCLEGEGCDL LINRSGWTCT QPGGRIKTTT VS
Length:132
Mass (Da):14,301
Last modified:September 2, 2008 - v2
Checksum:i16BFE9F574FBB066
GO
Isoform 2 (identifier: Q7Z5A7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MAPSPRTGSRQDATALPSMSSTFWAFMILASLLIAYCS → MQLLKALWALAGAALCCFLVLVIHAQFLKEG

Note: Contains a predicted signal peptide at positions 1-25.Curated
Show »
Length:125
Mass (Da):13,592
Checksum:iA8BCA8D09F86404A
GO
Isoform 3 (identifier: Q7Z5A7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-87: MAPSPRTGSR...TTRARPACVD → MYHHREWP

Note: No experimental confirmation available. Gene prediction based on EST data.
Show »
Length:53
Mass (Da):6,119
Checksum:iBE4717D812247D1D
GO

Sequence cautioni

The sequence AAD20061 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAH39396 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 2 (identifier: Q7Z5A7-2)
Sequence conflicti11 – 23AGAAL…LVLVI → V in AAQ89206 (PubMed:12975309).CuratedAdd BLAST13

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0351911 – 87MAPSP…PACVD → MYHHREWP in isoform 3. CuratedAdd BLAST87
Alternative sequenceiVSP_0160681 – 38MAPSP…IAYCS → MQLLKALWALAGAALCCFLV LVIHAQFLKEG in isoform 2. 3 PublicationsAdd BLAST38

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY325118 mRNA Translation: AAP92410.1
AF131851 mRNA Translation: AAD20061.1 Different initiation.
AY358847 mRNA Translation: AAQ89206.1
AK123443 mRNA Translation: BAG53905.1
AK125256 mRNA Translation: BAG54175.1
AL096843 Genomic DNA No translation available.
AL096853 Genomic DNA No translation available.
Z83837 Genomic DNA No translation available.
Z84468 Genomic DNA No translation available.
BC039396 mRNA Translation: AAH39396.2 Different initiation.
CCDSiCCDS46728.1 [Q7Z5A7-1]
CCDS46729.1 [Q7Z5A7-2]
RefSeqiNP_001076436.1, NM_001082967.2 [Q7Z5A7-1]
NP_056196.2, NM_015381.6 [Q7Z5A7-2]
UniGeneiHs.436854

Genome annotation databases

EnsembliENST00000358295; ENSP00000351043; ENSG00000219438 [Q7Z5A7-2]
ENST00000402357; ENSP00000383933; ENSG00000219438 [Q7Z5A7-1]
ENST00000406880; ENSP00000385603; ENSG00000219438 [Q7Z5A7-3]
GeneIDi25817
KEGGihsa:25817
UCSCiuc003bim.6 human [Q7Z5A7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiF19A5_HUMAN
AccessioniPrimary (citable) accession number: Q7Z5A7
Secondary accession number(s): A6NII9
, B0QZ13, B0QZ14, B0QZ15, O95902, Q5H9C4, Q6UWC9, Q8IXR8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 8, 2005
Last sequence update: September 2, 2008
Last modified: June 20, 2018
This is version 99 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health