Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Spermatogenesis-associated protein 21

Gene

SPATA21

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Involved in the differentiation of haploid spermatids.By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Calcium bindingi268 – 27912PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

Complete GO annotation...

Keywords - Ligandi

Calcium, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Spermatogenesis-associated protein 21
Gene namesi
Name:SPATA21
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:28026. SPATA21.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142670886.

Polymorphism and mutation databases

BioMutaiSPATA21.
DMDMi215274212.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 469469Spermatogenesis-associated protein 21PRO_0000330686Add
BLAST

Proteomic databases

EPDiQ7Z572.
PaxDbiQ7Z572.
PRIDEiQ7Z572.

PTM databases

PhosphoSiteiQ7Z572.

Expressioni

Gene expression databases

BgeeiQ7Z572.
CleanExiHS_SPATA21.
ExpressionAtlasiQ7Z572. baseline and differential.
GenevisibleiQ7Z572. HS.

Organism-specific databases

HPAiHPA032079.
HPA032080.

Interactioni

Protein-protein interaction databases

BioGridi131941. 1 interaction.
STRINGi9606.ENSP00000335612.

Structurei

3D structure databases

ProteinModelPortaliQ7Z572.
SMRiQ7Z572. Positions 199-342.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini255 – 29036EF-handPROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili198 – 22528Sequence analysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi114 – 17057Pro-richAdd
BLAST

Sequence similaritiesi

Contains 1 EF-hand domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG0027. Eukaryota.
COG5126. LUCA.
GeneTreeiENSGT00530000063748.
HOGENOMiHOG000154401.
HOVERGENiHBG107135.
InParanoidiQ7Z572.
OMAiETHPAPG.
PhylomeDBiQ7Z572.
TreeFamiTF328393.

Family and domain databases

Gene3Di1.10.238.10. 1 hit.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
[Graphical view]
SMARTiSM00054. EFh. 1 hit.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
PROSITEiPS00018. EF_HAND_1. 1 hit.
PS50222. EF_HAND_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7Z572-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDNRNTQMYT EEEKTVNPFL PSTPGPKKAK GGGEAVETHP APGPLPPPEV
60 70 80 90 100
RDIGERREPD RAQQQPQKPA VAAGTQSLGN FRQGFMKCLL EVEKMEASHR
110 120 130 140 150
RASKARSQTA QKSPRTLTPV PTSAPSLPQT PASVPASGPS WARLPAPGPE
160 170 180 190 200
PAPMGAPVPT SMPCPVLLGP ALDLGWRRME LLHQSSERTL SYAKARQEPE
210 220 230 240 250
EQSLQKLYQN REKSEEQLTL KQEEAFRSYF EIFNGPGEVD AQSLKNILLL
260 270 280 290 300
MGFSVTLAQV EDALMSADVN GDGRVDFKDF LAVMTDTRRF FCSVEQNALS
310 320 330 340 350
DMAPHNPHTL LFEILSLLVE MLALPEAVLE EITNYYQKKL KEGTCKAQEM
360 370 380 390 400
EAAVGRLRLQ KLPYNPQQEE SSEVPERKVL SILSRLKQQN YAPNLQSPYA
410 420 430 440 450
QVPCILLCPQ LDKKMVRRQP SNHYALDQCT PPGLDPDIRS PFFQSGSQGN
460
REHNSDSRKW LSSVPARTH
Length:469
Mass (Da):52,207
Last modified:November 25, 2008 - v3
Checksum:i9F34A50331774C5D
GO
Isoform 2 (identifier: Q7Z572-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: MDNRNTQMYTEEEKTVNPFLPSTPGPKKAKGGGEAVETHPAPGPLPPP → MAQPGAVEHACHPSTLGGQGGGSLE

Note: No experimental confirmation available.
Show »
Length:446
Mass (Da):49,484
Checksum:i583162496EB1BC90
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti417 – 4171R → C in AAI50599 (PubMed:15489334).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti24 – 241P → S in a breast cancer sample; somatic mutation. 1 Publication
VAR_042711
Natural varianti53 – 531I → L.
Corresponds to variant rs12087671 [ dbSNP | Ensembl ].
VAR_042712
Natural varianti184 – 1841Q → R.
Corresponds to variant rs4661746 [ dbSNP | Ensembl ].
VAR_042713
Natural varianti255 – 2551V → L.1 Publication
Corresponds to variant rs525409 [ dbSNP | Ensembl ].
VAR_042714
Natural varianti390 – 3901N → K.
Corresponds to variant rs12133574 [ dbSNP | Ensembl ].
VAR_042715

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4848MDNRN…PLPPP → MAQPGAVEHACHPSTLGGQG GGSLE in isoform 2. 1 PublicationVSP_053865Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY327405 mRNA. Translation: AAP92797.1.
AL358794 Genomic DNA. Translation: CAH73778.1.
CH471167 Genomic DNA. Translation: EAW51779.1.
BC150598 mRNA. Translation: AAI50599.1.
CCDSiCCDS172.1. [Q7Z572-1]
RefSeqiNP_940948.1. NM_198546.1. [Q7Z572-1]
XP_011539722.1. XM_011541420.1. [Q7Z572-2]
UniGeneiHs.705501.

Genome annotation databases

EnsembliENST00000335496; ENSP00000335612; ENSG00000187144. [Q7Z572-1]
ENST00000540400; ENSP00000440046; ENSG00000187144. [Q7Z572-2]
GeneIDi374955.
KEGGihsa:374955.
UCSCiuc001ayn.3. human. [Q7Z572-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY327405 mRNA. Translation: AAP92797.1.
AL358794 Genomic DNA. Translation: CAH73778.1.
CH471167 Genomic DNA. Translation: EAW51779.1.
BC150598 mRNA. Translation: AAI50599.1.
CCDSiCCDS172.1. [Q7Z572-1]
RefSeqiNP_940948.1. NM_198546.1. [Q7Z572-1]
XP_011539722.1. XM_011541420.1. [Q7Z572-2]
UniGeneiHs.705501.

3D structure databases

ProteinModelPortaliQ7Z572.
SMRiQ7Z572. Positions 199-342.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi131941. 1 interaction.
STRINGi9606.ENSP00000335612.

PTM databases

PhosphoSiteiQ7Z572.

Polymorphism and mutation databases

BioMutaiSPATA21.
DMDMi215274212.

Proteomic databases

EPDiQ7Z572.
PaxDbiQ7Z572.
PRIDEiQ7Z572.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000335496; ENSP00000335612; ENSG00000187144. [Q7Z572-1]
ENST00000540400; ENSP00000440046; ENSG00000187144. [Q7Z572-2]
GeneIDi374955.
KEGGihsa:374955.
UCSCiuc001ayn.3. human. [Q7Z572-1]

Organism-specific databases

CTDi374955.
GeneCardsiSPATA21.
H-InvDBHIX0023603.
HGNCiHGNC:28026. SPATA21.
HPAiHPA032079.
HPA032080.
neXtProtiNX_Q7Z572.
PharmGKBiPA142670886.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0027. Eukaryota.
COG5126. LUCA.
GeneTreeiENSGT00530000063748.
HOGENOMiHOG000154401.
HOVERGENiHBG107135.
InParanoidiQ7Z572.
OMAiETHPAPG.
PhylomeDBiQ7Z572.
TreeFamiTF328393.

Miscellaneous databases

GenomeRNAii374955.
NextBioi100348.
PROiQ7Z572.

Gene expression databases

BgeeiQ7Z572.
CleanExiHS_SPATA21.
ExpressionAtlasiQ7Z572. baseline and differential.
GenevisibleiQ7Z572. HS.

Family and domain databases

Gene3Di1.10.238.10. 1 hit.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
[Graphical view]
SMARTiSM00054. EFh. 1 hit.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
PROSITEiPS00018. EF_HAND_1. 1 hit.
PS50222. EF_HAND_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Shan Y.X., Yu L.
    Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT LEU-255.
    Tissue: Testis.
  5. Cited for: VARIANT [LARGE SCALE ANALYSIS] SER-24.

Entry informationi

Entry nameiSPT21_HUMAN
AccessioniPrimary (citable) accession number: Q7Z572
Secondary accession number(s): B9EK40, F5GXP5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: November 25, 2008
Last modified: May 11, 2016
This is version 110 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.