SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q7Z553

- MDGA2_HUMAN

UniProt

Q7Z553 - MDGA2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

MAM domain-containing glycosylphosphatidylinositol anchor protein 2

Gene
MDGA2, MAMDC1, UNQ8188/PRO23197
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Functioni

May be involved in cell-cell interactions By similarity.

GO - Biological processi

  1. spinal cord motor neuron differentiation Source: HGNC
Complete GO annotation...

Protein family/group databases

MEROPSiI43.001.

Names & Taxonomyi

Protein namesi
Recommended name:
MAM domain-containing glycosylphosphatidylinositol anchor protein 2
Alternative name(s):
MAM domain-containing protein 1
Gene namesi
Name:MDGA2
Synonyms:MAMDC1
ORF Names:UNQ8188/PRO23197
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 14

Organism-specific databases

HGNCiHGNC:19835. MDGA2.

Subcellular locationi

Cell membrane; Lipid-anchorGPI-anchor Reviewed prediction

GO - Cellular componenti

  1. anchored component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162395090.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2525 Reviewed predictionAdd
BLAST
Chaini26 – 931906MAM domain-containing glycosylphosphatidylinositol anchor protein 2PRO_0000014859Add
BLAST
Propeptidei932 – 95625Removed in mature form Reviewed predictionPRO_0000292043Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi62 ↔ 110 By similarity
Glycosylationi92 – 921N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi159 ↔ 216 By similarity
Glycosylationi213 – 2131N-linked (GlcNAc...) Reviewed prediction
Glycosylationi237 – 2371N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi264 ↔ 310 By similarity
Disulfide bondi359 ↔ 417 By similarity
Glycosylationi434 – 4341N-linked (GlcNAc...) Reviewed prediction
Glycosylationi443 – 4431N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi465 ↔ 515 By similarity
Glycosylationi504 – 5041N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi561 ↔ 611 By similarity
Glycosylationi610 – 6101N-linked (GlcNAc...) Reviewed prediction
Glycosylationi703 – 7031N-linked (GlcNAc...) Reviewed prediction
Lipidationi931 – 9311GPI-anchor amidated aspartate Reviewed prediction

Keywords - PTMi

Disulfide bond, Glycoprotein, GPI-anchor, Lipoprotein

Proteomic databases

PaxDbiQ7Z553.
PRIDEiQ7Z553.

PTM databases

PhosphoSiteiQ7Z553.

Expressioni

Tissue specificityi

Detected in Leydig cells, syncytiotrophoblast, duodenal villi epithelial cells and neutrophils from kidney and cutaneous squamous cell carcinoma (at protein level).1 Publication

Gene expression databases

ArrayExpressiQ7Z553.
BgeeiQ7Z553.
CleanExiHS_MDGA2.
GenevestigatoriQ7Z553.

Organism-specific databases

HPAiHPA003084.

Interactioni

Subunit structurei

Interacts (through the Ig-like domains) with NLGN2 By similarity.

Protein-protein interaction databases

BioGridi127785. 1 interaction.
STRINGi9606.ENSP00000382178.

Structurei

3D structure databases

ProteinModelPortaliQ7Z553.
SMRiQ7Z553. Positions 11-618, 748-921.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini27 – 127101Ig-like 1Add
BLAST
Domaini134 – 23299Ig-like 2Add
BLAST
Domaini242 – 32887Ig-like 3Add
BLAST
Domaini340 – 43697Ig-like 4Add
BLAST
Domaini442 – 53392Ig-like 5Add
BLAST
Domaini540 – 62788Ig-like 6Add
BLAST
Domaini638 – 739102Fibronectin type-IIIAdd
BLAST
Domaini746 – 921176MAMAdd
BLAST

Sequence similaritiesi

Contains 1 MAM domain.

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal

Phylogenomic databases

eggNOGiNOG126204.
HOGENOMiHOG000015243.
HOVERGENiHBG052403.
InParanoidiQ7Z553.
OMAiKQDLATK.
OrthoDBiEOG7NCV2N.
PhylomeDBiQ7Z553.
TreeFamiTF330345.

Family and domain databases

Gene3Di2.60.40.10. 7 hits.
InterProiIPR008985. ConA-like_lec_gl_sf.
IPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR000998. MAM_dom.
[Graphical view]
PfamiPF07679. I-set. 3 hits.
PF00629. MAM. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
SM00408. IGc2. 4 hits.
SM00137. MAM. 1 hit.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 1 hit.
SSF49899. SSF49899. 1 hit.
PROSITEiPS50853. FN3. 1 hit.
PS50835. IG_LIKE. 6 hits.
PS50060. MAM_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q7Z553-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MDLLYGLVWL LTVLLEGISG QGVYAPPTVR IVHSGLACNI EEERYSERVY    50
TIREGETLEL TCLVTGHPRP QIRWTKTAGS ASDRFQDSSV FNETLRITNI 100
QRHQGGRYYC KAENGLGSPA IKSIRVDVYY LDDPVVTVHQ SIGEAKEQFY 150
YERTVFLRCV ANSNPPVRYS WRRGQEVLLQ GSDKGVEIYE PFFTQGETKI 200
LKLKNLRPQD YANYSCIASV RNVCNIPDKM VSFRLSNKTA SPSIKLLVDD 250
PIVVNPGEAI TLVCVTTGGE PAPSLTWVRS FGTLPEKTVL NGGTLTIPAI 300
TSDDAGTYSC IANNNVGNPA KKSTNIIVRA LKKGRFWITP DPYHKDDNIQ 350
IGREVKISCQ VEAVPSEELT FSWFKNGRPL RSSERMVITQ TDPDVSPGTT 400
NLDIIDLKFT DFGTYTCVAS LKGGGISDIS IDVNISSSTV PPNLTVPQEK 450
SPLVTREGDT IELQCQVTGK PKPIILWSRA DKEVAMPDGS MQMESYDGTL 500
RIVNVSREMS GMYRCQTSQY NGFNVKPREA LVQLIVQYPP AVEPAFLEIR 550
QGQDRSVTMS CRVLRAYPIR VLTYEWRLGN KLLRTGQFDS QEYTEYAVKS 600
LSNENYGVYN CSIINEAGAG RCSFLVTGKA YAPEFYYDTY NPVWQNRHRV 650
YSYSLQWTQM NPDAVDRIVA YRLGIRQAGQ QRWWEQEIKI NGNIQKGELI 700
TYNLTELIKP EAYEVRLTPL TKFGEGDSTI RVIKYSAPVN PHLREFHCGF 750
EDGNICLFTQ DDTDNFDWTK QSTATRNTKY TPNTGPNADR SGSKEGFYMY 800
IETSRPRLEG EKARLLSPVF SIAPKNPYGP TNTAYCFSFF YHMYGQHIGV 850
LNVYLRLKGQ TTIENPLWSS SGNKGQRWNE AHVNIYPITS FQLIFEGIRG 900
PGIEGDIAID DVSIAEGECA KQDLATKNSV DGAVGILVHI WLFPIIVLIS 950
ILSPRR 956
Length:956
Mass (Da):107,436
Last modified:April 13, 2004 - v2
Checksum:i6B70534BD35489B9
GO
Isoform 2 (identifier: Q7Z553-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-229: Missing.

Show »
Length:727
Mass (Da):81,364
Checksum:i24465F56F955F261
GO
Isoform 3 (identifier: Q7Z553-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSVWSAGLLRSARRRRRGRTDGRRFLLRRAVPGHLGLARARVERAWLAAGLLKVPLRTPWAGYVHVHVKM

Note: No experimental confirmation available.

Show »
Length:1,025
Mass (Da):115,310
Checksum:iFC5403A869640428
GO

Sequence cautioni

The sequence AAP97010.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti608 – 6081V → F.
Corresponds to variant rs12590500 [ dbSNP | Ensembl ].
VAR_059400

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 229229Missing in isoform 2. VSP_042468Add
BLAST
Alternative sequencei1 – 11M → MSVWSAGLLRSARRRRRGRT DGRRFLLRRAVPGHLGLARA RVERAWLAAGLLKVPLRTPW AGYVHVHVKM in isoform 3. VSP_045240

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti19 – 246SGQGVY → EHLVIQ in AAQ88492. 1 Publication
Sequence conflicti71 – 711Missing in AAQ88492. 1 Publication
Sequence conflicti457 – 4571E → Q in AK309211. 1 Publication
Sequence conflicti479 – 4791R → K in AK309211. 1 Publication
Sequence conflicti504 – 5041N → S in AK309211. 1 Publication
Sequence conflicti554 – 5541D → N in AAQ88492. 1 Publication
Sequence conflicti930 – 9301V → I in AK309211. 1 Publication
Isoform 3 (identifier: Q7Z553-3)
Sequence conflicti50 – 501G → S in AK309211. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY369208 mRNA. Translation: AAQ73312.1.
AY358125 mRNA. Translation: AAQ88492.1.
AK309211 mRNA. No translation available.
AL079306 Genomic DNA. No translation available.
AL157792 Genomic DNA. No translation available.
AL162551 Genomic DNA. No translation available.
AL358832 Genomic DNA. No translation available.
AL359951 Genomic DNA. No translation available.
AL591771 Genomic DNA. No translation available.
AY328482 mRNA. Translation: AAP97010.1. Different initiation.
CCDSiCCDS41948.1. [Q7Z553-2]
CCDS45098.3. [Q7Z553-1]
RefSeqiNP_001106970.3. NM_001113498.2. [Q7Z553-1]
NP_878250.2. NM_182830.4. [Q7Z553-2]
UniGeneiHs.436380.

Genome annotation databases

EnsembliENST00000357362; ENSP00000349925; ENSG00000139915. [Q7Z553-2]
ENST00000399232; ENSP00000382178; ENSG00000139915. [Q7Z553-1]
ENST00000426342; ENSP00000405456; ENSG00000139915. [Q7Z553-2]
GeneIDi161357.
KEGGihsa:161357.
UCSCiuc001wwi.4. human. [Q7Z553-1]
uc010ani.3. human. [Q7Z553-2]

Polymorphism databases

DMDMi46403175.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY369208 mRNA. Translation: AAQ73312.1 .
AY358125 mRNA. Translation: AAQ88492.1 .
AK309211 mRNA. No translation available.
AL079306 Genomic DNA. No translation available.
AL157792 Genomic DNA. No translation available.
AL162551 Genomic DNA. No translation available.
AL358832 Genomic DNA. No translation available.
AL359951 Genomic DNA. No translation available.
AL591771 Genomic DNA. No translation available.
AY328482 mRNA. Translation: AAP97010.1 . Different initiation.
CCDSi CCDS41948.1. [Q7Z553-2 ]
CCDS45098.3. [Q7Z553-1 ]
RefSeqi NP_001106970.3. NM_001113498.2. [Q7Z553-1 ]
NP_878250.2. NM_182830.4. [Q7Z553-2 ]
UniGenei Hs.436380.

3D structure databases

ProteinModelPortali Q7Z553.
SMRi Q7Z553. Positions 11-618, 748-921.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 127785. 1 interaction.
STRINGi 9606.ENSP00000382178.

Protein family/group databases

MEROPSi I43.001.

PTM databases

PhosphoSitei Q7Z553.

Polymorphism databases

DMDMi 46403175.

Proteomic databases

PaxDbi Q7Z553.
PRIDEi Q7Z553.

Protocols and materials databases

DNASUi 161357.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000357362 ; ENSP00000349925 ; ENSG00000139915 . [Q7Z553-2 ]
ENST00000399232 ; ENSP00000382178 ; ENSG00000139915 . [Q7Z553-1 ]
ENST00000426342 ; ENSP00000405456 ; ENSG00000139915 . [Q7Z553-2 ]
GeneIDi 161357.
KEGGi hsa:161357.
UCSCi uc001wwi.4. human. [Q7Z553-1 ]
uc010ani.3. human. [Q7Z553-2 ]

Organism-specific databases

CTDi 161357.
GeneCardsi GC14M047309.
H-InvDB HIX0026644.
HGNCi HGNC:19835. MDGA2.
HPAi HPA003084.
MIMi 611128. gene.
neXtProti NX_Q7Z553.
PharmGKBi PA162395090.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG126204.
HOGENOMi HOG000015243.
HOVERGENi HBG052403.
InParanoidi Q7Z553.
OMAi KQDLATK.
OrthoDBi EOG7NCV2N.
PhylomeDBi Q7Z553.
TreeFami TF330345.

Miscellaneous databases

ChiTaRSi MDGA2. human.
GenomeRNAii 161357.
NextBioi 35535227.
PROi Q7Z553.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q7Z553.
Bgeei Q7Z553.
CleanExi HS_MDGA2.
Genevestigatori Q7Z553.

Family and domain databases

Gene3Di 2.60.40.10. 7 hits.
InterProi IPR008985. ConA-like_lec_gl_sf.
IPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR000998. MAM_dom.
[Graphical view ]
Pfami PF07679. I-set. 3 hits.
PF00629. MAM. 1 hit.
[Graphical view ]
SMARTi SM00409. IG. 1 hit.
SM00408. IGc2. 4 hits.
SM00137. MAM. 1 hit.
[Graphical view ]
SUPFAMi SSF49265. SSF49265. 1 hit.
SSF49899. SSF49899. 1 hit.
PROSITEi PS50853. FN3. 1 hit.
PS50835. IG_LIKE. 6 hits.
PS50060. MAM_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Huang C.Q., Wu S.L., Liu S.
    Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Thalamus.
  3. "The DNA sequence and analysis of human chromosome 14."
    Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H.
    , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
    Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 19-956 (ISOFORM 1).
  5. "Cloning and characterization of a novel human MAMDC1 gene."
    Shan Y.X., Yu L.
    Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 335-956 (ISOFORMS 1/2).
  6. Cited for: TISSUE SPECIFICITY.

Entry informationi

Entry nameiMDGA2_HUMAN
AccessioniPrimary (citable) accession number: Q7Z553
Secondary accession number(s): F6W3S7, J3KPX6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 13, 2004
Last sequence update: April 13, 2004
Last modified: July 9, 2014
This is version 118 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi