Q7Z553 (MDGA2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 106.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: MAM domain-containing glycosylphosphatidylinositol anchor protein 2 Alternative name(s): MAM domain-containing protein 1 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 956 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | May involved in cell-cell interactions By similarity. |
| Subcellular location | Cell membrane; Lipid-anchor › GPI-anchor Potential. |
| Sequence similarities | Contains 6 Ig-like (immunoglobulin-like) domains. Contains 1 MAM domain. |
| Sequence caution | The sequence AAP97010.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Immunoglobulin domain Repeat Signal |
| PTM | Disulfide bond GPI-anchor Glycoprotein Lipoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | spinal cord motor neuron differentiation Inferred from sequence or structural similarity PubMed 15019943. Source: HGNC |
| Cellular_component | anchored to membrane Inferred from electronic annotation. Source: UniProtKB-KW plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q7Z553-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q7Z553-2) The sequence of this isoform differs from the canonical sequence as follows: 1-229: Missing. | ||||||
| Isoform 3 (identifier: Q7Z553-3) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MSVWSAGLLRSARRRRRGRTDGRRFLLRRAVPGHLGLARARVERAWLAAGLLKVPLRTPWAGYVHVHVKM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 25 | 25 | Potential | ||||||||
| Chain | 26 – 931 | 906 | MAM domain-containing glycosylphosphatidylinositol anchor protein 2 | PRO_0000014859 | |||||||
| Propeptide | 932 – 956 | 25 | Removed in mature form Potential | PRO_0000292043 | |||||||
Regions | |||||||||||
| Domain | 27 – 127 | 101 | Ig-like 1 | ||||||||
| Domain | 134 – 232 | 99 | Ig-like 2 | ||||||||
| Domain | 242 – 328 | 87 | Ig-like 3 | ||||||||
| Domain | 340 – 436 | 97 | Ig-like 4 | ||||||||
| Domain | 442 – 533 | 92 | Ig-like 5 | ||||||||
| Domain | 540 – 627 | 88 | Ig-like 6 | ||||||||
| Domain | 746 – 921 | 176 | MAM | ||||||||
Amino acid modifications | |||||||||||
| Lipidation | 931 | 1 | GPI-anchor amidated aspartate Potential | ||||||||
| Glycosylation | 92 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 213 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 237 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 434 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 443 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 504 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 610 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 703 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 62 ↔ 110 | By similarity | |||||||||
| Disulfide bond | 159 ↔ 216 | By similarity | |||||||||
| Disulfide bond | 264 ↔ 310 | By similarity | |||||||||
| Disulfide bond | 359 ↔ 417 | By similarity | |||||||||
| Disulfide bond | 465 ↔ 515 | By similarity | |||||||||
| Disulfide bond | 561 ↔ 611 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 229 | 229 | Missing in isoform 2. | VSP_042468 | |||||||
| Alternative sequence | 1 | 1 | M → MSVWSAGLLRSARRRRRGRT DGRRFLLRRAVPGHLGLARA RVERAWLAAGLLKVPLRTPW AGYVHVHVKM in isoform 3. | VSP_045240 | |||||||
| Natural variant | 608 | 1 | V → F. Corresponds to variant rs12590500 [ dbSNP | Ensembl ]. | VAR_059400 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 19 – 24 | 6 | SGQGVY → EHLVIQ in AAQ88492. Ref.3 | ||||||||
| Sequence conflict | 71 | 1 | Missing in AAQ88492. Ref.3 | ||||||||
| Sequence conflict | 457 | 1 | E → Q in AK309211. Ref.2 | ||||||||
| Sequence conflict | 479 | 1 | R → K in AK309211. Ref.2 | ||||||||
| Sequence conflict | 504 | 1 | N → S in AK309211. Ref.2 | ||||||||
| Sequence conflict | 554 | 1 | D → N in AAQ88492. Ref.3 | ||||||||
| Sequence conflict | 930 | 1 | V → I in AK309211. Ref.2 | ||||||||
| Isoform 3: | |||||||||||
| Sequence conflict | 50 | 1 | G → S in AK309211. Ref.2 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | Huang C.Q., Wu S.L., Liu S. Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Thalamus. |
| [3] | "The DNA sequence and analysis of human chromosome 14." Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. Weissenbach J.Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 19-956 (ISOFORM 1). |
| [5] | "Cloning and characterization of a novel human MAMDC1 gene." Shan Y.X., Yu L. Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 335-956 (ISOFORMS 1/2). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY369208 mRNA. Translation: AAQ73312.1. AY358125 mRNA. Translation: AAQ88492.1. AK309211 mRNA. No translation available. AL079306 Genomic DNA. No translation available. AL157792 Genomic DNA. No translation available. AL162551 Genomic DNA. No translation available. AL358832 Genomic DNA. No translation available. AL359951 Genomic DNA. No translation available. AL591771 Genomic DNA. No translation available. AY328482 mRNA. Translation: AAP97010.1. Different initiation. |
| IPI | IPI00337351. |
| RefSeq | NP_001106970.2. NM_001113498.2. NP_878250.2. NM_182830.3. |
| UniGene | Hs.436380. |
3D structure databases | |
| ProteinModelPortal | Q7Z553. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000382178. |
Protein family/group databases | |
| MEROPS | I43.001. |
PTM databases | |
| PhosphoSite | Q7Z553. |
Polymorphism databases | |
| DMDM | 46403175. |
Proteomic databases | |
| PaxDb | Q7Z553. |
| PRIDE | Q7Z553. |
Protocols and materials databases | |
| DNASU | 161357. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000357362; ENSP00000349925; ENSG00000139915. ENST00000399232; ENSP00000382178; ENSG00000139915. ENST00000426342; ENSP00000405456; ENSG00000139915. ENST00000439988; ENSP00000400011; ENSG00000139915. |
| GeneID | 161357. |
| KEGG | hsa:161357. |
| UCSC | uc001wwi.4. human. |
Organism-specific databases | |
| CTD | 161357. |
| GeneCards | GC14M047309. |
| H-InvDB | HIX0026644. |
| HGNC | HGNC:19835. MDGA2. |
| HPA | HPA003084. |
| MIM | 611128. gene. |
| neXtProt | NX_Q7Z553. |
| PharmGKB | PA162395090. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG126204. |
| HOGENOM | HOG000015243. |
| HOVERGEN | HBG052403. |
| InParanoid | Q7Z553. |
| OMA | KQDLATK. |
| OrthoDB | EOG45MN4K. |
Gene expression databases | |
| ArrayExpress | Q7Z553. |
| Bgee | Q7Z553. |
| CleanEx | HS_MDGA2. |
| Genevestigator | Q7Z553. |
| GermOnline | ENSG00000139915. Homo sapiens. |
Family and domain databases | |
| Gene3D | 2.60.40.10. 7 hits. |
| InterPro | IPR008985. ConA-like_lec_gl_sf. IPR003961. Fibronectin_type3. IPR007110. Ig-like_dom. IPR013783. Ig-like_fold. IPR013098. Ig_I-set. IPR003599. Ig_sub. IPR003598. Ig_sub2. IPR000998. MAM_dom. [Graphical view] |
| Pfam | PF07679. I-set. 3 hits. PF00629. MAM. 1 hit. [Graphical view] |
| SMART | SM00409. IG. 1 hit. SM00408. IGc2. 4 hits. SM00137. MAM. 1 hit. [Graphical view] |
| SUPFAM | SSF49899. ConA_like_lec_gl. 1 hit. SSF49265. FN_III-like. 1 hit. |
| PROSITE | PS50835. IG_LIKE. 6 hits. PS00740. MAM_1. False negative. PS50060. MAM_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | MDGA2. human. |
| GenomeRNAi | 161357. |
| NextBio | 35535227. |
| SOURCE | Search... |
Entry information
| Entry name | MDGA2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q7Z553 Secondary accession number(s): F6W3S7, J3KPX6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 14 Human chromosome 14: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
