Q7Z4W2 (LYZL2_HUMAN)
Reviewed,
UniProtKB/Swiss-Prot
Last modified
August 10, 2010.
Version 58.
History...
Names and origin
| Protein names | Recommended name: Lysozyme-like protein 2 Short name=Lysozyme-2 EC=3.2.1.17 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 148 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Catalytic activity | Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins. |
| Subunit structure | Monomer Probable. |
| Subcellular location | Secreted Probable. |
| Tissue specificity | Expressed in testis, epididymis and placenta. Ref.1 |
| Sequence similarities | Belongs to the glycosyl hydrolase 22 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal |
| Molecular function | Glycosidase Hydrolase |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | cell wall macromolecule catabolic process Inferred from electronic annotation. Source: InterPro |
| Cellular component | extracellular region Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | lysozyme activity Inferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q7Z4W2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q7Z4W2-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MQDAPLSCLSPTKWSSVSSADSTEKSASAAGTRNLPFQFCLRQALRM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 19 | 19 | Potential | ||||||||
| Chain | 20 – 148 | 129 | Lysozyme-like protein 2 | PRO_0000240637 | |||||||
Sites | |||||||||||
| Active site | 54 | 1 | By similarity | ||||||||
| Active site | 71 | 1 | By similarity | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 58 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 25 ↔ 145 | By similarity | |||||||||
| Disulfide bond | 49 ↔ 133 | By similarity | |||||||||
| Disulfide bond | 83 ↔ 98 | By similarity | |||||||||
| Disulfide bond | 94 ↔ 112 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 | 1 | M → MQDAPLSCLSPTKWSSVSSA DSTEKSASAAGTRNLPFQFC LRQALRM in isoform 2. | VSP_019717 | |||||||
| Natural variant | 144 | 1 | D → G. [dbSNP:rs1054570] Ref.1 | VAR_026818 | |||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and characterization of three novel lysozyme-like genes, predominantly expressed in the male reproductive system of humans, belonging to the c-type lysozyme/alpha-lactalbumin family." Zhang K., Gao R., Zhang H., Cai X., Shen C., Wu C., Zhao S., Yu L. Biol. Reprod. 73:1064-1071(2005) [PubMed: 16014814] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT GLY-144, TISSUE SPECIFICITY. Tissue: Testis. |
| [2] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed: 15164054] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Testis. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF139543 mRNA. Translation: AAP97272.1. AL451107 Genomic DNA. Translation: CAH70607.1. BC066294 mRNA. Translation: AAH66294.1. |
| IPI | IPI00054693. IPI00742810. |
| RefSeq | NP_898881.2. |
| UniGene | Hs.522610. |
3D structure databases | |
| ProteinModelPortal | Q7Z4W2. |
| SMR | Q7Z4W2. Positions 19-147. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q7Z4W2. |
Protein family/group databases | |
| CAZy | GH22. Glycoside Hydrolase Family 22. |
Genome annotation databases | |
| Ensembl | ENST00000375318; ENSP00000364467; ENSG00000151033; Homo sapiens. [Genome view] |
| GeneID | 119180. |
| KEGG | hsa:119180. |
| UCSC | uc001ivk.1. human. |
Organism-specific databases | |
| CTD | 119180. |
| GeneCards | GC10M030940. |
| HGNC | HGNC:29613. LYZL2. |
| MIM | 612748. gene. |
| PharmGKB | PA134920379. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG07046. |
| HOGENOM | HBG505822. |
| HOVERGEN | HBG052297. |
| InParanoid | Q7Z4W2. |
| OMA | HYNTSAQ. |
| PhylomeDB | Q7Z4W2. |
Enzyme and pathway databases | |
| BRENDA | 3.2.1.17. 247. |
Gene expression databases | |
| Bgee | Q7Z4W2. |
| CleanEx | HS_LYZL2. |
| Genevestigator | Q7Z4W2. |
| GermOnline | ENSG00000151033. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001916. Glyco_hydro_22. IPR019799. Glyco_hydro_22_CS. IPR000974. Glyco_hydro_22_lys. [Graphical view] |
| Pfam | PF00062. Lys. 1 hit. [Graphical view] |
| PRINTS | PR00137. LYSOZYME. PR00135. LYZLACT. |
| SMART | SM00263. LYZ1. 1 hit. [Graphical view] |
| PROSITE | PS00128. LACTALBUMIN_LYSOZYME_1. 1 hit. PS51348. LACTALBUMIN_LYSOZYME_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 80392. |
| SOURCE | Search... |
Entry information
| Entry name | LYZL2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q7Z4W2 Secondary accession number(s): Q6NZ69 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Glycosyl hydrolases Classification of glycosyl hydrolase families and list of entries |
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


