Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Lysozyme-like protein 2

Gene

LYZL2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Catalytic activityi

Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei54 – 541PROSITE-ProRule annotation
Active sitei71 – 711PROSITE-ProRule annotation

GO - Molecular functioni

Complete GO annotation...

Keywords - Molecular functioni

Glycosidase, Hydrolase

Protein family/group databases

CAZyiGH22. Glycoside Hydrolase Family 22.

Names & Taxonomyi

Protein namesi
Recommended name:
Lysozyme-like protein 2 (EC:3.2.1.17)
Short name:
Lysozyme-2
Gene namesi
Name:LYZL2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:29613. LYZL2.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134920379.

Polymorphism and mutation databases

BioMutaiLYZL2.
DMDMi109892575.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1919Sequence AnalysisAdd
BLAST
Chaini20 – 148129Lysozyme-like protein 2PRO_0000240637Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi25 ↔ 145PROSITE-ProRule annotation
Disulfide bondi49 ↔ 133PROSITE-ProRule annotation
Glycosylationi58 – 581N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi83 ↔ 98PROSITE-ProRule annotation
Disulfide bondi94 ↔ 112PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ7Z4W2.
PRIDEiQ7Z4W2.

Expressioni

Tissue specificityi

Expressed in testis, epididymis and placenta.1 Publication

Gene expression databases

BgeeiQ7Z4W2.
CleanExiHS_LYZL2.
ExpressionAtlasiQ7Z4W2. baseline.
GenevisibleiQ7Z4W2. HS.

Organism-specific databases

HPAiHPA052332.

Interactioni

Subunit structurei

Monomer.Curated

Protein-protein interaction databases

BioGridi125634. 60 interactions.
STRINGi9606.ENSP00000364467.

Structurei

3D structure databases

ProteinModelPortaliQ7Z4W2.
SMRiQ7Z4W2. Positions 20-147.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the glycosyl hydrolase 22 family.PROSITE-ProRule annotation

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG329028.
GeneTreeiENSGT00550000074398.
HOGENOMiHOG000037357.
HOVERGENiHBG052297.
InParanoidiQ7Z4W2.
KOiK01185.
OMAiXQGWKKH.
OrthoDBiEOG7BW0M5.
PhylomeDBiQ7Z4W2.
TreeFamiTF324882.

Family and domain databases

InterProiIPR001916. Glyco_hydro_22.
IPR019799. Glyco_hydro_22_CS.
IPR000974. Glyco_hydro_22_lys.
IPR023346. Lysozyme-like_dom.
IPR030057. LYZL1/LYZL2.
[Graphical view]
PANTHERiPTHR11407:SF26. PTHR11407:SF26. 1 hit.
PfamiPF00062. Lys. 1 hit.
[Graphical view]
PRINTSiPR00137. LYSOZYME.
PR00135. LYZLACT.
SMARTiSM00263. LYZ1. 1 hit.
[Graphical view]
SUPFAMiSSF53955. SSF53955. 1 hit.
PROSITEiPS00128. LACTALBUMIN_LYSOZYME_1. 1 hit.
PS51348. LACTALBUMIN_LYSOZYME_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7Z4W2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKAAGILTLI GCLVTGAESK IYTRCKLAKI FSRAGLDNYW GFSLGNWICM
60 70 80 90 100
AYYESGYNTT AQTVLDDGSI DYGIFQINSF AWCRRGKLKE NNHCHVACSA
110 120 130 140
LVTDDLTDAI ICAKKIVKET QGMNYWQGWK KHCEGRDLSD WKKDCEVS
Length:148
Mass (Da):16,656
Last modified:June 27, 2006 - v2
Checksum:i4674158A2A5912F2
GO
Isoform 2 (identifier: Q7Z4W2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MQDAPLSCLSPTKWSSVSSADSTEKSASAAGTRNLPFQFCLRQALRM

Show »
Length:194
Mass (Da):21,584
Checksum:i81A2CCB4C2DD597E
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti144 – 1441D → G.1 Publication
Corresponds to variant rs1054570 [ dbSNP | Ensembl ].
VAR_026818

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MQDAPLSCLSPTKWSSVSSA DSTEKSASAAGTRNLPFQFC LRQALRM in isoform 2. 1 PublicationVSP_019717

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF139543 mRNA. Translation: AAP97272.1.
AL451107 Genomic DNA. Translation: CAH70607.1.
BC066294 mRNA. Translation: AAH66294.1.
CCDSiCCDS7167.2. [Q7Z4W2-2]
RefSeqiNP_898881.2. NM_183058.2.
UniGeneiHs.522610.

Genome annotation databases

EnsembliENST00000375318; ENSP00000364467; ENSG00000151033. [Q7Z4W2-2]
GeneIDi119180.
KEGGihsa:119180.
UCSCiuc001ivk.3. human. [Q7Z4W2-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF139543 mRNA. Translation: AAP97272.1.
AL451107 Genomic DNA. Translation: CAH70607.1.
BC066294 mRNA. Translation: AAH66294.1.
CCDSiCCDS7167.2. [Q7Z4W2-2]
RefSeqiNP_898881.2. NM_183058.2.
UniGeneiHs.522610.

3D structure databases

ProteinModelPortaliQ7Z4W2.
SMRiQ7Z4W2. Positions 20-147.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125634. 60 interactions.
STRINGi9606.ENSP00000364467.

Protein family/group databases

CAZyiGH22. Glycoside Hydrolase Family 22.

Polymorphism and mutation databases

BioMutaiLYZL2.
DMDMi109892575.

Proteomic databases

PaxDbiQ7Z4W2.
PRIDEiQ7Z4W2.

Protocols and materials databases

DNASUi119180.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000375318; ENSP00000364467; ENSG00000151033. [Q7Z4W2-2]
GeneIDi119180.
KEGGihsa:119180.
UCSCiuc001ivk.3. human. [Q7Z4W2-2]

Organism-specific databases

CTDi119180.
GeneCardsiGC10M030940.
HGNCiHGNC:29613. LYZL2.
HPAiHPA052332.
MIMi612748. gene.
neXtProtiNX_Q7Z4W2.
PharmGKBiPA134920379.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG329028.
GeneTreeiENSGT00550000074398.
HOGENOMiHOG000037357.
HOVERGENiHBG052297.
InParanoidiQ7Z4W2.
KOiK01185.
OMAiXQGWKKH.
OrthoDBiEOG7BW0M5.
PhylomeDBiQ7Z4W2.
TreeFamiTF324882.

Miscellaneous databases

GenomeRNAii119180.
NextBioi80392.
PROiQ7Z4W2.
SOURCEiSearch...

Gene expression databases

BgeeiQ7Z4W2.
CleanExiHS_LYZL2.
ExpressionAtlasiQ7Z4W2. baseline.
GenevisibleiQ7Z4W2. HS.

Family and domain databases

InterProiIPR001916. Glyco_hydro_22.
IPR019799. Glyco_hydro_22_CS.
IPR000974. Glyco_hydro_22_lys.
IPR023346. Lysozyme-like_dom.
IPR030057. LYZL1/LYZL2.
[Graphical view]
PANTHERiPTHR11407:SF26. PTHR11407:SF26. 1 hit.
PfamiPF00062. Lys. 1 hit.
[Graphical view]
PRINTSiPR00137. LYSOZYME.
PR00135. LYZLACT.
SMARTiSM00263. LYZ1. 1 hit.
[Graphical view]
SUPFAMiSSF53955. SSF53955. 1 hit.
PROSITEiPS00128. LACTALBUMIN_LYSOZYME_1. 1 hit.
PS51348. LACTALBUMIN_LYSOZYME_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and characterization of three novel lysozyme-like genes, predominantly expressed in the male reproductive system of humans, belonging to the c-type lysozyme/alpha-lactalbumin family."
    Zhang K., Gao R., Zhang H., Cai X., Shen C., Wu C., Zhao S., Yu L.
    Biol. Reprod. 73:1064-1071(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT GLY-144, TISSUE SPECIFICITY.
    Tissue: Testis.
  2. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.

Entry informationi

Entry nameiLYZL2_HUMAN
AccessioniPrimary (citable) accession number: Q7Z4W2
Secondary accession number(s): Q6NZ69
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: June 27, 2006
Last modified: June 24, 2015
This is version 93 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Glycosyl hydrolases
    Classification of glycosyl hydrolase families and list of entries
  2. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.