Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q7Z4W2 (LYZL2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 85. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Lysozyme-like protein 2

Short name=Lysozyme-2
EC=3.2.1.17
Gene names
Name:LYZL2
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length148 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Catalytic activity

Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins.

Subunit structure

Monomer Probable.

Subcellular location

Secreted Probable.

Tissue specificity

Expressed in testis, epididymis and placenta. Ref.1

Sequence similarities

Belongs to the glycosyl hydrolase 22 family.

Ontologies

Keywords
   Cellular componentSecreted
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainSignal
   Molecular functionGlycosidase
Hydrolase
   PTMDisulfide bond
Glycoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processcell wall macromolecule catabolic process

Inferred from electronic annotation. Source: InterPro

   Cellular_componentextracellular region

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionlysozyme activity

Inferred from electronic annotation. Source: UniProtKB-EC

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q7Z4W2-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q7Z4W2-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MQDAPLSCLSPTKWSSVSSADSTEKSASAAGTRNLPFQFCLRQALRM

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 1919 Potential
Chain20 – 148129Lysozyme-like protein 2
PRO_0000240637

Sites

Active site541 By similarity
Active site711 By similarity

Amino acid modifications

Glycosylation581N-linked (GlcNAc...) Potential
Disulfide bond25 ↔ 145 By similarity
Disulfide bond49 ↔ 133 By similarity
Disulfide bond83 ↔ 98 By similarity
Disulfide bond94 ↔ 112 By similarity

Natural variations

Alternative sequence11M → MQDAPLSCLSPTKWSSVSSA DSTEKSASAAGTRNLPFQFC LRQALRM in isoform 2.
VSP_019717
Natural variant1441D → G. Ref.1
Corresponds to variant rs1054570 [ dbSNP | Ensembl ].
VAR_026818

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 27, 2006. Version 2.
Checksum: 4674158A2A5912F2

FASTA14816,656
        10         20         30         40         50         60 
MKAAGILTLI GCLVTGAESK IYTRCKLAKI FSRAGLDNYW GFSLGNWICM AYYESGYNTT 

        70         80         90        100        110        120 
AQTVLDDGSI DYGIFQINSF AWCRRGKLKE NNHCHVACSA LVTDDLTDAI ICAKKIVKET 

       130        140 
QGMNYWQGWK KHCEGRDLSD WKKDCEVS 

« Hide

Isoform 2 [UniParc].

Checksum: 81A2CCB4C2DD597E
Show »

FASTA19421,584

References

« Hide 'large scale' references
[1]"Molecular cloning and characterization of three novel lysozyme-like genes, predominantly expressed in the male reproductive system of humans, belonging to the c-type lysozyme/alpha-lactalbumin family."
Zhang K., Gao R., Zhang H., Cai X., Shen C., Wu C., Zhao S., Yu L.
Biol. Reprod. 73:1064-1071(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT GLY-144, TISSUE SPECIFICITY.
Tissue: Testis.
[2]"The DNA sequence and comparative analysis of human chromosome 10."
Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. expand/collapse author list , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Testis.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF139543 mRNA. Translation: AAP97272.1.
AL451107 Genomic DNA. Translation: CAH70607.1.
BC066294 mRNA. Translation: AAH66294.1.
RefSeqNP_898881.2. NM_183058.2.
UniGeneHs.522610.

3D structure databases

ProteinModelPortalQ7Z4W2.
SMRQ7Z4W2. Positions 20-147.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000364467.

Protein family/group databases

CAZyGH22. Glycoside Hydrolase Family 22.

Polymorphism databases

DMDM109892575.

Proteomic databases

PaxDbQ7Z4W2.
PRIDEQ7Z4W2.

Protocols and materials databases

DNASU119180.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000375318; ENSP00000364467; ENSG00000151033. [Q7Z4W2-2]
GeneID119180.
KEGGhsa:119180.
UCSCuc001ivk.3. human. [Q7Z4W2-2]

Organism-specific databases

CTD119180.
GeneCardsGC10M030940.
HGNCHGNC:29613. LYZL2.
HPAHPA052332.
MIM612748. gene.
neXtProtNX_Q7Z4W2.
PharmGKBPA134920379.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG329028.
HOGENOMHOG000037357.
HOVERGENHBG052297.
InParanoidQ7Z4W2.
KOK01185.
OMAXQGWKKH.
OrthoDBEOG7BW0M5.
PhylomeDBQ7Z4W2.
TreeFamTF324882.

Gene expression databases

BgeeQ7Z4W2.
CleanExHS_LYZL2.
GenevestigatorQ7Z4W2.

Family and domain databases

InterProIPR001916. Glyco_hydro_22.
IPR019799. Glyco_hydro_22_CS.
IPR000974. Glyco_hydro_22_lys.
IPR023346. Lysozyme-like_dom.
[Graphical view]
PfamPF00062. Lys. 1 hit.
[Graphical view]
PRINTSPR00137. LYSOZYME.
PR00135. LYZLACT.
SMARTSM00263. LYZ1. 1 hit.
[Graphical view]
SUPFAMSSF53955. SSF53955. 1 hit.
PROSITEPS00128. LACTALBUMIN_LYSOZYME_1. 1 hit.
PS51348. LACTALBUMIN_LYSOZYME_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi119180.
NextBio80392.
PROQ7Z4W2.
SOURCESearch...

Entry information

Entry nameLYZL2_HUMAN
AccessionPrimary (citable) accession number: Q7Z4W2
Secondary accession number(s): Q6NZ69
Entry history
Integrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: June 27, 2006
Last modified: March 19, 2014
This is version 85 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 10

Human chromosome 10: entries, gene names and cross-references to MIM

Glycosyl hydrolases

Classification of glycosyl hydrolase families and list of entries