Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q7Z4W2

- LYZL2_HUMAN

UniProt

Q7Z4W2 - LYZL2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Lysozyme-like protein 2

Gene

LYZL2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli

Functioni

Catalytic activityi

Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei54 – 541PROSITE-ProRule annotation
Active sitei71 – 711PROSITE-ProRule annotation

GO - Molecular functioni

  1. lysozyme activity Source: UniProtKB-EC

GO - Biological processi

  1. cell wall macromolecule catabolic process Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Glycosidase, Hydrolase

Protein family/group databases

CAZyiGH22. Glycoside Hydrolase Family 22.

Names & Taxonomyi

Protein namesi
Recommended name:
Lysozyme-like protein 2 (EC:3.2.1.17)
Short name:
Lysozyme-2
Gene namesi
Name:LYZL2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 10

Organism-specific databases

HGNCiHGNC:29613. LYZL2.

Subcellular locationi

Secreted Curated

GO - Cellular componenti

  1. extracellular region Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134920379.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1919Sequence AnalysisAdd
BLAST
Chaini20 – 148129Lysozyme-like protein 2PRO_0000240637Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi25 ↔ 145PROSITE-ProRule annotation
Disulfide bondi49 ↔ 133PROSITE-ProRule annotation
Glycosylationi58 – 581N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi83 ↔ 98PROSITE-ProRule annotation
Disulfide bondi94 ↔ 112PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ7Z4W2.
PRIDEiQ7Z4W2.

Expressioni

Tissue specificityi

Expressed in testis, epididymis and placenta.1 Publication

Gene expression databases

BgeeiQ7Z4W2.
CleanExiHS_LYZL2.
GenevestigatoriQ7Z4W2.

Organism-specific databases

HPAiHPA052332.

Interactioni

Subunit structurei

Monomer.Curated

Protein-protein interaction databases

STRINGi9606.ENSP00000364467.

Structurei

3D structure databases

ProteinModelPortaliQ7Z4W2.
SMRiQ7Z4W2. Positions 20-147.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the glycosyl hydrolase 22 family.PROSITE-ProRule annotation

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG329028.
GeneTreeiENSGT00550000074398.
HOGENOMiHOG000037357.
HOVERGENiHBG052297.
InParanoidiQ7Z4W2.
KOiK01185.
OMAiXQGWKKH.
OrthoDBiEOG7BW0M5.
PhylomeDBiQ7Z4W2.
TreeFamiTF324882.

Family and domain databases

InterProiIPR001916. Glyco_hydro_22.
IPR019799. Glyco_hydro_22_CS.
IPR000974. Glyco_hydro_22_lys.
IPR023346. Lysozyme-like_dom.
[Graphical view]
PfamiPF00062. Lys. 1 hit.
[Graphical view]
PRINTSiPR00137. LYSOZYME.
PR00135. LYZLACT.
SMARTiSM00263. LYZ1. 1 hit.
[Graphical view]
SUPFAMiSSF53955. SSF53955. 1 hit.
PROSITEiPS00128. LACTALBUMIN_LYSOZYME_1. 1 hit.
PS51348. LACTALBUMIN_LYSOZYME_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q7Z4W2-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKAAGILTLI GCLVTGAESK IYTRCKLAKI FSRAGLDNYW GFSLGNWICM
60 70 80 90 100
AYYESGYNTT AQTVLDDGSI DYGIFQINSF AWCRRGKLKE NNHCHVACSA
110 120 130 140
LVTDDLTDAI ICAKKIVKET QGMNYWQGWK KHCEGRDLSD WKKDCEVS
Length:148
Mass (Da):16,656
Last modified:June 27, 2006 - v2
Checksum:i4674158A2A5912F2
GO
Isoform 2 (identifier: Q7Z4W2-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MQDAPLSCLSPTKWSSVSSADSTEKSASAAGTRNLPFQFCLRQALRM

Show »
Length:194
Mass (Da):21,584
Checksum:i81A2CCB4C2DD597E
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti144 – 1441D → G.1 Publication
Corresponds to variant rs1054570 [ dbSNP | Ensembl ].
VAR_026818

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MQDAPLSCLSPTKWSSVSSA DSTEKSASAAGTRNLPFQFC LRQALRM in isoform 2. 1 PublicationVSP_019717

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF139543 mRNA. Translation: AAP97272.1.
AL451107 Genomic DNA. Translation: CAH70607.1.
BC066294 mRNA. Translation: AAH66294.1.
CCDSiCCDS7167.2. [Q7Z4W2-2]
RefSeqiNP_898881.2. NM_183058.2.
UniGeneiHs.522610.

Genome annotation databases

EnsembliENST00000375318; ENSP00000364467; ENSG00000151033. [Q7Z4W2-2]
GeneIDi119180.
KEGGihsa:119180.
UCSCiuc001ivk.3. human. [Q7Z4W2-2]

Polymorphism databases

DMDMi109892575.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF139543 mRNA. Translation: AAP97272.1 .
AL451107 Genomic DNA. Translation: CAH70607.1 .
BC066294 mRNA. Translation: AAH66294.1 .
CCDSi CCDS7167.2. [Q7Z4W2-2 ]
RefSeqi NP_898881.2. NM_183058.2.
UniGenei Hs.522610.

3D structure databases

ProteinModelPortali Q7Z4W2.
SMRi Q7Z4W2. Positions 20-147.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000364467.

Protein family/group databases

CAZyi GH22. Glycoside Hydrolase Family 22.

Polymorphism databases

DMDMi 109892575.

Proteomic databases

PaxDbi Q7Z4W2.
PRIDEi Q7Z4W2.

Protocols and materials databases

DNASUi 119180.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000375318 ; ENSP00000364467 ; ENSG00000151033 . [Q7Z4W2-2 ]
GeneIDi 119180.
KEGGi hsa:119180.
UCSCi uc001ivk.3. human. [Q7Z4W2-2 ]

Organism-specific databases

CTDi 119180.
GeneCardsi GC10M030940.
HGNCi HGNC:29613. LYZL2.
HPAi HPA052332.
MIMi 612748. gene.
neXtProti NX_Q7Z4W2.
PharmGKBi PA134920379.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG329028.
GeneTreei ENSGT00550000074398.
HOGENOMi HOG000037357.
HOVERGENi HBG052297.
InParanoidi Q7Z4W2.
KOi K01185.
OMAi XQGWKKH.
OrthoDBi EOG7BW0M5.
PhylomeDBi Q7Z4W2.
TreeFami TF324882.

Miscellaneous databases

GenomeRNAii 119180.
NextBioi 80392.
PROi Q7Z4W2.
SOURCEi Search...

Gene expression databases

Bgeei Q7Z4W2.
CleanExi HS_LYZL2.
Genevestigatori Q7Z4W2.

Family and domain databases

InterProi IPR001916. Glyco_hydro_22.
IPR019799. Glyco_hydro_22_CS.
IPR000974. Glyco_hydro_22_lys.
IPR023346. Lysozyme-like_dom.
[Graphical view ]
Pfami PF00062. Lys. 1 hit.
[Graphical view ]
PRINTSi PR00137. LYSOZYME.
PR00135. LYZLACT.
SMARTi SM00263. LYZ1. 1 hit.
[Graphical view ]
SUPFAMi SSF53955. SSF53955. 1 hit.
PROSITEi PS00128. LACTALBUMIN_LYSOZYME_1. 1 hit.
PS51348. LACTALBUMIN_LYSOZYME_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and characterization of three novel lysozyme-like genes, predominantly expressed in the male reproductive system of humans, belonging to the c-type lysozyme/alpha-lactalbumin family."
    Zhang K., Gao R., Zhang H., Cai X., Shen C., Wu C., Zhao S., Yu L.
    Biol. Reprod. 73:1064-1071(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT GLY-144, TISSUE SPECIFICITY.
    Tissue: Testis.
  2. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.

Entry informationi

Entry nameiLYZL2_HUMAN
AccessioniPrimary (citable) accession number: Q7Z4W2
Secondary accession number(s): Q6NZ69
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: June 27, 2006
Last modified: October 29, 2014
This is version 88 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Glycosyl hydrolases
    Classification of glycosyl hydrolase families and list of entries
  2. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3