Q7Z4T9 (AAT1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
December 14, 2011.
Version 62.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: AMY-1-associating protein expressed in testis 1 Short name=AAT-1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 603 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Isoform 4 may play a role in spermatogenesis. |
| Subunit structure | Interacts with AMY1 and AKAP1. Isoform 4 belongs to a complex together with AMY1, AKAP1 and PRKAR2B. Isoform 3 does not interact with AMY1. Ref.1 Ref.7 |
| Subcellular location | Cytoplasm. Mitochondrion. Note: Isoform 4 is found in the mitochondria and localized in the neck of the sperm. |
| Tissue specificity | Isoform 1 is strongly expressed in the liver. Isoform 4 is widely expressed, but strongly expressed in all spermatogenesis-related tissues, including the testis, the epithelium of cauda and the corpus epididymis. Isoform 4 is present in the spermatid and mature sperm. Isoform 4 is also expressed in Leydig cells. Isoform 3 is expressed in the testis. Ref.7 |
| Post-translational modification |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Mitochondrion |
| Coding sequence diversity | Alternative promoter usage Alternative splicing Polymorphism |
| Domain | Coiled coil |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | mitochondrion Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | protein binding Inferred from physical interaction Ref.1. Source: IntAct |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| AKAP1 | Q92667-2 | 3 | EBI-2119735,EBI-2120060 | |
| MYCBP | Q99417 | 5 | EBI-2119735,EBI-716185 |
Alternative products
| This entry describes 8 isoforms produced by alternative promoter usage and alternative splicing. [Align] [Select] Note: Additional isoforms (AAT-1L and AAT-1S) may exist. | |||||||||
| Isoform 1 (identifier: Q7Z4T9-1) Also known as: AAT-1M; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||||||
| Isoform 2 (identifier: Q7Z4T9-2) The sequence of this isoform differs from the canonical sequence as follows: 229-238: RGLPAGQAEV → ELVNLLTIGR 239-603: Missing. | |||||||||
| Note: No experimental confirmation available. | |||||||||
| Isoform 3 (identifier: Q7Z4T9-3) The sequence of this isoform differs from the canonical sequence as follows: 1-67: MSHAVTIEEPQAQPQVSQTRYRERSRAGSHISSNRAYDFLYDPLFIVSSEKDHTQANIQATLIRSRL → MIFCT 331-331: A → AKIQRTHVST...SNEEEEMEMA | |||||||||
| Isoform 4 (identifier: Q7Z4T9-4) Also known as: AAT1-alpha; The sequence of this isoform differs from the canonical sequence as follows: 1-505: Missing. | |||||||||
| Note: May be produced by alternative promoter usage. | |||||||||
| Isoform 6 (identifier: Q7Z4T9-6) The sequence of this isoform differs from the canonical sequence as follows: 1-126: Missing. 331-331: A → AKIQRTHVST...SNEEEEMEMA | |||||||||
| Isoform 7 (identifier: Q7Z4T9-7) The sequence of this isoform differs from the canonical sequence as follows: 331-331: A → AKIQRTHVST...SNEEEEMEMA | |||||||||
Sequence annotation (Features) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
| Sequence conflict | 362 | 1 | K → R in BAF82603. Ref.3 | ||||||
| Isoform 8 (identifier: Q7Z4T9-8) The sequence of this isoform differs from the canonical sequence as follows: 1-41: MSHAVTIEEPQAQPQVSQTRYRERSRAGSHISSNRAYDFLY → MIFCTVRTAADLPLRPSPPRP 331-331: A → AKIQRTHVST...SNEEEEMEMA | |||||||||
| Isoform 5 (identifier: Q7Z4T9-5) Also known as: AAT1-beta; AAT1-gamma; The sequence of this isoform differs from the canonical sequence as follows: 1-572: Missing. | |||||||||
| Note: May be produced by alternative promoter usage. | |||||||||
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 603 | 603 | AMY-1-associating protein expressed in testis 1 | PRO_0000064417 | |||||
Regions | |||||||||
| Coiled coil | 264 – 310 | 47 | Potential | ||||||
| Coiled coil | 367 – 431 | 65 | Potential | ||||||
| Coiled coil | 487 – 519 | 33 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 579 | 1 | Phosphothreonine Ref.8 | ||||||
| Modified residue | 587 | 1 | Phosphoserine Ref.8 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 572 | 572 | Missing in isoform 5. | VSP_014909 | |||||
| Alternative sequence | 1 – 505 | 505 | Missing in isoform 4. | VSP_014908 | |||||
| Alternative sequence | 1 – 126 | 126 | Missing in isoform 6. | VSP_039503 | |||||
| Alternative sequence | 1 – 67 | 67 | MSHAV…IRSRL → MIFCT in isoform 3. | VSP_014907 | |||||
| Alternative sequence | 1 – 41 | 41 | MSHAV…YDFLY → MIFCTVRTAADLPLRPSPPR P in isoform 8. | VSP_039504 | |||||
| Alternative sequence | 229 – 238 | 10 | RGLPAGQAEV → ELVNLLTIGR in isoform 2. | VSP_014910 | |||||
| Alternative sequence | 239 – 603 | 365 | Missing in isoform 2. | VSP_014911 | |||||
| Alternative sequence | 331 | 1 | A → AKIQRTHVSTIRKLVGKRKN IEGKLERRNIIKDYSDYASQ VYGPLSRLGCFPDNNSEDFV VKNYYLNTYEGLVELESCLP DFVTQPQIRAPKPKVITTKA GFLKRAARLDYELAEVHKAL LDKKNKVLEVKKPPRFLQRN PIPQPRLPTPTLEMTSNEEE EMEMA in isoform 3, isoform 6, isoform 7 and isoform 8. | VSP_014912 | |||||
| Natural variant | 207 | 1 | A → P. Ref.2 Ref.3 Ref.4 Ref.6 Corresponds to variant rs6438544 [ dbSNP | Ensembl ]. | VAR_030243 | |||||
| Natural variant | 253 | 1 | S → T. Corresponds to variant rs9817771 [ dbSNP | Ensembl ]. | VAR_030244 | |||||
| Natural variant | 320 | 1 | S → C. Corresponds to variant rs9819218 [ dbSNP | Ensembl ]. | VAR_030245 | |||||
Experimental info | |||||||||
| Sequence conflict | 311 | 1 | N → D in BAG51535. Ref.3 | ||||||
| Sequence conflict | 344 | 1 | V → I in AAP97317. Ref.2 | ||||||
| Sequence conflict | 460 | 1 | R → C in BAG51535. Ref.3 | ||||||
| Sequence conflict | 485 | 1 | D → A in CAH18098. Ref.4 | ||||||
| Sequence conflict | 516 | 1 | E → G in BAG63926. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "AAT-1, a novel testis-specific AMY-1-binding protein, forms a quaternary complex between AMY-1, A-kinase anchor protein 84 and a regulatory subunit of cAMP-dependent protein kinase and is phosphorylated by its kinase." Yukitake H., Furusawa M., Taira T., Iguchi-Ariga S.M.M., Ariga H. J. Biol. Chem. 277:45480-45492(2002) [PubMed: 12223483] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 4 AND 5), INTERACTION WITH AMY1 AND AKAP1, PHOSPHORYLATION. Tissue: Testis. |
| [2] | Guo J.H., Yu L. Submitted (MAR-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT PRO-207. Tissue: Lung. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 6; 7 AND 8), VARIANT PRO-207. Tissue: Amygdala, Corpus callosum, Lung and Testis. |
| [4] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT PRO-207. Tissue: Testis. |
| [5] | "The DNA sequence, annotation and analysis of human chromosome 3." Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. Gibbs R.A.Nature 440:1194-1198(2006) [PubMed: 16641997] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7), VARIANT PRO-207. Tissue: Lung. |
| [7] | "Structure and characterization of AAT-1 isoforms." Matsuda E., Ishizaki R., Taira T., Iguchi-Ariga S.M.M., Ariga H. Biol. Pharm. Bull. 28:898-901(2005) [PubMed: 15863901] [Abstract] Cited for: ALTERNATIVE SPLICING, INTERACTION WITH AMY1, TISSUE SPECIFICITY (ISOFORM 1). |
| [8] | "Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry." Molina H., Horn D.M., Tang N., Mathivanan S., Pandey A. Proc. Natl. Acad. Sci. U.S.A. 104:2199-2204(2007) [PubMed: 17287340] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-579 AND SER-587, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB063296 mRNA. Translation: BAB60902.1. AB063297 mRNA. Translation: BAB60903.1. AB063298 mRNA. Translation: BAB60904.1. AF440403 mRNA. Translation: AAP97317.1. AF497717 mRNA. Translation: AAM19218.1. AK055558 mRNA. Translation: BAG51535.1. AK289914 mRNA. Translation: BAF82603.1. AK294413 mRNA. Translation: BAG57663.1. AK302699 mRNA. Translation: BAG63926.1. CR749242 mRNA. Translation: CAH18098.1. AC117466 Genomic DNA. No translation available. AC069444 Genomic DNA. No translation available. BC126394 mRNA. Translation: AAI26395.1. |
| IPI | IPI00376045. IPI00470511. IPI00607786. IPI00749309. IPI00797244. IPI00969116. IPI00969133. IPI00969208. |
| RefSeq | NP_203528.2. NM_033364.3. |
| UniGene | Hs.341906. |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q7Z4T9. 4 interactions. |
| STRING | Q7Z4T9. |
Polymorphism databases | |
| DMDM | 300669603. |
Proteomic databases | |
| PRIDE | Q7Z4T9. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000264232; ENSP00000264232; ENSG00000183833. ENST00000273390; ENSP00000273390; ENSG00000183833. ENST00000383667; ENSP00000373163; ENSG00000183833. |
| GeneID | 89876. |
| KEGG | hsa:89876. |
| UCSC | uc003edc.2. human. uc010hqz.1. human. |
Organism-specific databases | |
| CTD | 89876. |
| HGNC | HGNC:24010. C3orf15. |
| HPA | HPA035610. |
| MIM | 609910. gene. |
| neXtProt | NX_Q7Z4T9. |
| PharmGKB | PA134904689. |
| GenAtlas | Search... |
Phylogenomic databases | |
| GeneTree | ENSGT00390000003024. |
| HOGENOM | HBG357756. |
| HOVERGEN | HBG079422. |
| OMA | TSYLEDI. |
| OrthoDB | EOG4XPQFG. |
Gene expression databases | |
| ArrayExpress | Q7Z4T9. |
| Bgee | Q7Z4T9. |
| CleanEx | HS_C3orf15. |
| Genevestigator | Q7Z4T9. |
| GermOnline | ENSG00000183833. Homo sapiens. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| NextBio | 76384. |
| SOURCE | Search... |
Entry information
| Entry name | AAT1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q7Z4T9 Secondary accession number(s): A0AVK2 Q96JE8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |

Clusters with