Reviewed,
UniProtKB/Swiss-Prot Q7Z4T9 (AAT1_HUMAN)
Last modified
November 24, 2009.
Version 47.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: AMY-1-associating protein expressed in testis 1 Short name=AAT-1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 603 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Isoform 4 may play a role in spermatogenesis. |
| Subunit structure | Interacts with AMY1 and AKAP1. Isoform 4 belongs to a complex together with AMY1, AKAP1 and PRKAR2B. Isoform 3 does not interact with AMY1. Ref.1 Ref.4 |
| Subcellular location | Cytoplasm. Mitochondrion. Note: Isoform 4 is found in the mitochondria and localized in the neck of the sperm. |
| Tissue specificity | Isoform 1 is strongly expressed in the liver. Isoform 4 is widely expressed, but strongly expressed in all spermatogenesis-related tissues, including the testis, the epithelium of cauda and the corpus epididymis. Isoform 4 is present in the spermatid and mature sperm. Isoform 4 is also expressed in Leydig cells. Isoform 3 is expressed in the testis. Ref.4 |
| Post-translational modification |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Mitochondrion |
| Coding sequence diversity | Alternative promoter usage Alternative splicing Polymorphism |
| Domain | Coiled coil |
| PTM | Phosphoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Cellular component | mitochondrion Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | protein binding Ref.1 Inferred from physical interaction. Source: IntAct |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| AKAP1 | Q92667-2 | 2 | EBI-2119735,EBI-2120060 | |
| MYCBP | Q99417 | 2 | EBI-2119735,EBI-716185 |
Alternative products
| This entry describes 5 isoforms produced by alternative promoter usage and alternative splicing. [Align] [Select] Note: Additional isoforms (AAT-1L and AAT-1S) may exist. | ||||||
| Isoform 1 (identifier: Q7Z4T9-1) Also known as: AAT-1M; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q7Z4T9-2) The sequence of this isoform differs from the canonical sequence as follows: 229-238: RGLPAGQAEV → ELVNLLTIGR 239-603: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q7Z4T9-3) The sequence of this isoform differs from the canonical sequence as follows: 1-67: MSHAVTIEEPQAQPQVSQTRYRERSRAGSHISSNRAYDFLYDPLFIVSSEKDHTQANIQATLIRSRL → MIFCT 331-331: A → AKIQRTHVST...SNEEEEMEMA | ||||||
| Isoform 4 (identifier: Q7Z4T9-4) Also known as: AAT1-alpha; The sequence of this isoform differs from the canonical sequence as follows: 1-505: Missing. | ||||||
| Note: May be produced by alternative promoter usage. | ||||||
| Isoform 5 (identifier: Q7Z4T9-5) Also known as: AAT1-beta; AAT1-gamma; The sequence of this isoform differs from the canonical sequence as follows: 1-572: Missing. | ||||||
| Note: May be produced by alternative promoter usage. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 603 | 603 | AMY-1-associating protein expressed in testis 1 | PRO_0000064417 | |||||
Regions | |||||||||
| Coiled coil | 264 – 310 | 47 | Potential | ||||||
| Coiled coil | 367 – 431 | 65 | Potential | ||||||
| Coiled coil | 487 – 519 | 33 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 579 | 1 | Phosphothreonine Ref.5 | ||||||
| Modified residue | 587 | 1 | Phosphoserine Ref.5 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 572 | 572 | Missing in isoform 5. | VSP_014909 | |||||
| Alternative sequence | 1 – 505 | 505 | Missing in isoform 4. | VSP_014908 | |||||
| Alternative sequence | 1 – 67 | 67 | MSHAV…IRSRL → MIFCT in isoform 3. | VSP_014907 | |||||
| Alternative sequence | 229 – 238 | 10 | RGLPAGQAEV → ELVNLLTIGR in isoform 2. | VSP_014910 | |||||
| Alternative sequence | 239 – 603 | 365 | Missing in isoform 2. | VSP_014911 | |||||
| Alternative sequence | 331 | 1 | A → AKIQRTHVSTIRKLVGKRKN IEGKLERRNIIKDYSDYASQ VYGPLSRLGCFPDNNSEDFV VKNYYLNTYEGLVELESCLP DFVTQPQIRAPKPKVITTKA GFLKRAARLDYELAEVHKAL LDKKNKVLEVKKPPRFLQRN PIPQPRLPTPTLEMTSNEEE EMEMA in isoform 3. | VSP_014912 | |||||
| Natural variant | 207 | 1 | P → A: dbSNP rs6438544. | VAR_030243 | |||||
| Natural variant | 253 | 1 | S → T: dbSNP rs9817771. | VAR_030244 | |||||
| Natural variant | 320 | 1 | S → C: dbSNP rs9819218. | VAR_030245 | |||||
Experimental info | |||||||||
| Sequence conflict | 344 | 1 | I → V in CAH18098. Ref.3 | ||||||
| Sequence conflict | 485 | 1 | D → A in CAH18098. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "AAT-1, a novel testis-specific AMY-1-binding protein, forms a quaternary complex between AMY-1, A-kinase anchor protein 84 and a regulatory subunit of cAMP-dependent protein kinase and is phosphorylated by its kinase." Yukitake H., Furusawa M., Taira T., Iguchi-Ariga S.M.M., Ariga H. J. Biol. Chem. 277:45480-45492(2002) [PubMed: 12223483] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 4 AND 5), INTERACTION WITH AMY1 AND AKAP1, PHOSPHORYLATION. Tissue: Testis. |
| [2] | Guo J.H., Yu L. Submitted (MAR-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Lung. |
| [3] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Testis. |
| [4] | "Structure and characterization of AAT-1 isoforms." Matsuda E., Ishizaki R., Taira T., Iguchi-Ariga S.M.M., Ariga H. Biol. Pharm. Bull. 28:898-901(2005) [PubMed: 15863901] [Abstract] Cited for: ALTERNATIVE SPLICING, INTERACTION WITH AMY1, TISSUE SPECIFICITY (ISOFORM 1). |
| [5] | "Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry." Molina H., Horn D.M., Tang N., Mathivanan S., Pandey A. Proc. Natl. Acad. Sci. U.S.A. 104:2199-2204(2007) [PubMed: 17287340] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-579 AND SER-587, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AB063296 mRNA. Translation: BAB60902.1. AB063297 mRNA. Translation: BAB60903.1. AB063298 mRNA. Translation: BAB60904.1. AF440403 mRNA. Translation: AAP97317.1. AF497717 mRNA. Translation: AAM19218.1. CR749242 mRNA. Translation: CAH18098.1. | |
| IPI | IPI00376045. IPI00607721. IPI00607786. IPI00749309. IPI00789534. |
| UniGene | Hs.341906 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q7Z4T9. 3 interactions. |
| STRING | Q7Z4T9. |
Proteomic databases | |
| PRIDE | Q7Z4T9. |
Genome annotation databases | |
| Ensembl | ENST00000264232; ENSP00000264232; ENSG00000183833; Homo sapiens. [Genome view] |
| UCSC | uc003edc.2. human. uc010hqz.1. human. |
Organism-specific databases | |
| GeneCards | GC03P120904. GC11U900016. |
| H-InvDB | HIX0003587. |
| HGNC | HGNC:24010. C3orf15. |
| MIM | 609910. gene. |
| PharmGKB | PA134904689. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | Q7Z4T9. |
Gene expression databases | |
| ArrayExpress | Q7Z4T9. |
| Bgee | Q7Z4T9. |
| CleanEx | HS_C3orf15. |
| Genevestigator | Q7Z4T9. |
| GermOnline | ENSG00000183833. Homo sapiens. |
Family and domain databases | |
| ProtoNet | Search... |
Other Resources | |
| SOURCE | Search... |
Entry information
| Entry name | AAT1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q7Z4T9 Secondary accession number(s): Q68DX2 Q96JE8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |

Clusters with


