SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q7Z4S9

- SH2D6_HUMAN

UniProt

Q7Z4S9 - SH2D6_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
SH2 domain-containing protein 6
Gene
SH2D6
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5 - Experimental evidence at transcript leveli

Functioni

Enzyme and pathway databases

SignaLinkiQ7Z4S9.

Names & Taxonomyi

Protein namesi
Recommended name:
SH2 domain-containing protein 6
Gene namesi
Name:SH2D6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:30439. SH2D6.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162403243.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 175175SH2 domain-containing protein 6
PRO_0000308603Add
BLAST

Proteomic databases

PaxDbiQ7Z4S9.
PRIDEiQ7Z4S9.

Expressioni

Gene expression databases

BgeeiQ7Z4S9.
CleanExiHS_SH2D6.
GenevestigatoriQ7Z4S9.

Organism-specific databases

HPAiHPA053873.

Structurei

3D structure databases

ProteinModelPortaliQ7Z4S9.
SMRiQ7Z4S9. Positions 45-174.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini65 – 173109SH2
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi7 – 2822Pro-rich
Add
BLAST

Sequence similaritiesi

Contains 1 SH2 domain.

Keywords - Domaini

SH2 domain

Phylogenomic databases

eggNOGiNOG45165.
HOGENOMiHOG000154312.
HOVERGENiHBG097730.
InParanoidiQ7Z4S9.
OMAiYENEENA.
OrthoDBiEOG7WMCKM.
PhylomeDBiQ7Z4S9.
TreeFamiTF343096.

Family and domain databases

Gene3Di3.30.505.10. 1 hit.
InterProiIPR000980. SH2.
[Graphical view]
PfamiPF00017. SH2. 1 hit.
[Graphical view]
SMARTiSM00252. SH2. 1 hit.
[Graphical view]
SUPFAMiSSF55550. SSF55550. 1 hit.
PROSITEiPS50001. SH2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q7Z4S9-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MYASSYPPPP QLSPRSHLCP PPPHPTPPQL NNLLLLEGRK SSLPSVAPTG    50
SASAAEDSDL LTQPWYSGNC DRYAVESALL HLQKDGAYTV RPSSGPHGSQ 100
PFTLAVLLRG RVFNIPIRRL DGGRHYALGR EGRNREELFS SVAAMVQHFM 150
WHPLPLVDRH SGSRELTCLL FPTKP 175
Length:175
Mass (Da):19,279
Last modified:October 1, 2003 - v1
Checksum:i4978232EE5C87FCD
GO
Isoform 2 (identifier: Q7Z4S9-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MYASSYPPPPQLSPRSHLCPPPPHPTPPQLNNLLLL → MPSGPLPRTSVVPRPTTAPQETRNGTADAASK
     57-84: Missing.

Note: No experimental confirmation available.

Show »
Length:143
Mass (Da):15,393
Checksum:i23C189EF52A7F044
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3636MYASS…NLLLL → MPSGPLPRTSVVPRPTTAPQ ETRNGTADAASK in isoform 2.
VSP_029014Add
BLAST
Alternative sequencei57 – 8428Missing in isoform 2.
VSP_029015Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti115 – 1151I → T in AAR98781. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF450483 mRNA. Translation: AAP97677.1.
AY517502 mRNA. Translation: AAR98781.1.
AC062037 Genomic DNA. No translation available.
CCDSiCCDS1976.1. [Q7Z4S9-1]
RefSeqiNP_940884.1. NM_198482.1. [Q7Z4S9-1]
UniGeneiHs.209542.

Genome annotation databases

EnsembliENST00000340326; ENSP00000341867; ENSG00000152292. [Q7Z4S9-1]
ENST00000389938; ENSP00000374588; ENSG00000152292. [Q7Z4S9-2]
GeneIDi284948.
KEGGihsa:284948.
UCSCiuc002spq.3. human. [Q7Z4S9-1]

Polymorphism databases

DMDMi74723338.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF450483 mRNA. Translation: AAP97677.1 .
AY517502 mRNA. Translation: AAR98781.1 .
AC062037 Genomic DNA. No translation available.
CCDSi CCDS1976.1. [Q7Z4S9-1 ]
RefSeqi NP_940884.1. NM_198482.1. [Q7Z4S9-1 ]
UniGenei Hs.209542.

3D structure databases

ProteinModelPortali Q7Z4S9.
SMRi Q7Z4S9. Positions 45-174.
ModBasei Search...
MobiDBi Search...

Polymorphism databases

DMDMi 74723338.

Proteomic databases

PaxDbi Q7Z4S9.
PRIDEi Q7Z4S9.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000340326 ; ENSP00000341867 ; ENSG00000152292 . [Q7Z4S9-1 ]
ENST00000389938 ; ENSP00000374588 ; ENSG00000152292 . [Q7Z4S9-2 ]
GeneIDi 284948.
KEGGi hsa:284948.
UCSCi uc002spq.3. human. [Q7Z4S9-1 ]

Organism-specific databases

CTDi 284948.
GeneCardsi GC02P085645.
HGNCi HGNC:30439. SH2D6.
HPAi HPA053873.
neXtProti NX_Q7Z4S9.
PharmGKBi PA162403243.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG45165.
HOGENOMi HOG000154312.
HOVERGENi HBG097730.
InParanoidi Q7Z4S9.
OMAi YENEENA.
OrthoDBi EOG7WMCKM.
PhylomeDBi Q7Z4S9.
TreeFami TF343096.

Enzyme and pathway databases

SignaLinki Q7Z4S9.

Miscellaneous databases

GenomeRNAii 284948.
NextBioi 95184.
PROi Q7Z4S9.

Gene expression databases

Bgeei Q7Z4S9.
CleanExi HS_SH2D6.
Genevestigatori Q7Z4S9.

Family and domain databases

Gene3Di 3.30.505.10. 1 hit.
InterProi IPR000980. SH2.
[Graphical view ]
Pfami PF00017. SH2. 1 hit.
[Graphical view ]
SMARTi SM00252. SH2. 1 hit.
[Graphical view ]
SUPFAMi SSF55550. SSF55550. 1 hit.
PROSITEi PS50001. SH2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. Zan Q., Guo J.H., Yu L.
    Submitted (NOV-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Testis.
  2. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

Entry informationi

Entry nameiSH2D6_HUMAN
AccessioniPrimary (citable) accession number: Q7Z4S9
Secondary accession number(s): A6ND14, Q6R306
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: October 1, 2003
Last modified: July 9, 2014
This is version 73 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi