Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q7Z4S9 (SH2D6_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 73. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
SH2 domain-containing protein 6
Gene names
Name:SH2D6
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length175 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Sequence similarities

Contains 1 SH2 domain.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
   DomainSH2 domain
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
None. [Check GOA]

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q7Z4S9-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q7Z4S9-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MYASSYPPPPQLSPRSHLCPPPPHPTPPQLNNLLLL → MPSGPLPRTSVVPRPTTAPQETRNGTADAASK
     57-84: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 175175SH2 domain-containing protein 6
PRO_0000308603

Regions

Domain65 – 173109SH2
Compositional bias7 – 2822Pro-rich

Natural variations

Alternative sequence1 – 3636MYASS…NLLLL → MPSGPLPRTSVVPRPTTAPQ ETRNGTADAASK in isoform 2.
VSP_029014
Alternative sequence57 – 8428Missing in isoform 2.
VSP_029015

Experimental info

Sequence conflict1151I → T in AAR98781. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 1, 2003. Version 1.
Checksum: 4978232EE5C87FCD

FASTA17519,279
        10         20         30         40         50         60 
MYASSYPPPP QLSPRSHLCP PPPHPTPPQL NNLLLLEGRK SSLPSVAPTG SASAAEDSDL 

        70         80         90        100        110        120 
LTQPWYSGNC DRYAVESALL HLQKDGAYTV RPSSGPHGSQ PFTLAVLLRG RVFNIPIRRL 

       130        140        150        160        170 
DGGRHYALGR EGRNREELFS SVAAMVQHFM WHPLPLVDRH SGSRELTCLL FPTKP 

« Hide

Isoform 2 [UniParc].

Checksum: 23C189EF52A7F044
Show »

FASTA14315,393

References

[1]Zan Q., Guo J.H., Yu L.
Submitted (NOV-2001) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Testis.
[2]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF450483 mRNA. Translation: AAP97677.1.
AY517502 mRNA. Translation: AAR98781.1.
AC062037 Genomic DNA. No translation available.
CCDSCCDS1976.1. [Q7Z4S9-1]
RefSeqNP_940884.1. NM_198482.1. [Q7Z4S9-1]
UniGeneHs.209542.

3D structure databases

ProteinModelPortalQ7Z4S9.
SMRQ7Z4S9. Positions 45-174.
ModBaseSearch...
MobiDBSearch...

Polymorphism databases

DMDM74723338.

Proteomic databases

PaxDbQ7Z4S9.
PRIDEQ7Z4S9.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000340326; ENSP00000341867; ENSG00000152292. [Q7Z4S9-1]
ENST00000389938; ENSP00000374588; ENSG00000152292. [Q7Z4S9-2]
GeneID284948.
KEGGhsa:284948.
UCSCuc002spq.3. human. [Q7Z4S9-1]

Organism-specific databases

CTD284948.
GeneCardsGC02P085645.
HGNCHGNC:30439. SH2D6.
HPAHPA053873.
neXtProtNX_Q7Z4S9.
PharmGKBPA162403243.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG45165.
HOGENOMHOG000154312.
HOVERGENHBG097730.
InParanoidQ7Z4S9.
OMAYENEENA.
OrthoDBEOG7WMCKM.
PhylomeDBQ7Z4S9.
TreeFamTF343096.

Enzyme and pathway databases

SignaLinkQ7Z4S9.

Gene expression databases

BgeeQ7Z4S9.
CleanExHS_SH2D6.
GenevestigatorQ7Z4S9.

Family and domain databases

Gene3D3.30.505.10. 1 hit.
InterProIPR000980. SH2.
[Graphical view]
PfamPF00017. SH2. 1 hit.
[Graphical view]
SMARTSM00252. SH2. 1 hit.
[Graphical view]
SUPFAMSSF55550. SSF55550. 1 hit.
PROSITEPS50001. SH2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi284948.
NextBio95184.
PROQ7Z4S9.

Entry information

Entry nameSH2D6_HUMAN
AccessionPrimary (citable) accession number: Q7Z4S9
Secondary accession number(s): A6ND14, Q6R306
Entry history
Integrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: October 1, 2003
Last modified: July 9, 2014
This is version 73 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human chromosome 2

Human chromosome 2: entries, gene names and cross-references to MIM