Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q7Z4S9

- SH2D6_HUMAN

UniProt

Q7Z4S9 - SH2D6_HUMAN

Protein

SH2 domain-containing protein 6

Gene

SH2D6

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 74 (01 Oct 2014)
      Sequence version 1 (01 Oct 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Enzyme and pathway databases

    SignaLinkiQ7Z4S9.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    SH2 domain-containing protein 6
    Gene namesi
    Name:SH2D6
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:30439. SH2D6.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA162403243.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 175175SH2 domain-containing protein 6PRO_0000308603Add
    BLAST

    Proteomic databases

    PaxDbiQ7Z4S9.
    PRIDEiQ7Z4S9.

    Expressioni

    Gene expression databases

    BgeeiQ7Z4S9.
    CleanExiHS_SH2D6.
    GenevestigatoriQ7Z4S9.

    Organism-specific databases

    HPAiHPA053873.

    Structurei

    3D structure databases

    ProteinModelPortaliQ7Z4S9.
    SMRiQ7Z4S9. Positions 45-174.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini65 – 173109SH2PROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi7 – 2822Pro-richAdd
    BLAST

    Sequence similaritiesi

    Contains 1 SH2 domain.PROSITE-ProRule annotation

    Keywords - Domaini

    SH2 domain

    Phylogenomic databases

    eggNOGiNOG45165.
    HOGENOMiHOG000154312.
    HOVERGENiHBG097730.
    InParanoidiQ7Z4S9.
    OMAiYENEENA.
    OrthoDBiEOG7WMCKM.
    PhylomeDBiQ7Z4S9.
    TreeFamiTF343096.

    Family and domain databases

    Gene3Di3.30.505.10. 1 hit.
    InterProiIPR000980. SH2.
    [Graphical view]
    PfamiPF00017. SH2. 1 hit.
    [Graphical view]
    SMARTiSM00252. SH2. 1 hit.
    [Graphical view]
    SUPFAMiSSF55550. SSF55550. 1 hit.
    PROSITEiPS50001. SH2. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q7Z4S9-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MYASSYPPPP QLSPRSHLCP PPPHPTPPQL NNLLLLEGRK SSLPSVAPTG    50
    SASAAEDSDL LTQPWYSGNC DRYAVESALL HLQKDGAYTV RPSSGPHGSQ 100
    PFTLAVLLRG RVFNIPIRRL DGGRHYALGR EGRNREELFS SVAAMVQHFM 150
    WHPLPLVDRH SGSRELTCLL FPTKP 175
    Length:175
    Mass (Da):19,279
    Last modified:October 1, 2003 - v1
    Checksum:i4978232EE5C87FCD
    GO
    Isoform 2 (identifier: Q7Z4S9-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-36: MYASSYPPPPQLSPRSHLCPPPPHPTPPQLNNLLLL → MPSGPLPRTSVVPRPTTAPQETRNGTADAASK
         57-84: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:143
    Mass (Da):15,393
    Checksum:i23C189EF52A7F044
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti115 – 1151I → T in AAR98781. 1 PublicationCurated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3636MYASS…NLLLL → MPSGPLPRTSVVPRPTTAPQ ETRNGTADAASK in isoform 2. 1 PublicationVSP_029014Add
    BLAST
    Alternative sequencei57 – 8428Missing in isoform 2. 1 PublicationVSP_029015Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF450483 mRNA. Translation: AAP97677.1.
    AY517502 mRNA. Translation: AAR98781.1.
    AC062037 Genomic DNA. No translation available.
    CCDSiCCDS1976.1. [Q7Z4S9-1]
    RefSeqiNP_940884.1. NM_198482.1. [Q7Z4S9-1]
    UniGeneiHs.209542.

    Genome annotation databases

    EnsembliENST00000340326; ENSP00000341867; ENSG00000152292. [Q7Z4S9-1]
    ENST00000389938; ENSP00000374588; ENSG00000152292. [Q7Z4S9-2]
    GeneIDi284948.
    KEGGihsa:284948.
    UCSCiuc002spq.3. human. [Q7Z4S9-1]

    Polymorphism databases

    DMDMi74723338.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF450483 mRNA. Translation: AAP97677.1 .
    AY517502 mRNA. Translation: AAR98781.1 .
    AC062037 Genomic DNA. No translation available.
    CCDSi CCDS1976.1. [Q7Z4S9-1 ]
    RefSeqi NP_940884.1. NM_198482.1. [Q7Z4S9-1 ]
    UniGenei Hs.209542.

    3D structure databases

    ProteinModelPortali Q7Z4S9.
    SMRi Q7Z4S9. Positions 45-174.
    ModBasei Search...
    MobiDBi Search...

    Polymorphism databases

    DMDMi 74723338.

    Proteomic databases

    PaxDbi Q7Z4S9.
    PRIDEi Q7Z4S9.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000340326 ; ENSP00000341867 ; ENSG00000152292 . [Q7Z4S9-1 ]
    ENST00000389938 ; ENSP00000374588 ; ENSG00000152292 . [Q7Z4S9-2 ]
    GeneIDi 284948.
    KEGGi hsa:284948.
    UCSCi uc002spq.3. human. [Q7Z4S9-1 ]

    Organism-specific databases

    CTDi 284948.
    GeneCardsi GC02P085645.
    HGNCi HGNC:30439. SH2D6.
    HPAi HPA053873.
    neXtProti NX_Q7Z4S9.
    PharmGKBi PA162403243.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG45165.
    HOGENOMi HOG000154312.
    HOVERGENi HBG097730.
    InParanoidi Q7Z4S9.
    OMAi YENEENA.
    OrthoDBi EOG7WMCKM.
    PhylomeDBi Q7Z4S9.
    TreeFami TF343096.

    Enzyme and pathway databases

    SignaLinki Q7Z4S9.

    Miscellaneous databases

    GenomeRNAii 284948.
    NextBioi 95184.
    PROi Q7Z4S9.

    Gene expression databases

    Bgeei Q7Z4S9.
    CleanExi HS_SH2D6.
    Genevestigatori Q7Z4S9.

    Family and domain databases

    Gene3Di 3.30.505.10. 1 hit.
    InterProi IPR000980. SH2.
    [Graphical view ]
    Pfami PF00017. SH2. 1 hit.
    [Graphical view ]
    SMARTi SM00252. SH2. 1 hit.
    [Graphical view ]
    SUPFAMi SSF55550. SSF55550. 1 hit.
    PROSITEi PS50001. SH2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Zan Q., Guo J.H., Yu L.
      Submitted (NOV-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Testis.
    2. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

    Entry informationi

    Entry nameiSH2D6_HUMAN
    AccessioniPrimary (citable) accession number: Q7Z4S9
    Secondary accession number(s): A6ND14, Q6R306
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 23, 2007
    Last sequence update: October 1, 2003
    Last modified: October 1, 2014
    This is version 74 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3