Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SH2 domain-containing protein 6

Gene

SH2D6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Functioni

Enzyme and pathway databases

SignaLinkiQ7Z4S9.

Names & Taxonomyi

Protein namesi
Recommended name:
SH2 domain-containing protein 6
Gene namesi
Name:SH2D6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:30439. SH2D6.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162403243.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 175175SH2 domain-containing protein 6PRO_0000308603Add
BLAST

Proteomic databases

PaxDbiQ7Z4S9.
PRIDEiQ7Z4S9.

Expressioni

Gene expression databases

BgeeiQ7Z4S9.
CleanExiHS_SH2D6.
GenevestigatoriQ7Z4S9.

Organism-specific databases

HPAiHPA053873.

Structurei

3D structure databases

ProteinModelPortaliQ7Z4S9.
SMRiQ7Z4S9. Positions 45-174.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini65 – 173109SH2PROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi7 – 2822Pro-richAdd
BLAST

Sequence similaritiesi

Contains 1 SH2 domain.PROSITE-ProRule annotation

Keywords - Domaini

SH2 domain

Phylogenomic databases

eggNOGiNOG45165.
GeneTreeiENSGT00530000063094.
HOGENOMiHOG000154312.
HOVERGENiHBG097730.
InParanoidiQ7Z4S9.
OMAiCDRYAVE.
OrthoDBiEOG7WMCKM.
PhylomeDBiQ7Z4S9.
TreeFamiTF343096.

Family and domain databases

Gene3Di3.30.505.10. 1 hit.
InterProiIPR000980. SH2.
[Graphical view]
PfamiPF00017. SH2. 1 hit.
[Graphical view]
SMARTiSM00252. SH2. 1 hit.
[Graphical view]
SUPFAMiSSF55550. SSF55550. 1 hit.
PROSITEiPS50001. SH2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7Z4S9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MYASSYPPPP QLSPRSHLCP PPPHPTPPQL NNLLLLEGRK SSLPSVAPTG
60 70 80 90 100
SASAAEDSDL LTQPWYSGNC DRYAVESALL HLQKDGAYTV RPSSGPHGSQ
110 120 130 140 150
PFTLAVLLRG RVFNIPIRRL DGGRHYALGR EGRNREELFS SVAAMVQHFM
160 170
WHPLPLVDRH SGSRELTCLL FPTKP
Length:175
Mass (Da):19,279
Last modified:October 1, 2003 - v1
Checksum:i4978232EE5C87FCD
GO
Isoform 2 (identifier: Q7Z4S9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MYASSYPPPPQLSPRSHLCPPPPHPTPPQLNNLLLL → MPSGPLPRTSVVPRPTTAPQETRNGTADAASK
     57-84: Missing.

Note: No experimental confirmation available.

Show »
Length:143
Mass (Da):15,393
Checksum:i23C189EF52A7F044
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti115 – 1151I → T in AAR98781 (Ref. 1) Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3636MYASS…NLLLL → MPSGPLPRTSVVPRPTTAPQ ETRNGTADAASK in isoform 2. 1 PublicationVSP_029014Add
BLAST
Alternative sequencei57 – 8428Missing in isoform 2. 1 PublicationVSP_029015Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF450483 mRNA. Translation: AAP97677.1.
AY517502 mRNA. Translation: AAR98781.1.
AC062037 Genomic DNA. No translation available.
CCDSiCCDS1976.1. [Q7Z4S9-1]
RefSeqiNP_940884.1. NM_198482.1. [Q7Z4S9-1]
UniGeneiHs.209542.

Genome annotation databases

EnsembliENST00000340326; ENSP00000341867; ENSG00000152292. [Q7Z4S9-1]
ENST00000389938; ENSP00000374588; ENSG00000152292. [Q7Z4S9-2]
GeneIDi284948.
KEGGihsa:284948.
UCSCiuc002spq.3. human. [Q7Z4S9-1]

Polymorphism databases

DMDMi74723338.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF450483 mRNA. Translation: AAP97677.1.
AY517502 mRNA. Translation: AAR98781.1.
AC062037 Genomic DNA. No translation available.
CCDSiCCDS1976.1. [Q7Z4S9-1]
RefSeqiNP_940884.1. NM_198482.1. [Q7Z4S9-1]
UniGeneiHs.209542.

3D structure databases

ProteinModelPortaliQ7Z4S9.
SMRiQ7Z4S9. Positions 45-174.
ModBaseiSearch...
MobiDBiSearch...

Polymorphism databases

DMDMi74723338.

Proteomic databases

PaxDbiQ7Z4S9.
PRIDEiQ7Z4S9.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000340326; ENSP00000341867; ENSG00000152292. [Q7Z4S9-1]
ENST00000389938; ENSP00000374588; ENSG00000152292. [Q7Z4S9-2]
GeneIDi284948.
KEGGihsa:284948.
UCSCiuc002spq.3. human. [Q7Z4S9-1]

Organism-specific databases

CTDi284948.
GeneCardsiGC02P085645.
HGNCiHGNC:30439. SH2D6.
HPAiHPA053873.
neXtProtiNX_Q7Z4S9.
PharmGKBiPA162403243.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG45165.
GeneTreeiENSGT00530000063094.
HOGENOMiHOG000154312.
HOVERGENiHBG097730.
InParanoidiQ7Z4S9.
OMAiCDRYAVE.
OrthoDBiEOG7WMCKM.
PhylomeDBiQ7Z4S9.
TreeFamiTF343096.

Enzyme and pathway databases

SignaLinkiQ7Z4S9.

Miscellaneous databases

GenomeRNAii284948.
NextBioi95184.
PROiQ7Z4S9.

Gene expression databases

BgeeiQ7Z4S9.
CleanExiHS_SH2D6.
GenevestigatoriQ7Z4S9.

Family and domain databases

Gene3Di3.30.505.10. 1 hit.
InterProiIPR000980. SH2.
[Graphical view]
PfamiPF00017. SH2. 1 hit.
[Graphical view]
SMARTiSM00252. SH2. 1 hit.
[Graphical view]
SUPFAMiSSF55550. SSF55550. 1 hit.
PROSITEiPS50001. SH2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. Zan Q., Guo J.H., Yu L.
    Submitted (NOV-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Testis.
  2. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

Entry informationi

Entry nameiSH2D6_HUMAN
AccessioniPrimary (citable) accession number: Q7Z4S9
Secondary accession number(s): A6ND14, Q6R306
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: October 1, 2003
Last modified: January 7, 2015
This is version 76 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.