Q7Z4S9 (SH2D6_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 63.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: SH2 domain-containing protein 6 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 175 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Sequence similarities | Contains 1 SH2 domain. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Domain | SH2 domain |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q7Z4S9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q7Z4S9-2) The sequence of this isoform differs from the canonical sequence as follows: 1-36: MYASSYPPPPQLSPRSHLCPPPPHPTPPQLNNLLLL → MPSGPLPRTSVVPRPTTAPQETRNGTADAASK 57-84: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 175 | 175 | SH2 domain-containing protein 6 | PRO_0000308603 | |||||
Regions | |||||||||
| Domain | 65 – 173 | 109 | SH2 | ||||||
| Compositional bias | 7 – 28 | 22 | Pro-rich | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 36 | 36 | MYASS…NLLLL → MPSGPLPRTSVVPRPTTAPQ ETRNGTADAASK in isoform 2. | VSP_029014 | |||||
| Alternative sequence | 57 – 84 | 28 | Missing in isoform 2. | VSP_029015 | |||||
Experimental info | |||||||||
| Sequence conflict | 115 | 1 | I → T in AAR98781. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | Zan Q., Guo J.H., Yu L. Submitted (NOV-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Testis. |
| [2] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF450483 mRNA. Translation: AAP97677.1. AY517502 mRNA. Translation: AAR98781.1. AC062037 Genomic DNA. No translation available. |
| IPI | IPI00394759. IPI00401786. |
| RefSeq | NP_940884.1. NM_198482.1. |
| UniGene | Hs.209542. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1AYA based on UniProtKB P35235. |
| ProteinModelPortal | Q7Z4S9. |
| ModBase | Search... |
Polymorphism databases | |
| DMDM | 74723338. |
Proteomic databases | |
| PaxDb | Q7Z4S9. |
| PRIDE | Q7Z4S9. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000340326; ENSP00000341867; ENSG00000152292. ENST00000389938; ENSP00000374588; ENSG00000152292. |
| GeneID | 284948. |
| KEGG | hsa:284948. |
| UCSC | uc002spq.3. human. |
Organism-specific databases | |
| CTD | 284948. |
| GeneCards | GC02P085645. |
| HGNC | HGNC:30439. SH2D6. |
| HPA | HPA053873. |
| neXtProt | NX_Q7Z4S9. |
| PharmGKB | PA162403243. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG45165. |
| HOGENOM | HOG000154312. |
| HOVERGEN | HBG097730. |
| InParanoid | Q7Z4S9. |
| OMA | CDRYAVE. |
| PhylomeDB | Q7Z4S9. |
Gene expression databases | |
| Bgee | Q7Z4S9. |
| CleanEx | HS_SH2D6. |
| Genevestigator | Q7Z4S9. |
Family and domain databases | |
| Gene3D | 3.30.505.10. 1 hit. |
| InterPro | IPR000980. SH2. [Graphical view] |
| Pfam | PF00017. SH2. 1 hit. [Graphical view] |
| SMART | SM00252. SH2. 1 hit. [Graphical view] |
| PROSITE | PS50001. SH2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 284948. |
| NextBio | 95184. |
Entry information
| Entry name | SH2D6_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q7Z4S9 Secondary accession number(s): A6ND14, Q6R306 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with
