Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q7Z4S6 (KI21A_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 115. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Kinesin-like protein KIF21A
Alternative name(s):
Kinesin-like protein KIF2
Renal carcinoma antigen NY-REN-62
Gene names
Name:KIF21A
Synonyms:KIAA1708, KIF2
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1674 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Microtubule-binding motor protein probably involved in neuronal axonal transport. In vitro, has a plus-end directed motor activity By similarity.

Subcellular location

Cytoplasmcytoskeleton Probable.

Involvement in disease

Congenital fibrosis of extraocular muscles 1 (CFEOM1) [MIM:135700]: A congenital ocular motility disorder marked by restrictive ophthalmoplegia affecting extraocular muscles innervated by the oculomotor and/or trochlear nerves. It is clinically characterized by anchoring of the eyes in downward gaze, ptosis, and backward tilt of the head. Patients affected by congenital fibrosis of extraocular muscles type 1 show an absence of the superior division of the oculomotor nerve (cranial nerve III) and corresponding oculomotor subnuclei.
Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.1 Ref.21

Sequence similarities

Belongs to the kinesin-like protein family.

Contains 1 kinesin-motor domain.

Contains 7 WD repeats.

Sequence caution

The sequence AAD42883.1 differs from that shown. Reason: Frameshift at positions 185, 191, 380 and 405.

The sequence AAH41430.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.

The sequence AAP97680.1 differs from that shown. Reason: Frameshift at positions 185 and 191.

The sequence BAA90916.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.

Ontologies

Keywords
   Cellular componentCytoplasm
Cytoskeleton
Microtubule
   Coding sequence diversityAlternative splicing
   DiseaseDisease mutation
   DomainCoiled coil
Repeat
WD repeat
   LigandATP-binding
Nucleotide-binding
   Molecular functionMotor protein
   PTMAcetylation
Phosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processmicrotubule-based movement

Inferred from electronic annotation. Source: InterPro

   Cellular_componentcytoplasm

Inferred from electronic annotation. Source: UniProtKB-KW

kinesin complex

Inferred from electronic annotation. Source: InterPro

microtubule

Inferred from electronic annotation. Source: UniProtKB-KW

   Molecular_functionATP binding

Inferred from electronic annotation. Source: UniProtKB-KW

microtubule motor activity

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Binary interactions

Alternative products

This entry describes 6 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q7Z4S6-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q7Z4S6-2)

The sequence of this isoform differs from the canonical sequence as follows:
     558-570: Missing.
Isoform 3 (identifier: Q7Z4S6-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1260-1319: HSDSGTSEASLSPPSSPPSRPRNELNVFNRLTVSQGNTSVQQDKSDESDSSLSEVHRSSR → QSDESDSSLSEVH
Note: No experimental confirmation available.
Isoform 4 (identifier: Q7Z4S6-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1315-1315: H → HS
Note: No experimental confirmation available.
Isoform 5 (identifier: Q7Z4S6-5)

The sequence of this isoform differs from the canonical sequence as follows:
     558-570: Missing.
     1107-1113: Missing.
     1304-1320: Missing.
Isoform 6 (identifier: Q7Z4S6-6)

The sequence of this isoform differs from the canonical sequence as follows:
     558-570: Missing.
     807-829: Missing.
     1304-1320: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 16741674Kinesin-like protein KIF21A
PRO_0000125462

Regions

Domain1 – 299299Kinesin-motor
Repeat1345 – 138238WD 1
Repeat1385 – 142339WD 2
Repeat1449 – 148739WD 3
Repeat1490 – 153243WD 4
Repeat1541 – 157838WD 5
Repeat1582 – 162140WD 6
Repeat1624 – 166138WD 7
Nucleotide binding88 – 958ATP By similarity
Coiled coil365 – 575211 Potential
Coiled coil931 – 101989 Potential
Coiled coil1053 – 108331 Potential

Amino acid modifications

Modified residue11N-acetylmethionine Ref.19
Modified residue5241Phosphoserine Ref.16
Modified residue12121Phosphoserine Ref.13 Ref.16 Ref.18
Modified residue12391Phosphoserine Ref.13 Ref.16 Ref.18
Modified residue16621Phosphoserine Ref.16
Modified residue16641Phosphothreonine Ref.16
Modified residue16731Phosphoserine Ref.13 Ref.16

Natural variations

Alternative sequence558 – 57013Missing in isoform 2, isoform 5 and isoform 6.
VSP_010870
Alternative sequence807 – 82923Missing in isoform 6.
VSP_046790
Alternative sequence1107 – 11137Missing in isoform 5.
VSP_046791
Alternative sequence1260 – 131960HSDSG…HRSSR → QSDESDSSLSEVH in isoform 3.
VSP_010871
Alternative sequence1304 – 132017Missing in isoform 5 and isoform 6.
VSP_046792
Alternative sequence13151H → HS in isoform 4.
VSP_010872
Natural variant3561M → T in CFEOM1. Ref.1
VAR_019399
Natural variant9471M → R in CFEOM1. Ref.1
VAR_019400
Natural variant9471M → T in CFEOM1. Ref.21
VAR_027021
Natural variant9471M → V in CFEOM1. Ref.1
VAR_019401
Natural variant9541R → Q in CFEOM1. Ref.1
VAR_019402
Natural variant9541R → W in CFEOM1. Ref.1
VAR_019403
Natural variant10101I → T in CFEOM1. Ref.1
VAR_019404

Experimental info

Sequence conflict1721K → R in CAJ45483. Ref.2
Sequence conflict1761R → G in CAJ45483. Ref.2
Sequence conflict2151A → G in CAJ45483. Ref.2
Sequence conflict3151S → C in CAJ45483. Ref.2
Sequence conflict596 – 5972NN → TQ in AAP97680. Ref.3
Sequence conflict596 – 5972NN → TQ in AAD42883. Ref.8
Sequence conflict6531E → D in AAP97680. Ref.3
Sequence conflict801 – 8022DQ → AP in AAP97680. Ref.3
Sequence conflict8011D → G in CAJ45483. Ref.2
Sequence conflict8131E → G in AAP97680. Ref.3
Sequence conflict8261K → Q in AAP97680. Ref.3
Sequence conflict8751R → G in CAJ45483. Ref.2
Sequence conflict8921L → S in CAJ45483. Ref.2
Sequence conflict10711Q → R in CAJ45483. Ref.2
Sequence conflict11671D → G in CAJ45483. Ref.2
Sequence conflict12371E → D in AAI36415. Ref.7
Sequence conflict13411H → N in CAJ45483. Ref.2
Sequence conflict1378 – 13792QE → HR in CAJ45483. Ref.2
Sequence conflict14291G → A in CAJ45483. Ref.2
Sequence conflict15031I → T in CAD97863. Ref.11
Sequence conflict15111I → T in CAD97863. Ref.11

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 19, 2004. Version 2.
Checksum: 292AFA5F2C0C6F9A

FASTA1,674187,179
        10         20         30         40         50         60 
MLGAPDESSV RVAVRIRPQL AKEKIEGCHI CTSVTPGEPQ VFLGKDKAFT FDYVFDIDSQ 

        70         80         90        100        110        120 
QEQIYIQCIE KLIEGCFEGY NATVFAYGQT GAGKTYTMGT GFDVNIVEEE LGIISRAVKH 

       130        140        150        160        170        180 
LFKSIEEKKH IAIKNGLPAP DFKVNAQFLE LYNEEVLDLF DTTRDIDAKS KKSNIRIHED 

       190        200        210        220        230        240 
STGGIYTVGV TTRTVNTESE MMQCLKLGAL SRTTASTQMN VQSSRSHAIF TIHVCQTRVC 

       250        260        270        280        290        300 
PQIDADNATD NKIISESAQM NEFETLTAKF HFVDLAGSER LKRTGATGER AKEGISINCG 

       310        320        330        340        350        360 
LLALGNVISA LGDKSKRATH VPYRDSKLTR LLQDSLGGNS QTIMIACVSP SDRDFMETLN 

       370        380        390        400        410        420 
TLKYANRARN IKNKVMVNQD RASQQINALR SEITRLQMEL MEYKTGKRII DEEGVESIND 

       430        440        450        460        470        480 
MFHENAMLQT ENNNLRVRIK AMQETVDALR SRITQLVSDQ ANHVLARAGE GNEEISNMIH 

       490        500        510        520        530        540 
SYIKEIEDLR AKLLESEAVN ENLRKNLTRA TARAPYFSGS STFSPTILSS DKETIEIIDL 

       550        560        570        580        590        600 
AKKDLEKLKR KEKRKKKRLQ KLEESNREER SVAGKEDNTD TDQEKKEEKG VSERENNELE 

       610        620        630        640        650        660 
VEESQEVSDH EDEEEEEEEE EDDIDGGESS DESDSESDEK ANYQADLANI TCEIAIKQKL 

       670        680        690        700        710        720 
IDELENSQKR LQTLKKQYEE KLMMLQHKIR DTQLERDQVL QNLGSVESYS EEKAKKVRSE 

       730        740        750        760        770        780 
YEKKLQAMNK ELQRLQAAQK EHARLLKNQS QYEKQLKKLQ QDVMEMKKTK VRLMKQMKEE 

       790        800        810        820        830        840 
QEKARLTESR RNREIAQLKK DQRKRDHQLR LLEAQKRNQE VVLRRKTEEV TALRRQVRPM 

       850        860        870        880        890        900 
SDKVAGKVTR KLSSSDAPAQ DTGSSAAAVE TDASRTGAQQ KMRIPVARVQ ALPTPATNGN 

       910        920        930        940        950        960 
RKKYQRKGLT GRVFISKTAR MKWQLLERRV TDIIMQKMTI SNMEADMNRL LKQREELTKR 

       970        980        990       1000       1010       1020 
REKLSKRREK IVKENGEGDK NVANINEEME SLTANIDYIN DSISDCQANI MQMEEAKEEG 

      1030       1040       1050       1060       1070       1080 
ETLDVTAVIN ACTLTEARYL LDHFLSMGIN KGLQAAQKEA QIKVLEGRLK QTEITSATQN 

      1090       1100       1110       1120       1130       1140 
QLLFHMLKEK AELNPELDAL LGHALQDLDS VPLENVEDST DEDAPLNSPG SEGSTLSSDL 

      1150       1160       1170       1180       1190       1200 
MKLCGEVKPK NKARRRTTTQ MELLYADSSE LASDTSTGDA SLPGPLTPVA EGQEIGMNTE 

      1210       1220       1230       1240       1250       1260 
TSGTSAREKE LSPPPGLPSK IGSISRQSSL SEKKIPEPSP VTRRKAYEKA EKSKAKEQKH 

      1270       1280       1290       1300       1310       1320 
SDSGTSEASL SPPSSPPSRP RNELNVFNRL TVSQGNTSVQ QDKSDESDSS LSEVHRSSRR 

      1330       1340       1350       1360       1370       1380 
GIINPFPASK GIRAFPLQCI HIAEGHTKAV LCVDSTDDLL FTGSKDRTCK VWNLVTGQEI 

      1390       1400       1410       1420       1430       1440 
MSLGGHPNNV VSVKYCNYTS LVFTVSTSYI KVWDIRDSAK CIRTLTSSGQ VTLGDACSAS 

      1450       1460       1470       1480       1490       1500 
TSRTVAIPSG ENQINQIALN PTGTFLYAAS GNAVRMWDLK RFQSTGKLTG HLGPVMCLTV 

      1510       1520       1530       1540       1550       1560 
DQISSGQDLI ITGSKDHYIK MFDVTEGALG TVSPTHNFEP PHYDGIEALT IQGDNLFSGS 

      1570       1580       1590       1600       1610       1620 
RDNGIKKWDL TQKDLLQQVP NAHKDWVCAL GVVPDHPVLL SGCRGGILKV WNMDTFMPVG 

      1630       1640       1650       1660       1670 
EMKGHDSPIN AICVNSTHIF TAADDRTVRI WKARNLQDGQ ISDTGDLGED IASN 

« Hide

Isoform 2 [UniParc].

Checksum: 62AAF4804167A918
Show »

FASTA1,661185,510
Isoform 3 [UniParc].

Checksum: B4B2415E2E95010F
Show »

FASTA1,627182,129
Isoform 4 [UniParc].

Checksum: DA1BD09FE7D3C1AF
Show »

FASTA1,675187,266
Isoform 5 [UniParc].

Checksum: C65E7231C1EEA1B1
Show »

FASTA1,637182,854
Isoform 6 [UniParc].

Checksum: C58AFA881A960A85
Show »

FASTA1,621180,738

References

« Hide 'large scale' references
[1]"Heterozygous mutations of the kinesin KIF21A in congenital fibrosis of the extraocular muscles type 1 (CFEOM1)."
Yamada K., Andrews C., Chan W.M., McKeown C.A., Magli A., De Berardinis T., Loewenstein A., Lazar M., O'Keefe M., Letson R., London A., Ruttum M., Matsumoto N., Saito N., Morris L., Monte M.D., Johnson R.H., Uyama E. expand/collapse author list , Houtman W.A., De Vries B., Carlow T.J., Hart B.L., Krawiecki N., Shoffner J., Vogel M.C., Katowitz J., Goldstein S.M., Levin A.V., Sener E.C., Ozturk B.T., Akarsu A.N., Brodsky M.C., Hanisch F., Cruse R.P., Zubcov A.A., Robb R.M., Roggenkaemper P., Gottlob I., Kowal L., Battu R., Traboulsi E.I., Franceschini P., Newlin A., Demer J.L., Engle E.C.
Nat. Genet. 35:318-321(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS CFEOM1 THR-356; ARG-947; VAL-947; GLN-954; TRP-954 AND THR-1010.
[2]"Differential expression analysis of molecular motors in ALS motor neuron disease."
Pantelidou M., Lederer C.W., Zographos S.E., Pfaffl M.W., Cavallaro S., Santama N.
Submitted (DEC-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6).
Tissue: Brain cortex.
[3]Zan Q., Guo J.H., Yu L.
Submitted (NOV-2001) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
[4]"Multiplex amplification and cloning of 5'-ends of cDNA by ligase-free recombination: preparation of full-length cDNA clones encoding motor proteins."
Yamakawa H., Kikuno R.F., Nagase T., Ohara O.
Submitted (JAN-2007) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Brain.
[5]"The finished DNA sequence of human chromosome 12."
Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. expand/collapse author list , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-543 (ISOFORMS 1/2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1243-1674 (ISOFORM 4).
Tissue: Adrenal cortex, Brain and Testis.
[8]"Antigens recognized by autologous antibody in patients with renal-cell carcinoma."
Scanlan M.J., Gordan J.D., Williamson B., Stockert E., Bander N.H., Jongeneel C.V., Gure A.O., Jaeger D., Jaeger E., Knuth A., Chen Y.-T., Old L.J.
Int. J. Cancer 83:456-464(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-597 (ISOFORM 2), IDENTIFICATION AS A RENAL CANCER ANTIGEN.
[9]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-586 (ISOFORM 2).
Tissue: Colon.
[10]"Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Kikuno R., Hattori A., Kondo Y., Okumura K., Ohara O.
DNA Res. 7:347-355(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 5-1674 (ISOFORM 2).
Tissue: Brain.
[11]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 654-1674 (ISOFORM 3).
Tissue: Liver.
[12]"Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[13]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1212; SER-1239 AND SER-1673, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[14]"Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[15]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[16]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-524; SER-1212; SER-1239; SER-1662; THR-1664 AND SER-1673, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[17]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[18]"System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1212 AND SER-1239, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[19]"Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[20]"N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB."
Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.
Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[21]"A novel KIF21A mutation in a patient with congenital fibrosis of the extraocular muscles and Marcus Gunn jaw-winking phenomenon."
Yamada K., Hunter D.G., Andrews C., Engle E.C.
Arch. Ophthalmol. 123:1254-1259(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT CFEOM1 THR-947.
+Additional computationally mapped references.

Web resources

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY368076 mRNA. Translation: AAR04774.1.
AM177179 mRNA. Translation: CAJ45483.1.
AF450487 mRNA. Translation: AAP97680.1. Frameshift.
AB290166 mRNA. Translation: BAG06720.1.
AC084373 Genomic DNA. No translation available.
AC090668 Genomic DNA. No translation available.
AC121334 Genomic DNA. No translation available.
AF155117 mRNA. Translation: AAD42883.1. Sequence problems.
AK000059 mRNA. Translation: BAA90916.1. Sequence problems.
CH471111 Genomic DNA. Translation: EAW57803.1.
BC041430 mRNA. Translation: AAH41430.1. Sequence problems.
BC047572 mRNA. Translation: AAH47572.1.
BC136414 mRNA. Translation: AAI36415.1.
AB051495 mRNA. Translation: BAB21799.2.
BX537855 mRNA. Translation: CAD97863.1.
RefSeqNP_001166934.1. NM_001173463.1.
NP_001166935.1. NM_001173464.1.
NP_001166936.1. NM_001173465.1.
NP_060111.2. NM_017641.3.
XP_005269064.1. XM_005269007.1.
XP_005269070.1. XM_005269013.1.
UniGeneHs.374201.

3D structure databases

ProteinModelPortalQ7Z4S6.
SMRQ7Z4S6. Positions 6-398, 1338-1660.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid120746. 5 interactions.
DIPDIP-56253N.
IntActQ7Z4S6. 5 interactions.
MINTMINT-2808104.

PTM databases

PhosphoSiteQ7Z4S6.

Polymorphism databases

DMDM50400977.

Proteomic databases

PaxDbQ7Z4S6.
PeptideAtlasQ7Z4S6.
PRIDEQ7Z4S6.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000361418; ENSP00000354878; ENSG00000139116. [Q7Z4S6-1]
ENST00000361961; ENSP00000354851; ENSG00000139116. [Q7Z4S6-2]
ENST00000541463; ENSP00000438075; ENSG00000139116. [Q7Z4S6-6]
ENST00000544797; ENSP00000445606; ENSG00000139116. [Q7Z4S6-5]
GeneID55605.
KEGGhsa:55605.
UCSCuc001rlx.3. human. [Q7Z4S6-2]
uc001rly.3. human. [Q7Z4S6-1]

Organism-specific databases

CTD55605.
GeneCardsGC12M039687.
HGNCHGNC:19349. KIF21A.
HPACAB022079.
MIM135700. phenotype.
608283. gene.
neXtProtNX_Q7Z4S6.
Orphanet45358. Congenital fibrosis of extraocular muscles.
PharmGKBPA134882934.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG2319.
HOVERGENHBG052247.
KOK10395.
PhylomeDBQ7Z4S6.
TreeFamTF105224.

Enzyme and pathway databases

SignaLinkQ7Z4S6.

Gene expression databases

ArrayExpressQ7Z4S6.
BgeeQ7Z4S6.
CleanExHS_KIF21A.
GenevestigatorQ7Z4S6.

Family and domain databases

Gene3D2.130.10.10. 1 hit.
3.40.850.10. 1 hit.
InterProIPR027640. Kinesin-like_fam.
IPR019821. Kinesin_motor_CS.
IPR001752. Kinesin_motor_dom.
IPR027417. P-loop_NTPase.
IPR009053. Prefoldin.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PANTHERPTHR24115. PTHR24115. 1 hit.
PfamPF00225. Kinesin. 1 hit.
PF00400. WD40. 4 hits.
[Graphical view]
PRINTSPR00380. KINESINHEAVY.
SMARTSM00129. KISc. 1 hit.
SM00320. WD40. 7 hits.
[Graphical view]
SUPFAMSSF46579. SSF46579. 1 hit.
SSF50978. SSF50978. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEPS00411. KINESIN_MOTOR_DOMAIN1. 1 hit.
PS50067. KINESIN_MOTOR_DOMAIN2. 1 hit.
PS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 4 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSKIF21A. human.
GeneWikiKIF21A.
GenomeRNAi55605.
NextBio60157.
PROQ7Z4S6.
SOURCESearch...

Entry information

Entry nameKI21A_HUMAN
AccessionPrimary (citable) accession number: Q7Z4S6
Secondary accession number(s): A8MX28 expand/collapse secondary AC list , B0I1R9, B9EGE4, F5H0C3, F5H219, Q2UVF1, Q6UKL9, Q7Z668, Q86WZ5, Q8IVZ8, Q9C0F5, Q9NXU4, Q9Y590
Entry history
Integrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: July 19, 2004
Last modified: April 16, 2014
This is version 115 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 12

Human chromosome 12: entries, gene names and cross-references to MIM