SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q7Z4S6

- KI21A_HUMAN

UniProt

Q7Z4S6 - KI21A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Kinesin-like protein KIF21A
Gene
KIF21A, KIAA1708, KIF2
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Microtubule-binding motor protein probably involved in neuronal axonal transport. In vitro, has a plus-end directed motor activity By similarity.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi88 – 958ATP By similarity

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. microtubule motor activity Source: InterPro
  3. protein binding Source: IntAct

GO - Biological processi

  1. microtubule-based movement Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Motor protein

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

SignaLinkiQ7Z4S6.

Names & Taxonomyi

Protein namesi
Recommended name:
Kinesin-like protein KIF21A
Alternative name(s):
Kinesin-like protein KIF2
Renal carcinoma antigen NY-REN-62
Gene namesi
Name:KIF21A
Synonyms:KIAA1708, KIF2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:19349. KIF21A.

Subcellular locationi

Cytoplasmcytoskeleton Inferred

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-KW
  2. kinesin complex Source: InterPro
  3. microtubule Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

Pathology & Biotechi

Involvement in diseasei

Congenital fibrosis of extraocular muscles 1 (CFEOM1) [MIM:135700]: A congenital ocular motility disorder marked by restrictive ophthalmoplegia affecting extraocular muscles innervated by the oculomotor and/or trochlear nerves. It is clinically characterized by anchoring of the eyes in downward gaze, ptosis, and backward tilt of the head. Patients affected by congenital fibrosis of extraocular muscles type 1 show an absence of the superior division of the oculomotor nerve (cranial nerve III) and corresponding oculomotor subnuclei.
Note: The disease is caused by mutations affecting the gene represented in this entry.2 Publications
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti356 – 3561M → T in CFEOM1. 1 Publication
VAR_019399
Natural varianti947 – 9471M → R in CFEOM1. 1 Publication
VAR_019400
Natural varianti947 – 9471M → T in CFEOM1. 1 Publication
VAR_027021
Natural varianti947 – 9471M → V in CFEOM1. 1 Publication
VAR_019401
Natural varianti954 – 9541R → Q in CFEOM1. 1 Publication
VAR_019402
Natural varianti954 – 9541R → W in CFEOM1. 1 Publication
VAR_019403
Natural varianti1010 – 10101I → T in CFEOM1. 1 Publication
VAR_019404

Keywords - Diseasei

Disease mutation

Organism-specific databases

MIMi135700. phenotype.
Orphaneti45358. Congenital fibrosis of extraocular muscles.
PharmGKBiPA134882934.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 16741674Kinesin-like protein KIF21A
PRO_0000125462Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionine1 Publication
Modified residuei524 – 5241Phosphoserine1 Publication
Modified residuei1212 – 12121Phosphoserine3 Publications
Modified residuei1239 – 12391Phosphoserine3 Publications
Modified residuei1662 – 16621Phosphoserine1 Publication
Modified residuei1664 – 16641Phosphothreonine1 Publication
Modified residuei1673 – 16731Phosphoserine2 Publications

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ7Z4S6.
PaxDbiQ7Z4S6.
PeptideAtlasiQ7Z4S6.
PRIDEiQ7Z4S6.

PTM databases

PhosphoSiteiQ7Z4S6.

Expressioni

Gene expression databases

ArrayExpressiQ7Z4S6.
BgeeiQ7Z4S6.
CleanExiHS_KIF21A.
GenevestigatoriQ7Z4S6.

Organism-specific databases

HPAiCAB022079.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
ARFGEF1Q9Y6D64EBI-6251716,EBI-1044254
KANK1Q146782EBI-2691397,EBI-2556221
KANK1Q14678-23EBI-2691397,EBI-6173812

Protein-protein interaction databases

BioGridi120746. 5 interactions.
DIPiDIP-56253N.
IntActiQ7Z4S6. 5 interactions.
MINTiMINT-2808104.

Structurei

3D structure databases

ProteinModelPortaliQ7Z4S6.
SMRiQ7Z4S6. Positions 10-379, 1308-1655.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini9 – 371363Kinesin motor
Add
BLAST
Repeati1345 – 138238WD 1
Add
BLAST
Repeati1385 – 142339WD 2
Add
BLAST
Repeati1449 – 148739WD 3
Add
BLAST
Repeati1490 – 153243WD 4
Add
BLAST
Repeati1541 – 157838WD 5
Add
BLAST
Repeati1582 – 162140WD 6
Add
BLAST
Repeati1624 – 166138WD 7
Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili365 – 575211 Reviewed prediction
Add
BLAST
Coiled coili931 – 101989 Reviewed prediction
Add
BLAST
Coiled coili1053 – 108331 Reviewed prediction
Add
BLAST

Sequence similaritiesi

Contains 7 WD repeats.

Keywords - Domaini

Coiled coil, Repeat, WD repeat

Phylogenomic databases

eggNOGiCOG2319.
HOVERGENiHBG052247.
KOiK10395.
PhylomeDBiQ7Z4S6.
TreeFamiTF105224.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
3.40.850.10. 1 hit.
InterProiIPR027640. Kinesin-like_fam.
IPR019821. Kinesin_motor_CS.
IPR001752. Kinesin_motor_dom.
IPR027417. P-loop_NTPase.
IPR009053. Prefoldin.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PANTHERiPTHR24115. PTHR24115. 1 hit.
PfamiPF00225. Kinesin. 1 hit.
PF00400. WD40. 4 hits.
[Graphical view]
PRINTSiPR00380. KINESINHEAVY.
SMARTiSM00129. KISc. 1 hit.
SM00320. WD40. 7 hits.
[Graphical view]
SUPFAMiSSF46579. SSF46579. 1 hit.
SSF50978. SSF50978. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEiPS00411. KINESIN_MOTOR_1. 1 hit.
PS50067. KINESIN_MOTOR_2. 1 hit.
PS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 4 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q7Z4S6-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MLGAPDESSV RVAVRIRPQL AKEKIEGCHI CTSVTPGEPQ VFLGKDKAFT     50
FDYVFDIDSQ QEQIYIQCIE KLIEGCFEGY NATVFAYGQT GAGKTYTMGT 100
GFDVNIVEEE LGIISRAVKH LFKSIEEKKH IAIKNGLPAP DFKVNAQFLE 150
LYNEEVLDLF DTTRDIDAKS KKSNIRIHED STGGIYTVGV TTRTVNTESE 200
MMQCLKLGAL SRTTASTQMN VQSSRSHAIF TIHVCQTRVC PQIDADNATD 250
NKIISESAQM NEFETLTAKF HFVDLAGSER LKRTGATGER AKEGISINCG 300
LLALGNVISA LGDKSKRATH VPYRDSKLTR LLQDSLGGNS QTIMIACVSP 350
SDRDFMETLN TLKYANRARN IKNKVMVNQD RASQQINALR SEITRLQMEL 400
MEYKTGKRII DEEGVESIND MFHENAMLQT ENNNLRVRIK AMQETVDALR 450
SRITQLVSDQ ANHVLARAGE GNEEISNMIH SYIKEIEDLR AKLLESEAVN 500
ENLRKNLTRA TARAPYFSGS STFSPTILSS DKETIEIIDL AKKDLEKLKR 550
KEKRKKKRLQ KLEESNREER SVAGKEDNTD TDQEKKEEKG VSERENNELE 600
VEESQEVSDH EDEEEEEEEE EDDIDGGESS DESDSESDEK ANYQADLANI 650
TCEIAIKQKL IDELENSQKR LQTLKKQYEE KLMMLQHKIR DTQLERDQVL 700
QNLGSVESYS EEKAKKVRSE YEKKLQAMNK ELQRLQAAQK EHARLLKNQS 750
QYEKQLKKLQ QDVMEMKKTK VRLMKQMKEE QEKARLTESR RNREIAQLKK 800
DQRKRDHQLR LLEAQKRNQE VVLRRKTEEV TALRRQVRPM SDKVAGKVTR 850
KLSSSDAPAQ DTGSSAAAVE TDASRTGAQQ KMRIPVARVQ ALPTPATNGN 900
RKKYQRKGLT GRVFISKTAR MKWQLLERRV TDIIMQKMTI SNMEADMNRL 950
LKQREELTKR REKLSKRREK IVKENGEGDK NVANINEEME SLTANIDYIN 1000
DSISDCQANI MQMEEAKEEG ETLDVTAVIN ACTLTEARYL LDHFLSMGIN 1050
KGLQAAQKEA QIKVLEGRLK QTEITSATQN QLLFHMLKEK AELNPELDAL 1100
LGHALQDLDS VPLENVEDST DEDAPLNSPG SEGSTLSSDL MKLCGEVKPK 1150
NKARRRTTTQ MELLYADSSE LASDTSTGDA SLPGPLTPVA EGQEIGMNTE 1200
TSGTSAREKE LSPPPGLPSK IGSISRQSSL SEKKIPEPSP VTRRKAYEKA 1250
EKSKAKEQKH SDSGTSEASL SPPSSPPSRP RNELNVFNRL TVSQGNTSVQ 1300
QDKSDESDSS LSEVHRSSRR GIINPFPASK GIRAFPLQCI HIAEGHTKAV 1350
LCVDSTDDLL FTGSKDRTCK VWNLVTGQEI MSLGGHPNNV VSVKYCNYTS 1400
LVFTVSTSYI KVWDIRDSAK CIRTLTSSGQ VTLGDACSAS TSRTVAIPSG 1450
ENQINQIALN PTGTFLYAAS GNAVRMWDLK RFQSTGKLTG HLGPVMCLTV 1500
DQISSGQDLI ITGSKDHYIK MFDVTEGALG TVSPTHNFEP PHYDGIEALT 1550
IQGDNLFSGS RDNGIKKWDL TQKDLLQQVP NAHKDWVCAL GVVPDHPVLL 1600
SGCRGGILKV WNMDTFMPVG EMKGHDSPIN AICVNSTHIF TAADDRTVRI 1650
WKARNLQDGQ ISDTGDLGED IASN 1674
Length:1,674
Mass (Da):187,179
Last modified:July 19, 2004 - v2
Checksum:i292AFA5F2C0C6F9A
GO
Isoform 2 (identifier: Q7Z4S6-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     558-570: Missing.

Show »
Length:1,661
Mass (Da):185,510
Checksum:i62AAF4804167A918
GO
Isoform 3 (identifier: Q7Z4S6-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1260-1319: HSDSGTSEASLSPPSSPPSRPRNELNVFNRLTVSQGNTSVQQDKSDESDSSLSEVHRSSR → QSDESDSSLSEVH

Note: No experimental confirmation available.

Show »
Length:1,627
Mass (Da):182,129
Checksum:iB4B2415E2E95010F
GO
Isoform 4 (identifier: Q7Z4S6-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1315-1315: H → HS

Note: No experimental confirmation available.

Show »
Length:1,675
Mass (Da):187,266
Checksum:iDA1BD09FE7D3C1AF
GO
Isoform 5 (identifier: Q7Z4S6-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     558-570: Missing.
     1107-1113: Missing.
     1304-1320: Missing.

Show »
Length:1,637
Mass (Da):182,854
Checksum:iC65E7231C1EEA1B1
GO
Isoform 6 (identifier: Q7Z4S6-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     558-570: Missing.
     807-829: Missing.
     1304-1320: Missing.

Show »
Length:1,621
Mass (Da):180,738
Checksum:iC58AFA881A960A85
GO

Sequence cautioni

The sequence AAH41430.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.
The sequence BAA90916.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.
The sequence AAD42883.1 differs from that shown. Reason: Frameshift at positions 185, 191, 380 and 405.
The sequence AAP97680.1 differs from that shown. Reason: Frameshift at positions 185 and 191.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti356 – 3561M → T in CFEOM1. 1 Publication
VAR_019399
Natural varianti947 – 9471M → R in CFEOM1. 1 Publication
VAR_019400
Natural varianti947 – 9471M → T in CFEOM1. 1 Publication
VAR_027021
Natural varianti947 – 9471M → V in CFEOM1. 1 Publication
VAR_019401
Natural varianti954 – 9541R → Q in CFEOM1. 1 Publication
VAR_019402
Natural varianti954 – 9541R → W in CFEOM1. 1 Publication
VAR_019403
Natural varianti1010 – 10101I → T in CFEOM1. 1 Publication
VAR_019404

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei558 – 57013Missing in isoform 2, isoform 5 and isoform 6.
VSP_010870Add
BLAST
Alternative sequencei807 – 82923Missing in isoform 6.
VSP_046790Add
BLAST
Alternative sequencei1107 – 11137Missing in isoform 5.
VSP_046791
Alternative sequencei1260 – 131960HSDSG…HRSSR → QSDESDSSLSEVH in isoform 3.
VSP_010871Add
BLAST
Alternative sequencei1304 – 132017Missing in isoform 5 and isoform 6.
VSP_046792Add
BLAST
Alternative sequencei1315 – 13151H → HS in isoform 4.
VSP_010872

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti172 – 1721K → R in CAJ45483. 1 Publication
Sequence conflicti176 – 1761R → G in CAJ45483. 1 Publication
Sequence conflicti215 – 2151A → G in CAJ45483. 1 Publication
Sequence conflicti315 – 3151S → C in CAJ45483. 1 Publication
Sequence conflicti596 – 5972NN → TQ in AAP97680. 1 Publication
Sequence conflicti596 – 5972NN → TQ in AAD42883. 1 Publication
Sequence conflicti653 – 6531E → D in AAP97680. 1 Publication
Sequence conflicti801 – 8022DQ → AP in AAP97680. 1 Publication
Sequence conflicti801 – 8011D → G in CAJ45483. 1 Publication
Sequence conflicti813 – 8131E → G in AAP97680. 1 Publication
Sequence conflicti826 – 8261K → Q in AAP97680. 1 Publication
Sequence conflicti875 – 8751R → G in CAJ45483. 1 Publication
Sequence conflicti892 – 8921L → S in CAJ45483. 1 Publication
Sequence conflicti1071 – 10711Q → R in CAJ45483. 1 Publication
Sequence conflicti1167 – 11671D → G in CAJ45483. 1 Publication
Sequence conflicti1237 – 12371E → D in AAI36415. 1 Publication
Sequence conflicti1341 – 13411H → N in CAJ45483. 1 Publication
Sequence conflicti1378 – 13792QE → HR in CAJ45483. 1 Publication
Sequence conflicti1429 – 14291G → A in CAJ45483. 1 Publication
Sequence conflicti1503 – 15031I → T in CAD97863. 1 Publication
Sequence conflicti1511 – 15111I → T in CAD97863. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY368076 mRNA. Translation: AAR04774.1.
AM177179 mRNA. Translation: CAJ45483.1.
AF450487 mRNA. Translation: AAP97680.1. Frameshift.
AB290166 mRNA. Translation: BAG06720.1.
AC084373 Genomic DNA. No translation available.
AC090668 Genomic DNA. No translation available.
AC121334 Genomic DNA. No translation available.
AF155117 mRNA. Translation: AAD42883.1. Sequence problems.
AK000059 mRNA. Translation: BAA90916.1. Sequence problems.
CH471111 Genomic DNA. Translation: EAW57803.1.
BC041430 mRNA. Translation: AAH41430.1. Sequence problems.
BC047572 mRNA. Translation: AAH47572.1.
BC136414 mRNA. Translation: AAI36415.1.
AB051495 mRNA. Translation: BAB21799.2.
BX537855 mRNA. Translation: CAD97863.1.
CCDSiCCDS31773.1. [Q7Z4S6-2]
CCDS53774.1. [Q7Z4S6-6]
CCDS53775.1. [Q7Z4S6-5]
CCDS53776.1. [Q7Z4S6-1]
RefSeqiNP_001166934.1. NM_001173463.1. [Q7Z4S6-5]
NP_001166935.1. NM_001173464.1. [Q7Z4S6-1]
NP_001166936.1. NM_001173465.1. [Q7Z4S6-6]
NP_060111.2. NM_017641.3. [Q7Z4S6-2]
XP_005269064.1. XM_005269007.1. [Q7Z4S6-4]
XP_005269070.1. XM_005269013.1. [Q7Z4S6-3]
UniGeneiHs.374201.

Genome annotation databases

EnsembliENST00000361418; ENSP00000354878; ENSG00000139116. [Q7Z4S6-1]
ENST00000361961; ENSP00000354851; ENSG00000139116. [Q7Z4S6-2]
ENST00000541463; ENSP00000438075; ENSG00000139116. [Q7Z4S6-6]
ENST00000544797; ENSP00000445606; ENSG00000139116. [Q7Z4S6-5]
GeneIDi55605.
KEGGihsa:55605.
UCSCiuc001rlx.3. human. [Q7Z4S6-2]
uc001rly.3. human. [Q7Z4S6-1]

Polymorphism databases

DMDMi50400977.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY368076 mRNA. Translation: AAR04774.1 .
AM177179 mRNA. Translation: CAJ45483.1 .
AF450487 mRNA. Translation: AAP97680.1 . Frameshift.
AB290166 mRNA. Translation: BAG06720.1 .
AC084373 Genomic DNA. No translation available.
AC090668 Genomic DNA. No translation available.
AC121334 Genomic DNA. No translation available.
AF155117 mRNA. Translation: AAD42883.1 . Sequence problems.
AK000059 mRNA. Translation: BAA90916.1 . Sequence problems.
CH471111 Genomic DNA. Translation: EAW57803.1 .
BC041430 mRNA. Translation: AAH41430.1 . Sequence problems.
BC047572 mRNA. Translation: AAH47572.1 .
BC136414 mRNA. Translation: AAI36415.1 .
AB051495 mRNA. Translation: BAB21799.2 .
BX537855 mRNA. Translation: CAD97863.1 .
CCDSi CCDS31773.1. [Q7Z4S6-2 ]
CCDS53774.1. [Q7Z4S6-6 ]
CCDS53775.1. [Q7Z4S6-5 ]
CCDS53776.1. [Q7Z4S6-1 ]
RefSeqi NP_001166934.1. NM_001173463.1. [Q7Z4S6-5 ]
NP_001166935.1. NM_001173464.1. [Q7Z4S6-1 ]
NP_001166936.1. NM_001173465.1. [Q7Z4S6-6 ]
NP_060111.2. NM_017641.3. [Q7Z4S6-2 ]
XP_005269064.1. XM_005269007.1. [Q7Z4S6-4 ]
XP_005269070.1. XM_005269013.1. [Q7Z4S6-3 ]
UniGenei Hs.374201.

3D structure databases

ProteinModelPortali Q7Z4S6.
SMRi Q7Z4S6. Positions 10-379, 1308-1655.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120746. 5 interactions.
DIPi DIP-56253N.
IntActi Q7Z4S6. 5 interactions.
MINTi MINT-2808104.

PTM databases

PhosphoSitei Q7Z4S6.

Polymorphism databases

DMDMi 50400977.

Proteomic databases

MaxQBi Q7Z4S6.
PaxDbi Q7Z4S6.
PeptideAtlasi Q7Z4S6.
PRIDEi Q7Z4S6.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000361418 ; ENSP00000354878 ; ENSG00000139116 . [Q7Z4S6-1 ]
ENST00000361961 ; ENSP00000354851 ; ENSG00000139116 . [Q7Z4S6-2 ]
ENST00000541463 ; ENSP00000438075 ; ENSG00000139116 . [Q7Z4S6-6 ]
ENST00000544797 ; ENSP00000445606 ; ENSG00000139116 . [Q7Z4S6-5 ]
GeneIDi 55605.
KEGGi hsa:55605.
UCSCi uc001rlx.3. human. [Q7Z4S6-2 ]
uc001rly.3. human. [Q7Z4S6-1 ]

Organism-specific databases

CTDi 55605.
GeneCardsi GC12M039687.
GeneReviewsi KIF21A.
HGNCi HGNC:19349. KIF21A.
HPAi CAB022079.
MIMi 135700. phenotype.
608283. gene.
neXtProti NX_Q7Z4S6.
Orphaneti 45358. Congenital fibrosis of extraocular muscles.
PharmGKBi PA134882934.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG2319.
HOVERGENi HBG052247.
KOi K10395.
PhylomeDBi Q7Z4S6.
TreeFami TF105224.

Enzyme and pathway databases

SignaLinki Q7Z4S6.

Miscellaneous databases

ChiTaRSi KIF21A. human.
GeneWikii KIF21A.
GenomeRNAii 55605.
NextBioi 60157.
PROi Q7Z4S6.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q7Z4S6.
Bgeei Q7Z4S6.
CleanExi HS_KIF21A.
Genevestigatori Q7Z4S6.

Family and domain databases

Gene3Di 2.130.10.10. 1 hit.
3.40.850.10. 1 hit.
InterProi IPR027640. Kinesin-like_fam.
IPR019821. Kinesin_motor_CS.
IPR001752. Kinesin_motor_dom.
IPR027417. P-loop_NTPase.
IPR009053. Prefoldin.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view ]
PANTHERi PTHR24115. PTHR24115. 1 hit.
Pfami PF00225. Kinesin. 1 hit.
PF00400. WD40. 4 hits.
[Graphical view ]
PRINTSi PR00380. KINESINHEAVY.
SMARTi SM00129. KISc. 1 hit.
SM00320. WD40. 7 hits.
[Graphical view ]
SUPFAMi SSF46579. SSF46579. 1 hit.
SSF50978. SSF50978. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEi PS00411. KINESIN_MOTOR_1. 1 hit.
PS50067. KINESIN_MOTOR_2. 1 hit.
PS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 4 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS CFEOM1 THR-356; ARG-947; VAL-947; GLN-954; TRP-954 AND THR-1010.
  2. "Differential expression analysis of molecular motors in ALS motor neuron disease."
    Pantelidou M., Lederer C.W., Zographos S.E., Pfaffl M.W., Cavallaro S., Santama N.
    Submitted (DEC-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6).
    Tissue: Brain cortex.
  3. Zan Q., Guo J.H., Yu L.
    Submitted (NOV-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  4. "Multiplex amplification and cloning of 5'-ends of cDNA by ligase-free recombination: preparation of full-length cDNA clones encoding motor proteins."
    Yamakawa H., Kikuno R.F., Nagase T., Ohara O.
    Submitted (JAN-2007) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  5. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-543 (ISOFORMS 1/2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1243-1674 (ISOFORM 4).
    Tissue: Adrenal cortex, Brain and Testis.
  8. Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-597 (ISOFORM 2), IDENTIFICATION AS A RENAL CANCER ANTIGEN.
  9. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-586 (ISOFORM 2).
    Tissue: Colon.
  10. "Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Hattori A., Kondo Y., Okumura K., Ohara O.
    DNA Res. 7:347-355(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 5-1674 (ISOFORM 2).
    Tissue: Brain.
  11. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 654-1674 (ISOFORM 3).
    Tissue: Liver.
  12. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  13. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1212; SER-1239 AND SER-1673, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  14. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  15. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  16. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-524; SER-1212; SER-1239; SER-1662; THR-1664 AND SER-1673, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  17. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  18. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1212 AND SER-1239, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  19. "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
    Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
    Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  20. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  21. "A novel KIF21A mutation in a patient with congenital fibrosis of the extraocular muscles and Marcus Gunn jaw-winking phenomenon."
    Yamada K., Hunter D.G., Andrews C., Engle E.C.
    Arch. Ophthalmol. 123:1254-1259(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT CFEOM1 THR-947.

Entry informationi

Entry nameiKI21A_HUMAN
AccessioniPrimary (citable) accession number: Q7Z4S6
Secondary accession number(s): A8MX28
, B0I1R9, B9EGE4, F5H0C3, F5H219, Q2UVF1, Q6UKL9, Q7Z668, Q86WZ5, Q8IVZ8, Q9C0F5, Q9NXU4, Q9Y590
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: July 19, 2004
Last modified: July 9, 2014
This is version 118 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi