Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q7Z4N2 (TRPM1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 87. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Transient receptor potential cation channel subfamily M member 1
Alternative name(s):
Long transient receptor potential channel 1
Short name=LTrpC1
Melastatin-1
Gene names
Name:TRPM1
Synonyms:LTRPC1, MLSN, MLSN1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1603 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Cation channel essential for the depolarizing photoresponse of retinal ON bipolar cells. It is part of the GRM6 signaling cascade. May play a role in metastasis suppression By similarity. May act as a spontaneously active, calcium-permeable plasma membrane channel. Ref.9 Ref.10 Ref.11

Subcellular location

Cell membrane; Multi-pass membrane protein Potential Ref.9.

Tissue specificity

Expressed in the retina where it localizes to the outer plexiform layer. Highly expressed in benign melanocytic nevi and diffusely expressed in various in situ melanomas, but not detected in melanoma metastases. Also expressed in melanocytes and pigmented metastatic melanoma cell lines. In melanocytes expression appears to be regulated at the level of transcription and mRNA processing. Ref.7 Ref.8 Ref.11

Induction

Up-regulated by hexamethylene bisacetamide (HBMA). Ref.8

Involvement in disease

Night blindness, congenital stationary, 1C (CSNB1C) [MIM:613216]: A non-progressive retinal disorder characterized by impaired night vision, often associated with nystagmus and myopia.
Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.10 Ref.11 Ref.12

Sequence similarities

Belongs to the transient receptor (TC 1.A.4) family. LTrpC subfamily. TRPM1 sub-subfamily. [View classification]

Alternative products

This entry describes 7 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 Ref.4 (identifier: Q7Z4N2-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Note: No experimental confirmation available.
Isoform 2 Ref.1 Ref.2 Ref.4 (identifier: Q7Z4N2-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: Missing.
Isoform 3 Ref.2 (identifier: Q7Z4N2-3)

The sequence of this isoform differs from the canonical sequence as follows:
     295-300: Missing.
Isoform 4 Ref.2 (identifier: Q7Z4N2-4)

The sequence of this isoform differs from the canonical sequence as follows:
     301-1603: Missing.
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Isoform 5 (identifier: Q7Z4N2-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSSFKRGSLKSSTSGSQKGQKSWIEKTFCKRECIFVIPSM
Isoform 6 (identifier: Q7Z4N2-6)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGQKSWIEKTFCKRECIFVIPSM
Isoform 7 (identifier: Q7Z4N2-7)

The sequence of this isoform differs from the canonical sequence as follows:
     72-136: YIRVSYDTKP...AAMTTGAWIF → VRKAFRHGAT...AMRLGNWTPL
     137-1603: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 16031603Transient receptor potential cation channel subfamily M member 1
PRO_0000328930

Regions

Topological domain1 – 524524Extracellular Potential
Transmembrane525 – 54521Helical; Potential
Topological domain546 – 745200Cytoplasmic Potential
Transmembrane746 – 76621Helical; Potential
Topological domain767 – 83064Extracellular Potential
Transmembrane831 – 85121Helical; Potential
Topological domain8521Cytoplasmic Potential
Transmembrane853 – 87321Helical; Potential
Topological domain874 – 89724Extracellular Potential
Transmembrane898 – 91821Helical; Potential
Topological domain919 – 92810Cytoplasmic Potential
Transmembrane929 – 94921Helical; Potential
Topological domain950 – 96112Extracellular Potential
Transmembrane962 – 98221Helical; Potential
Topological domain983 – 105472Cytoplasmic Potential
Transmembrane1055 – 107521Helical; Potential
Topological domain1076 – 110530Extracellular Potential
Transmembrane1106 – 112621Helical; Potential
Topological domain1127 – 1603477Cytoplasmic Potential
Coiled coil1179 – 124062 Potential

Natural variations

Alternative sequence1 – 7070Missing in isoform 2. Ref.1 Ref.2 Ref.4
VSP_052748
Alternative sequence11M → MSSFKRGSLKSSTSGSQKGQ KSWIEKTFCKRECIFVIPSM in isoform 5.
VSP_046786
Alternative sequence11M → MGQKSWIEKTFCKRECIFVI PSM in isoform 6.
VSP_046787
Alternative sequence72 – 13665YIRVS…GAWIF → VRKAFRHGATRITAFIGGQS PSPKLQIPGLLHGCGSIFLD ISLKNQEIYLCTWLLAMRLG NWTPL in isoform 7.
VSP_046788
Alternative sequence137 – 16031467Missing in isoform 7.
VSP_046789
Alternative sequence295 – 3006Missing in isoform 3. Ref.2
VSP_052749
Alternative sequence301 – 16031303Missing in isoform 4. Ref.2
VSP_052750
Natural variant61R → W. Ref.10 Ref.12
VAR_063173
Natural variant321S → N. Ref.6 Ref.10 Ref.12
Corresponds to variant rs2241493 [ dbSNP | Ensembl ].
VAR_052370
Natural variant561Y → C in CSNB1C. Ref.10
VAR_063174
Natural variant721Y → C in CSNB1C. Ref.12
VAR_063175
Natural variant741R → C in CSNB1C. Ref.10 Ref.11
VAR_063176
Natural variant991L → P in CSNB1C. Ref.11 Ref.12
Corresponds to variant rs191205969 [ dbSNP | Ensembl ].
VAR_063177
Natural variant3641L → R in CSNB1C. Ref.11
VAR_063178
Natural variant3991P → T. Ref.1 Ref.12
Corresponds to variant rs141540242 [ dbSNP | Ensembl ].
VAR_063179
Natural variant4731R → P in CSNB1C. Ref.12
VAR_063180
Natural variant5341G → R in CSNB1C. Ref.11
VAR_063181
Natural variant5411M → K in CSNB1C. Ref.12
VAR_063182
Natural variant6051V → M. Ref.10 Ref.12
Corresponds to variant rs17815774 [ dbSNP | Ensembl ].
VAR_052371
Natural variant6111P → H in CSNB1C. Ref.11
VAR_063183
Natural variant7211R → Q in CSNB1C. Ref.10
VAR_063184
Natural variant8831E → G in CSNB1C. Ref.10
VAR_063185
Natural variant9621M → T in a patient with night blindness started in the third decade; associated in cis with G-1438. Ref.10
VAR_063186
Natural variant10021I → F in CSNB1C. Ref.10
VAR_063187
Natural variant11611Q → H. Ref.12
Corresponds to variant rs182549235 [ dbSNP | Ensembl ].
VAR_063188
Natural variant12291N → T. Ref.12
Corresponds to variant rs17227996 [ dbSNP | Ensembl ].
VAR_052372
Natural variant13051R → H.
Corresponds to variant rs13380059 [ dbSNP | Ensembl ].
VAR_052373
Natural variant13791P → T. Ref.12
Corresponds to variant rs61734298 [ dbSNP | Ensembl ].
VAR_063189
Natural variant13951V → I. Ref.10 Ref.12
Corresponds to variant rs3784588 [ dbSNP | Ensembl ].
VAR_052374
Natural variant14221R → G.
Corresponds to variant rs3784587 [ dbSNP | Ensembl ].
VAR_052375
Natural variant14221R → W. Ref.12
VAR_063190
Natural variant14381R → G in a patient with night blindness started in the third decade; associated in cis with T-962. Ref.10
VAR_063191
Natural variant14981H → Q. Ref.1 Ref.12
Corresponds to variant rs12898290 [ dbSNP | Ensembl ].
VAR_052376

Experimental info

Sequence conflict11M → T in ADJ52077. Ref.2
Sequence conflict3691V → L in BAC80200. Ref.3
Sequence conflict11951R → G in BAC80201. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified April 8, 2008. Version 2.
Checksum: 8B9658FAE3F7B32F

FASTA1,603182,178
        10         20         30         40         50         60 
MKDSNRCCCG QFTNQHIPPL PSATPSKNEE ESKQVETQPE KWSVAKHTQS YPTDSYGVLE 

        70         80         90        100        110        120 
FQGGGYSNKA MYIRVSYDTK PDSLLHLMVK DWQLELPKLL ISVHGGLQNF EMQPKLKQVF 

       130        140        150        160        170        180 
GKGLIKAAMT TGAWIFTGGV STGVISHVGD ALKDHSSKSR GRVCAIGIAP WGIVENKEDL 

       190        200        210        220        230        240 
VGKDVTRVYQ TMSNPLSKLS VLNNSHTHFI LADNGTLGKY GAEVKLRRLL EKHISLQKIN 

       250        260        270        280        290        300 
TRLGQGVPLV GLVVEGGPNV VSIVLEYLQE EPPIPVVICD GSGRASDILS FAHKYCEEGG 

       310        320        330        340        350        360 
IINESLREQL LVTIQKTFNY NKAQSHQLFA IIMECMKKKE LVTVFRMGSE GQQDIEMAIL 

       370        380        390        400        410        420 
TALLKGTNVS APDQLSLALA WNRVDIARSQ IFVFGPHWPP LGSLAPPTDS KATEKEKKPP 

       430        440        450        460        470        480 
MATTKGGRGK GKGKKKGKVK EEVEEETDPR KIELLNWVNA LEQAMLDALV LDRVDFVKLL 

       490        500        510        520        530        540 
IENGVNMQHF LTIPRLEELY NTRLGPPNTL HLLVRDVKKS NLPPDYHISL IDIGLVLEYL 

       550        560        570        580        590        600 
MGGAYRCNYT RKNFRTLYNN LFGPKRPKAL KLLGMEDDEP PAKGKKKKKK KKEEEIDIDV 

       610        620        630        640        650        660 
DDPAVSRFQY PFHELMVWAV LMKRQKMAVF LWQRGEESMA KALVACKLYK AMAHESSESD 

       670        680        690        700        710        720 
LVDDISQDLD NNSKDFGQLA LELLDQSYKH DEQIAMKLLT YELKNWSNST CLKLAVAAKH 

       730        740        750        760        770        780 
RDFIAHTCSQ MLLTDMWMGR LRMRKNPGLK VIMGILLPPT ILFLEFRTYD DFSYQTSKEN 

       790        800        810        820        830        840 
EDGKEKEEEN TDANADAGSR KGDEENEHKK QRSIPIGTKI CEFYNAPIVK FWFYTISYLG 

       850        860        870        880        890        900 
YLLLFNYVIL VRMDGWPSLQ EWIVISYIVS LALEKIREIL MSEPGKLSQK IKVWLQEYWN 

       910        920        930        940        950        960 
ITDLVAISTF MIGAILRLQN QPYMGYGRVI YCVDIIFWYI RVLDIFGVNK YLGPYVMMIG 

       970        980        990       1000       1010       1020 
KMMIDMLYFV VIMLVVLMSF GVARQAILHP EEKPSWKLAR NIFYMPYWMI YGEVFADQID 

      1030       1040       1050       1060       1070       1080 
LYAMEINPPC GENLYDEEGK RLPPCIPGAW LTPALMACYL LVANILLVNL LIAVFNNTFF 

      1090       1100       1110       1120       1130       1140 
EVKSISNQVW KFQRYQLIMT FHDRPVLPPP MIILSHIYII IMRLSGRCRK KREGDQEERD 

      1150       1160       1170       1180       1190       1200 
RGLKLFLSDE ELKRLHEFEE QCVQEHFREK EDEQQSSSDE RIRVTSERVE NMSMRLEEIN 

      1210       1220       1230       1240       1250       1260 
ERETFMKTSL QTVDLRLAQL EELSNRMVNA LENLAGIDRS DLIQARSRAS SECEATYLLR 

      1270       1280       1290       1300       1310       1320 
QSSINSADGY SLYRYHFNGE ELLFEDTSLS TSPGTGVRKK TCSFRIKEEK DVKTHLVPEC 

      1330       1340       1350       1360       1370       1380 
QNSLHLSLGT STSATPDGSH LAVDDLKNAE ESKLGPDIGI SKEDDERQTD SKKEETISPS 

      1390       1400       1410       1420       1430       1440 
LNKTDVIHGQ DKSDVQNTQL TVETTNIEGT ISYPLEETKI TRYFPDETIN ACKTMKSRSF 

      1450       1460       1470       1480       1490       1500 
VYSRGRKLVG GVNQDVEYSS ITDQQLTTEW QCQVQKITRS HSTDIPYIVS EAAVQAEHKE 

      1510       1520       1530       1540       1550       1560 
QFADMQDEHH VAEAIPRIPR LSLTITDRNG MENLLSVKPD QTLGFPSLRS KSLHGHPRNV 

      1570       1580       1590       1600 
KSIQGKLDRS GHASSVSSLV IVSGMTAEEK KVKKEKASTE TEC 

« Hide

Isoform 2 [UniParc].

Checksum: D824DC467BC1A70F
Show »

FASTA1,533174,418
Isoform 3 [UniParc].

Checksum: 44A93B1C9CF533C7
Show »

FASTA1,597181,540
Isoform 4 [UniParc].

Checksum: EA1EE23D05248823
Show »

FASTA30032,814
Isoform 5 [UniParc].

Checksum: 8FCF58496AF8504D
Show »

FASTA1,642186,545
Isoform 6 [UniParc].

Checksum: 242329CE4A78C0F6
Show »

FASTA1,625184,792
Isoform 7 [UniParc].

Checksum: EAA6CA0DA32B87D7
Show »

FASTA13615,099

References

« Hide 'large scale' references
[1]"Chromosomal localization and genomic characterization of the mouse melastatin gene (Mlsn1)."
Hunter J.J., Shao J., Smutko J.S., Dussault B.J., Nagle D.L., Woolf E.A., Holmgren L.M., Moore K.J., Shyjan A.W.
Genomics 54:116-123(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANTS THR-399 AND GLN-1498.
Tissue: Retina.
[2]"TRPM1 forms ion channels associated with melanin content in melanocytes."
Oancea E., Vriens J., Brauchi S., Jun J., Splawski I., Clapham D.E.
Sci. Signal. 2:RA21-RA21(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5 AND 6).
[3]"ProX human full-length cDNA cloning project."
Sano M., Okabayashi K., Miyauchi A., Gonoi T.
Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4).
Tissue: Melanoma.
[4]"Analysis of the DNA sequence and duplication history of human chromosome 15."
Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A. expand/collapse author list , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7), VARIANT ASN-32.
[7]"Down-regulation of the novel gene melastatin correlates with potential for melanoma metastasis."
Duncan L.M., Deeds J., Hunter J., Shao J., Holmgren L.M., Woolf E.A., Tepper R.I., Shyjan A.W.
Cancer Res. 58:1515-1520(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
[8]"Expression and up-regulation of alternatively spliced transcripts of melastatin, a melanoma metastasis-related gene, in human melanoma cells."
Fang D., Setaluri V.
Biochem. Biophys. Res. Commun. 279:53-61(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY, INDUCTION.
[9]"Regulation of melastatin, a TRP-related protein, through interaction with a cytoplasmic isoform."
Xu X.-Z.S., Moebius F., Gill D.L., Montell C.
Proc. Natl. Acad. Sci. U.S.A. 98:10692-10697(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, SUBCELLULAR LOCATION.
[10]"Recessive mutations of the gene TRPM1 abrogate ON bipolar cell function and cause complete congenital stationary night blindness in humans."
Li Z., Sergouniotis P.I., Michaelides M., Mackay D.S., Wright G.A., Devery S., Moore A.T., Holder G.E., Robson A.G., Webster A.R.
Am. J. Hum. Genet. 85:711-719(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, VARIANTS CSNB1C CYS-56; CYS-74; GLN-721; GLY-883 AND PHE-1002, VARIANTS TRP-6; ASN-32; MET-605; THR-962; ILE-1395 AND GLY-1438.
[11]"Mutations in TRPM1 are a common cause of complete congenital stationary night blindness."
van Genderen M.M., Bijveld M.M., Claassen Y.B., Florijn R.J., Pearring J.N., Meire F.M., McCall M.A., Riemslag F.C., Gregg R.G., Bergen A.A., Kamermans M.
Am. J. Hum. Genet. 85:730-736(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, TISSUE SPECIFICITY, VARIANTS CSNB1C CYS-74; PRO-99; ARG-364; ARG-534 AND HIS-611.
[12]"TRPM1 is mutated in patients with autosomal-recessive complete congenital stationary night blindness."
Audo I., Kohl S., Leroy B.P., Munier F.L., Guillonneau X., Mohand-Said S., Bujakowska K., Nandrot E.F., Lorenz B., Preising M., Kellner U., Renner A.B., Bernd A., Antonio A., Moskova-Doumanova V., Lancelot M.E., Poloschek C.M., Drumare I. expand/collapse author list , Defoort-Dhellemmes S., Wissinger B., Leveillard T., Hamel C.P., Schorderet D.F., De Baere E., Berger W., Jacobson S.G., Zrenner E., Sahel J.A., Bhattacharya S.S., Zeitz C.
Am. J. Hum. Genet. 85:720-729(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS CSNB1C CYS-72; PRO-99; PRO-473 AND LYS-541, VARIANTS TRP-6; ASN-32; THR-399; MET-605; HIS-1161; THR-1229; THR-1379; ILE-1395; TRP-1422 AND GLN-1498.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF071787 mRNA. Translation: AAC80000.1.
HM135790 mRNA. Translation: ADJ52077.1.
HM135791 mRNA. Translation: ADJ52078.1.
AB115498 mRNA. Translation: BAC80200.1.
AB115499 mRNA. Translation: BAC80201.1.
AB115500 mRNA. Translation: BAC80202.1.
AB115501 mRNA. Translation: BAC80203.1.
AB115502 mRNA. Translation: BAC80204.1.
AC009562 Genomic DNA. No translation available.
AC090829 Genomic DNA. No translation available.
CH471216 Genomic DNA. Translation: EAW61261.1.
BC058286 mRNA. Translation: AAH58286.1.
RefSeqNP_001238949.1. NM_001252020.1.
NP_001238953.1. NM_001252024.1.
NP_001238959.1. NM_001252030.1.
NP_002411.3. NM_002420.5.
UniGeneHs.155942.
Hs.732541.

3D structure databases

ProteinModelPortalQ7Z4N2.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid110453. 1 interaction.
IntActQ7Z4N2. 1 interaction.
STRING9606.ENSP00000380897.

Chemistry

GuidetoPHARMACOLOGY493.

Protein family/group databases

TCDB1.A.4.5.2. the transient receptor potential ca(2+) channel (trp-cc) family.

PTM databases

PhosphoSiteQ7Z4N2.

Polymorphism databases

DMDM182701419.

Proteomic databases

PaxDbQ7Z4N2.
PRIDEQ7Z4N2.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000256552; ENSP00000256552; ENSG00000134160. [Q7Z4N2-6]
ENST00000397795; ENSP00000380897; ENSG00000134160. [Q7Z4N2-1]
ENST00000542188; ENSP00000437849; ENSG00000134160. [Q7Z4N2-5]
ENST00000558768; ENSP00000453119; ENSG00000134160.
ENST00000559179; ENSP00000453851; ENSG00000134160. [Q7Z4N2-7]
ENST00000560658; ENSP00000454077; ENSG00000134160. [Q7Z4N2-4]
ENST00000560801; ENSP00000453644; ENSG00000134160.
GeneID4308.
KEGGhsa:4308.
UCSCuc001zfm.3. human. [Q7Z4N2-1]
uc010azy.3. human. [Q7Z4N2-3]

Organism-specific databases

CTD4308.
GeneCardsGC15M031293.
HGNCHGNC:7146. TRPM1.
HPAHPA014785.
MIM603576. gene.
613216. phenotype.
neXtProtNX_Q7Z4N2.
Orphanet215. Congenital stationary night blindness.
PharmGKBPA35496.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG253824.
HOGENOMHOG000230920.
HOVERGENHBG055663.
KOK04976.
OMATMKSRSF.
OrthoDBEOG7NPFSC.
TreeFamTF314204.

Enzyme and pathway databases

ReactomeREACT_15518. Transmembrane transport of small molecules.

Gene expression databases

ArrayExpressQ7Z4N2.
BgeeQ7Z4N2.
CleanExHS_TRPM1.
GenevestigatorQ7Z4N2.

Family and domain databases

InterProIPR005821. Ion_trans_dom.
[Graphical view]
PfamPF00520. Ion_trans. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiTRPM1.
GenomeRNAi4308.
NextBio16953.
PROQ7Z4N2.
SOURCESearch...

Entry information

Entry nameTRPM1_HUMAN
AccessionPrimary (citable) accession number: Q7Z4N2
Secondary accession number(s): D9IDV2 expand/collapse secondary AC list , D9IDV3, F8W865, H0YN37, O75560, Q6PE48, Q7Z4N1, Q7Z4N3, Q7Z4N4, Q7Z4N5
Entry history
Integrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: April 8, 2008
Last modified: March 19, 2014
This is version 87 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 15

Human chromosome 15: entries, gene names and cross-references to MIM