Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transient receptor potential cation channel subfamily M member 1

Gene

TRPM1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Cation channel essential for the depolarizing photoresponse of retinal ON bipolar cells. It is part of the GRM6 signaling cascade. May play a role in metastasis suppression (By similarity). May act as a spontaneously active, calcium-permeable plasma membrane channel.By similarity3 Publications

GO - Molecular functioni

  • calcium channel activity Source: UniProtKB

GO - Biological processi

  • calcium ion transmembrane transport Source: Reactome
  • calcium ion transport into cytosol Source: UniProtKB
  • cellular response to light stimulus Source: UniProtKB
  • G-protein coupled glutamate receptor signaling pathway Source: UniProtKB
  • protein tetramerization Source: InterPro
  • retinal rod cell development Source: Ensembl
  • transport Source: ProtInc
  • visual perception Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Ion channel, Ligand-gated ion channel, Receptor

Keywords - Biological processi

Ion transport, Sensory transduction, Transport, Vision

Enzyme and pathway databases

ReactomeiR-HSA-3295583. TRP channels.

Protein family/group databases

TCDBi1.A.4.5.2. the transient receptor potential ca(2+) channel (trp-cc) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Transient receptor potential cation channel subfamily M member 1
Alternative name(s):
Long transient receptor potential channel 1
Short name:
LTrpC1
Melastatin-1
Gene namesi
Name:TRPM1Imported
Synonyms:LTRPC1, MLSN1 Publication, MLSN1Imported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

HGNCiHGNC:7146. TRPM1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 524ExtracellularSequence analysisAdd BLAST524
Transmembranei525 – 545HelicalSequence analysisAdd BLAST21
Topological domaini546 – 745CytoplasmicSequence analysisAdd BLAST200
Transmembranei746 – 766HelicalSequence analysisAdd BLAST21
Topological domaini767 – 830ExtracellularSequence analysisAdd BLAST64
Transmembranei831 – 851HelicalSequence analysisAdd BLAST21
Topological domaini852CytoplasmicSequence analysis1
Transmembranei853 – 873HelicalSequence analysisAdd BLAST21
Topological domaini874 – 897ExtracellularSequence analysisAdd BLAST24
Transmembranei898 – 918HelicalSequence analysisAdd BLAST21
Topological domaini919 – 928CytoplasmicSequence analysis10
Transmembranei929 – 949HelicalSequence analysisAdd BLAST21
Topological domaini950 – 961ExtracellularSequence analysisAdd BLAST12
Transmembranei962 – 982HelicalSequence analysisAdd BLAST21
Topological domaini983 – 1054CytoplasmicSequence analysisAdd BLAST72
Transmembranei1055 – 1075HelicalSequence analysisAdd BLAST21
Topological domaini1076 – 1105ExtracellularSequence analysisAdd BLAST30
Transmembranei1106 – 1126HelicalSequence analysisAdd BLAST21
Topological domaini1127 – 1603CytoplasmicSequence analysisAdd BLAST477

GO - Cellular componenti

  • integral component of plasma membrane Source: ProtInc
  • new growing cell tip Source: Ensembl
  • plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Involvement in diseasei

Night blindness, congenital stationary, 1C (CSNB1C)3 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA non-progressive retinal disorder characterized by impaired night vision, often associated with nystagmus and myopia.
See also OMIM:613216
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06317456Y → C in CSNB1C. 1 Publication1
Natural variantiVAR_06317572Y → C in CSNB1C. 1 PublicationCorresponds to variant rs200514769dbSNPEnsembl.1
Natural variantiVAR_06317674R → C in CSNB1C. 2 PublicationsCorresponds to variant rs774365264dbSNPEnsembl.1
Natural variantiVAR_06317799L → P in CSNB1C. 2 PublicationsCorresponds to variant rs191205969dbSNPEnsembl.1
Natural variantiVAR_063178364L → R in CSNB1C. 1 PublicationCorresponds to variant rs372608320dbSNPEnsembl.1
Natural variantiVAR_063180473R → P in CSNB1C. 1 Publication1
Natural variantiVAR_063181534G → R in CSNB1C. 1 PublicationCorresponds to variant rs748043795dbSNPEnsembl.1
Natural variantiVAR_063182541M → K in CSNB1C. 1 Publication1
Natural variantiVAR_063183611P → H in CSNB1C. 1 PublicationCorresponds to variant rs267607139dbSNPEnsembl.1
Natural variantiVAR_063184721R → Q in CSNB1C. 1 PublicationCorresponds to variant rs781460164dbSNPEnsembl.1
Natural variantiVAR_063185883E → G in CSNB1C. 1 PublicationCorresponds to variant rs574652148dbSNPEnsembl.1
Natural variantiVAR_0631871002I → F in CSNB1C. 1 PublicationCorresponds to variant rs369484186dbSNPEnsembl.1

Keywords - Diseasei

Congenital stationary night blindness, Disease mutation

Organism-specific databases

DisGeNETi4308.
MalaCardsiTRPM1.
MIMi613216. phenotype.
OpenTargetsiENSG00000134160.
Orphaneti215. Congenital stationary night blindness.
PharmGKBiPA35496.

Chemistry databases

GuidetoPHARMACOLOGYi493.

Polymorphism and mutation databases

BioMutaiTRPM1.
DMDMi182701419.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003289301 – 1603Transient receptor potential cation channel subfamily M member 1Add BLAST1603

Proteomic databases

EPDiQ7Z4N2.
MaxQBiQ7Z4N2.
PaxDbiQ7Z4N2.
PeptideAtlasiQ7Z4N2.
PRIDEiQ7Z4N2.

PTM databases

iPTMnetiQ7Z4N2.
PhosphoSitePlusiQ7Z4N2.

Expressioni

Tissue specificityi

Expressed in the retina where it localizes to the outer plexiform layer. Highly expressed in benign melanocytic nevi and diffusely expressed in various in situ melanomas, but not detected in melanoma metastases. Also expressed in melanocytes and pigmented metastatic melanoma cell lines. In melanocytes expression appears to be regulated at the level of transcription and mRNA processing.3 Publications

Inductioni

Up-regulated by hexamethylene bisacetamide (HBMA).1 Publication

Gene expression databases

BgeeiENSG00000134160.
CleanExiHS_TRPM1.
ExpressionAtlasiQ7Z4N2. baseline and differential.
GenevisibleiQ7Z4N2. HS.

Organism-specific databases

HPAiHPA014785.

Interactioni

Protein-protein interaction databases

BioGridi110453. 4 interactors.
IntActiQ7Z4N2. 2 interactors.
STRINGi9606.ENSP00000380897.

Structurei

3D structure databases

ProteinModelPortaliQ7Z4N2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili1179 – 1240Sequence analysisAdd BLAST62

Sequence similaritiesi

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3614. Eukaryota.
ENOG410XR5B. LUCA.
GeneTreeiENSGT00760000119127.
HOGENOMiHOG000230920.
HOVERGENiHBG055663.
InParanoidiQ7Z4N2.
KOiK04976.
OMAiPPCGEHL.
OrthoDBiEOG091G0DHL.
PhylomeDBiQ7Z4N2.
TreeFamiTF314204.

Family and domain databases

InterProiIPR005821. Ion_trans_dom.
IPR029588. TRPM1.
IPR032415. TRPM_tetra.
[Graphical view]
PANTHERiPTHR13800:SF13. PTHR13800:SF13. 2 hits.
PfamiPF00520. Ion_trans. 1 hit.
PF16519. TRPM_tetra. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q7Z4N2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKDSNRCCCG QFTNQHIPPL PSATPSKNEE ESKQVETQPE KWSVAKHTQS
60 70 80 90 100
YPTDSYGVLE FQGGGYSNKA MYIRVSYDTK PDSLLHLMVK DWQLELPKLL
110 120 130 140 150
ISVHGGLQNF EMQPKLKQVF GKGLIKAAMT TGAWIFTGGV STGVISHVGD
160 170 180 190 200
ALKDHSSKSR GRVCAIGIAP WGIVENKEDL VGKDVTRVYQ TMSNPLSKLS
210 220 230 240 250
VLNNSHTHFI LADNGTLGKY GAEVKLRRLL EKHISLQKIN TRLGQGVPLV
260 270 280 290 300
GLVVEGGPNV VSIVLEYLQE EPPIPVVICD GSGRASDILS FAHKYCEEGG
310 320 330 340 350
IINESLREQL LVTIQKTFNY NKAQSHQLFA IIMECMKKKE LVTVFRMGSE
360 370 380 390 400
GQQDIEMAIL TALLKGTNVS APDQLSLALA WNRVDIARSQ IFVFGPHWPP
410 420 430 440 450
LGSLAPPTDS KATEKEKKPP MATTKGGRGK GKGKKKGKVK EEVEEETDPR
460 470 480 490 500
KIELLNWVNA LEQAMLDALV LDRVDFVKLL IENGVNMQHF LTIPRLEELY
510 520 530 540 550
NTRLGPPNTL HLLVRDVKKS NLPPDYHISL IDIGLVLEYL MGGAYRCNYT
560 570 580 590 600
RKNFRTLYNN LFGPKRPKAL KLLGMEDDEP PAKGKKKKKK KKEEEIDIDV
610 620 630 640 650
DDPAVSRFQY PFHELMVWAV LMKRQKMAVF LWQRGEESMA KALVACKLYK
660 670 680 690 700
AMAHESSESD LVDDISQDLD NNSKDFGQLA LELLDQSYKH DEQIAMKLLT
710 720 730 740 750
YELKNWSNST CLKLAVAAKH RDFIAHTCSQ MLLTDMWMGR LRMRKNPGLK
760 770 780 790 800
VIMGILLPPT ILFLEFRTYD DFSYQTSKEN EDGKEKEEEN TDANADAGSR
810 820 830 840 850
KGDEENEHKK QRSIPIGTKI CEFYNAPIVK FWFYTISYLG YLLLFNYVIL
860 870 880 890 900
VRMDGWPSLQ EWIVISYIVS LALEKIREIL MSEPGKLSQK IKVWLQEYWN
910 920 930 940 950
ITDLVAISTF MIGAILRLQN QPYMGYGRVI YCVDIIFWYI RVLDIFGVNK
960 970 980 990 1000
YLGPYVMMIG KMMIDMLYFV VIMLVVLMSF GVARQAILHP EEKPSWKLAR
1010 1020 1030 1040 1050
NIFYMPYWMI YGEVFADQID LYAMEINPPC GENLYDEEGK RLPPCIPGAW
1060 1070 1080 1090 1100
LTPALMACYL LVANILLVNL LIAVFNNTFF EVKSISNQVW KFQRYQLIMT
1110 1120 1130 1140 1150
FHDRPVLPPP MIILSHIYII IMRLSGRCRK KREGDQEERD RGLKLFLSDE
1160 1170 1180 1190 1200
ELKRLHEFEE QCVQEHFREK EDEQQSSSDE RIRVTSERVE NMSMRLEEIN
1210 1220 1230 1240 1250
ERETFMKTSL QTVDLRLAQL EELSNRMVNA LENLAGIDRS DLIQARSRAS
1260 1270 1280 1290 1300
SECEATYLLR QSSINSADGY SLYRYHFNGE ELLFEDTSLS TSPGTGVRKK
1310 1320 1330 1340 1350
TCSFRIKEEK DVKTHLVPEC QNSLHLSLGT STSATPDGSH LAVDDLKNAE
1360 1370 1380 1390 1400
ESKLGPDIGI SKEDDERQTD SKKEETISPS LNKTDVIHGQ DKSDVQNTQL
1410 1420 1430 1440 1450
TVETTNIEGT ISYPLEETKI TRYFPDETIN ACKTMKSRSF VYSRGRKLVG
1460 1470 1480 1490 1500
GVNQDVEYSS ITDQQLTTEW QCQVQKITRS HSTDIPYIVS EAAVQAEHKE
1510 1520 1530 1540 1550
QFADMQDEHH VAEAIPRIPR LSLTITDRNG MENLLSVKPD QTLGFPSLRS
1560 1570 1580 1590 1600
KSLHGHPRNV KSIQGKLDRS GHASSVSSLV IVSGMTAEEK KVKKEKASTE

TEC
Note: No experimental confirmation available.Curated
Length:1,603
Mass (Da):182,178
Last modified:April 8, 2008 - v2
Checksum:i8B9658FAE3F7B32F
GO
Isoform 22 Publications (identifier: Q7Z4N2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: Missing.

Show »
Length:1,533
Mass (Da):174,418
Checksum:iD824DC467BC1A70F
GO
Isoform 31 Publication (identifier: Q7Z4N2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     295-300: Missing.

Show »
Length:1,597
Mass (Da):181,540
Checksum:i44A93B1C9CF533C7
GO
Isoform 41 Publication (identifier: Q7Z4N2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     301-1603: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:300
Mass (Da):32,814
Checksum:iEA1EE23D05248823
GO
Isoform 5 (identifier: Q7Z4N2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSSFKRGSLKSSTSGSQKGQKSWIEKTFCKRECIFVIPSM

Show »
Length:1,642
Mass (Da):186,545
Checksum:i8FCF58496AF8504D
GO
Isoform 6 (identifier: Q7Z4N2-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGQKSWIEKTFCKRECIFVIPSM

Show »
Length:1,625
Mass (Da):184,792
Checksum:i242329CE4A78C0F6
GO
Isoform 7 (identifier: Q7Z4N2-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     72-136: YIRVSYDTKP...AAMTTGAWIF → VRKAFRHGAT...AMRLGNWTPL
     137-1603: Missing.

Show »
Length:136
Mass (Da):15,099
Checksum:iEAA6CA0DA32B87D7
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti1M → T in ADJ52077 (PubMed:19436059).Curated1
Sequence conflicti369V → L in BAC80200 (Ref. 3) Curated1
Sequence conflicti1195R → G in BAC80201 (Ref. 3) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0631736R → W.2 Publications1
Natural variantiVAR_05237032S → N.3 PublicationsCorresponds to variant rs2241493dbSNPEnsembl.1
Natural variantiVAR_06317456Y → C in CSNB1C. 1 Publication1
Natural variantiVAR_06317572Y → C in CSNB1C. 1 PublicationCorresponds to variant rs200514769dbSNPEnsembl.1
Natural variantiVAR_06317674R → C in CSNB1C. 2 PublicationsCorresponds to variant rs774365264dbSNPEnsembl.1
Natural variantiVAR_06317799L → P in CSNB1C. 2 PublicationsCorresponds to variant rs191205969dbSNPEnsembl.1
Natural variantiVAR_063178364L → R in CSNB1C. 1 PublicationCorresponds to variant rs372608320dbSNPEnsembl.1
Natural variantiVAR_063179399P → T.2 PublicationsCorresponds to variant rs141540242dbSNPEnsembl.1
Natural variantiVAR_063180473R → P in CSNB1C. 1 Publication1
Natural variantiVAR_063181534G → R in CSNB1C. 1 PublicationCorresponds to variant rs748043795dbSNPEnsembl.1
Natural variantiVAR_063182541M → K in CSNB1C. 1 Publication1
Natural variantiVAR_052371605V → M.2 PublicationsCorresponds to variant rs17815774dbSNPEnsembl.1
Natural variantiVAR_063183611P → H in CSNB1C. 1 PublicationCorresponds to variant rs267607139dbSNPEnsembl.1
Natural variantiVAR_063184721R → Q in CSNB1C. 1 PublicationCorresponds to variant rs781460164dbSNPEnsembl.1
Natural variantiVAR_063185883E → G in CSNB1C. 1 PublicationCorresponds to variant rs574652148dbSNPEnsembl.1
Natural variantiVAR_063186962M → T in a patient with night blindness started in the third decade; associated in cis with G-1438. 1 Publication1
Natural variantiVAR_0631871002I → F in CSNB1C. 1 PublicationCorresponds to variant rs369484186dbSNPEnsembl.1
Natural variantiVAR_0631881161Q → H.1 PublicationCorresponds to variant rs182549235dbSNPEnsembl.1
Natural variantiVAR_0523721229N → T.1 PublicationCorresponds to variant rs17227996dbSNPEnsembl.1
Natural variantiVAR_0523731305R → H.Corresponds to variant rs13380059dbSNPEnsembl.1
Natural variantiVAR_0631891379P → T.1 PublicationCorresponds to variant rs61734298dbSNPEnsembl.1
Natural variantiVAR_0523741395V → I.2 PublicationsCorresponds to variant rs3784588dbSNPEnsembl.1
Natural variantiVAR_0523751422R → G.Corresponds to variant rs3784587dbSNPEnsembl.1
Natural variantiVAR_0631901422R → W.1 Publication1
Natural variantiVAR_0631911438R → G in a patient with night blindness started in the third decade; associated in cis with T-962. 1 Publication1
Natural variantiVAR_0523761498H → Q.2 PublicationsCorresponds to variant rs12898290dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0527481 – 70Missing in isoform 2. 2 PublicationsAdd BLAST70
Alternative sequenceiVSP_0467861M → MSSFKRGSLKSSTSGSQKGQ KSWIEKTFCKRECIFVIPSM in isoform 5. 1 Publication1
Alternative sequenceiVSP_0467871M → MGQKSWIEKTFCKRECIFVI PSM in isoform 6. 1 Publication1
Alternative sequenceiVSP_04678872 – 136YIRVS…GAWIF → VRKAFRHGATRITAFIGGQS PSPKLQIPGLLHGCGSIFLD ISLKNQEIYLCTWLLAMRLG NWTPL in isoform 7. 1 PublicationAdd BLAST65
Alternative sequenceiVSP_046789137 – 1603Missing in isoform 7. 1 PublicationAdd BLAST1467
Alternative sequenceiVSP_052749295 – 300Missing in isoform 3. 1 Publication6
Alternative sequenceiVSP_052750301 – 1603Missing in isoform 4. 1 PublicationAdd BLAST1303

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF071787 mRNA. Translation: AAC80000.1.
HM135790 mRNA. Translation: ADJ52077.1.
HM135791 mRNA. Translation: ADJ52078.1.
AB115498 mRNA. Translation: BAC80200.1.
AB115499 mRNA. Translation: BAC80201.1.
AB115500 mRNA. Translation: BAC80202.1.
AB115501 mRNA. Translation: BAC80203.1.
AB115502 mRNA. Translation: BAC80204.1.
AC009562 Genomic DNA. No translation available.
AC090829 Genomic DNA. No translation available.
CH471216 Genomic DNA. Translation: EAW61261.1.
BC058286 mRNA. Translation: AAH58286.1.
CCDSiCCDS10024.2. [Q7Z4N2-1]
CCDS58345.1. [Q7Z4N2-7]
CCDS58346.1. [Q7Z4N2-6]
CCDS58347.1. [Q7Z4N2-5]
RefSeqiNP_001238949.1. NM_001252020.1. [Q7Z4N2-5]
NP_001238953.1. NM_001252024.1. [Q7Z4N2-6]
NP_001238959.1. NM_001252030.1. [Q7Z4N2-7]
NP_002411.3. NM_002420.5. [Q7Z4N2-1]
UniGeneiHs.155942.
Hs.732541.

Genome annotation databases

EnsembliENST00000256552; ENSP00000256552; ENSG00000134160. [Q7Z4N2-6]
ENST00000397795; ENSP00000380897; ENSG00000134160. [Q7Z4N2-1]
ENST00000542188; ENSP00000437849; ENSG00000134160. [Q7Z4N2-5]
ENST00000559179; ENSP00000453851; ENSG00000134160. [Q7Z4N2-7]
ENST00000560658; ENSP00000454077; ENSG00000134160. [Q7Z4N2-4]
GeneIDi4308.
KEGGihsa:4308.
UCSCiuc001zfm.4. human. [Q7Z4N2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF071787 mRNA. Translation: AAC80000.1.
HM135790 mRNA. Translation: ADJ52077.1.
HM135791 mRNA. Translation: ADJ52078.1.
AB115498 mRNA. Translation: BAC80200.1.
AB115499 mRNA. Translation: BAC80201.1.
AB115500 mRNA. Translation: BAC80202.1.
AB115501 mRNA. Translation: BAC80203.1.
AB115502 mRNA. Translation: BAC80204.1.
AC009562 Genomic DNA. No translation available.
AC090829 Genomic DNA. No translation available.
CH471216 Genomic DNA. Translation: EAW61261.1.
BC058286 mRNA. Translation: AAH58286.1.
CCDSiCCDS10024.2. [Q7Z4N2-1]
CCDS58345.1. [Q7Z4N2-7]
CCDS58346.1. [Q7Z4N2-6]
CCDS58347.1. [Q7Z4N2-5]
RefSeqiNP_001238949.1. NM_001252020.1. [Q7Z4N2-5]
NP_001238953.1. NM_001252024.1. [Q7Z4N2-6]
NP_001238959.1. NM_001252030.1. [Q7Z4N2-7]
NP_002411.3. NM_002420.5. [Q7Z4N2-1]
UniGeneiHs.155942.
Hs.732541.

3D structure databases

ProteinModelPortaliQ7Z4N2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110453. 4 interactors.
IntActiQ7Z4N2. 2 interactors.
STRINGi9606.ENSP00000380897.

Chemistry databases

GuidetoPHARMACOLOGYi493.

Protein family/group databases

TCDBi1.A.4.5.2. the transient receptor potential ca(2+) channel (trp-cc) family.

PTM databases

iPTMnetiQ7Z4N2.
PhosphoSitePlusiQ7Z4N2.

Polymorphism and mutation databases

BioMutaiTRPM1.
DMDMi182701419.

Proteomic databases

EPDiQ7Z4N2.
MaxQBiQ7Z4N2.
PaxDbiQ7Z4N2.
PeptideAtlasiQ7Z4N2.
PRIDEiQ7Z4N2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000256552; ENSP00000256552; ENSG00000134160. [Q7Z4N2-6]
ENST00000397795; ENSP00000380897; ENSG00000134160. [Q7Z4N2-1]
ENST00000542188; ENSP00000437849; ENSG00000134160. [Q7Z4N2-5]
ENST00000559179; ENSP00000453851; ENSG00000134160. [Q7Z4N2-7]
ENST00000560658; ENSP00000454077; ENSG00000134160. [Q7Z4N2-4]
GeneIDi4308.
KEGGihsa:4308.
UCSCiuc001zfm.4. human. [Q7Z4N2-1]

Organism-specific databases

CTDi4308.
DisGeNETi4308.
GeneCardsiTRPM1.
HGNCiHGNC:7146. TRPM1.
HPAiHPA014785.
MalaCardsiTRPM1.
MIMi603576. gene.
613216. phenotype.
neXtProtiNX_Q7Z4N2.
OpenTargetsiENSG00000134160.
Orphaneti215. Congenital stationary night blindness.
PharmGKBiPA35496.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3614. Eukaryota.
ENOG410XR5B. LUCA.
GeneTreeiENSGT00760000119127.
HOGENOMiHOG000230920.
HOVERGENiHBG055663.
InParanoidiQ7Z4N2.
KOiK04976.
OMAiPPCGEHL.
OrthoDBiEOG091G0DHL.
PhylomeDBiQ7Z4N2.
TreeFamiTF314204.

Enzyme and pathway databases

ReactomeiR-HSA-3295583. TRP channels.

Miscellaneous databases

GeneWikiiTRPM1.
GenomeRNAii4308.
PROiQ7Z4N2.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000134160.
CleanExiHS_TRPM1.
ExpressionAtlasiQ7Z4N2. baseline and differential.
GenevisibleiQ7Z4N2. HS.

Family and domain databases

InterProiIPR005821. Ion_trans_dom.
IPR029588. TRPM1.
IPR032415. TRPM_tetra.
[Graphical view]
PANTHERiPTHR13800:SF13. PTHR13800:SF13. 2 hits.
PfamiPF00520. Ion_trans. 1 hit.
PF16519. TRPM_tetra. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTRPM1_HUMAN
AccessioniPrimary (citable) accession number: Q7Z4N2
Secondary accession number(s): D9IDV2
, D9IDV3, F8W865, H0YN37, O75560, Q6PE48, Q7Z4N1, Q7Z4N3, Q7Z4N4, Q7Z4N5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: April 8, 2008
Last modified: November 30, 2016
This is version 109 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.