Q7Z4H8 (KDEL2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 79.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: KDEL motif-containing protein 2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 507 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subcellular location | Endoplasmic reticulum lumen Potential. |
| Sequence similarities | Belongs to the KDELC family. Contains 1 filamin repeat. |
| Sequence caution | The sequence BAC05260.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Endoplasmic reticulum |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | endoplasmic reticulum lumen Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q7Z4H8-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q7Z4H8-2) The sequence of this isoform differs from the canonical sequence as follows: 1-56: Missing. 57-67: SEGQNLTRSPA → MVELFIFLFLL | ||||||
| Isoform 3 (identifier: Q7Z4H8-3) The sequence of this isoform differs from the canonical sequence as follows: 1-56: Missing. 57-67: SEGQNLTRSPA → MVELFIFLFLL 432-465: ENDEEAKKIAKEGQLMARDLLQPHRLYCYYYQVL → SFTLSPRLECSGTISTHCNLCLPGSRNFVPQPPE 466-507: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 20 | 20 | Potential | ||||||
| Chain | 21 – 507 | 487 | KDEL motif-containing protein 2 | PRO_0000247196 | |||||
Regions | |||||||||
| Repeat | 24 – 134 | 111 | Filamin | ||||||
| Motif | 504 – 507 | 4 | Prevents secretion from ER Potential | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 61 | 1 | N-linked (GlcNAc...) Ref.5 | ||||||
| Glycosylation | 306 | 1 | N-linked (GlcNAc...) Ref.5 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 56 | 56 | Missing in isoform 2 and isoform 3. | VSP_019944 | |||||
| Alternative sequence | 57 – 67 | 11 | SEGQNLTRSPA → MVELFIFLFLL in isoform 2 and isoform 3. | VSP_019945 | |||||
| Alternative sequence | 432 – 465 | 34 | ENDEE…YYQVL → SFTLSPRLECSGTISTHCNL CLPGSRNFVPQPPE in isoform 3. | VSP_019946 | |||||
| Alternative sequence | 466 – 507 | 42 | Missing in isoform 3. | VSP_019947 | |||||
| Natural variant | 319 | 1 | R → L. Ref.4 Corresponds to variant rs17853654 [ dbSNP | Ensembl ]. | VAR_027086 | |||||
Experimental info | |||||||||
| Sequence conflict | 101 | 1 | L → S in AAQ09021. Ref.1 | ||||||
| Sequence conflict | 115 | 1 | K → T in AAQ09021. Ref.1 | ||||||
| Sequence conflict | 132 | 1 | L → S in AAQ09021. Ref.1 | ||||||
| Sequence conflict | 158 | 1 | T → N in AAQ09021. Ref.1 | ||||||
| Sequence conflict | 161 | 1 | P → T in AAQ09021. Ref.1 | ||||||
| Sequence conflict | 185 | 1 | R → S in AAQ09021. Ref.1 | ||||||
| Sequence conflict | 188 | 1 | D → Y in AAQ09021. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | Ding P., Han W., Xia D., Wu C., Liu Y., Wu C., Ma D. Submitted (JUL-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Testis. |
| [2] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 324-507 (ISOFORMS 1/2). Tissue: Placenta and Uterus. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT LEU-319. Tissue: Testis. |
| [5] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-61 AND ASN-306, MASS SPECTROMETRY. Tissue: Liver. |
| [6] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF533708 mRNA. Translation: AAQ09021.1. AY358616 mRNA. Translation: AAQ88979.1. AK098206 mRNA. Translation: BAC05260.1. Different initiation. AK125519 mRNA. Translation: BAC86191.1. BC036526 mRNA. Translation: AAH36526.3. |
| IPI | IPI00143921. IPI00445699. IPI00783221. |
| RefSeq | NP_714916.3. NM_153705.4. |
| UniGene | Hs.83286. |
3D structure databases | |
| ProteinModelPortal | Q7Z4H8. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q7Z4H8. 1 interaction. |
| STRING | 9606.ENSP00000315386. |
PTM databases | |
| PhosphoSite | Q7Z4H8. |
Polymorphism databases | |
| DMDM | 110810398. |
Proteomic databases | |
| PaxDb | Q7Z4H8. |
| PRIDE | Q7Z4H8. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000323468; ENSP00000315386; ENSG00000178202. ENST00000375648; ENSP00000364799; ENSG00000178202. ENST00000434945; ENSP00000413429; ENSG00000178202. ENST00000530529; ENSP00000431796; ENSG00000178202. |
| GeneID | 143888. |
| KEGG | hsa:143888. |
| UCSC | uc001pki.2. human. uc001pkj.2. human. |
Organism-specific databases | |
| CTD | 143888. |
| GeneCards | GC11M108342. |
| H-InvDB | HIX0010092. |
| HGNC | HGNC:28496. KDELC2. |
| HPA | HPA039315. HPA039817. |
| neXtProt | NX_Q7Z4H8. |
| PharmGKB | PA134904072. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG248922. |
| HOGENOM | HOG000286007. |
| HOVERGEN | HBG081852. |
| InParanoid | Q7Z4H8. |
| OMA | HRLYCYY. |
| OrthoDB | EOG469QTW. |
| PhylomeDB | Q7Z4H8. |
Gene expression databases | |
| ArrayExpress | Q7Z4H8. |
| Bgee | Q7Z4H8. |
| CleanEx | HS_KDELC2. |
| Genevestigator | Q7Z4H8. |
| GermOnline | ENSG00000178202. Homo sapiens. |
Family and domain databases | |
| Gene3D | 2.60.40.10. 1 hit. |
| InterPro | IPR001298. Filamin. IPR017868. Filamin/ABP280_repeat-like. IPR013783. Ig-like_fold. IPR014756. Ig_E-set. IPR006598. LipoPS_modifying. [Graphical view] |
| Pfam | PF00630. Filamin. 1 hit. PF05686. Glyco_transf_90. 1 hit. [Graphical view] |
| SMART | SM00672. CAP10. 1 hit. SM00557. IG_FLMN. 1 hit. [Graphical view] |
| SUPFAM | SSF81296. Ig_E-set. 1 hit. |
| PROSITE | PS00014. ER_TARGET. 1 hit. PS50194. FILAMIN_REPEAT. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 143888. |
| NextBio | 84805. |
Entry information
| Entry name | KDEL2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q7Z4H8 Secondary accession number(s): Q6UWW2 Q8NE24 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
