Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q7Z465

- BNIPL_HUMAN

UniProt

Q7Z465 - BNIPL_HUMAN

Protein

Bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein

Gene

BNIPL

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 100 (01 Oct 2014)
      Sequence version 1 (01 Oct 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May be a bridge molecule between BCL2 and ARHGAP1/CDC42 in promoting cell death.1 Publication

    GO - Molecular functioni

    1. identical protein binding Source: UniProtKB
    2. protein binding Source: UniProtKB

    GO - Biological processi

    1. apoptotic process Source: MGI
    2. negative regulation of cell proliferation Source: UniProtKB
    3. regulation of growth rate Source: UniProtKB

    Keywords - Biological processi

    Apoptosis

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein
    Gene namesi
    Name:BNIPL
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:16976. BNIPL.

    Subcellular locationi

    GO - Cellular componenti

    1. cytosol Source: UniProtKB
    2. nucleus Source: UniProtKB

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA38196.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 357357Bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like proteinPRO_0000210770Add
    BLAST

    Proteomic databases

    PaxDbiQ7Z465.
    PRIDEiQ7Z465.

    PTM databases

    PhosphoSiteiQ7Z465.

    Expressioni

    Tissue specificityi

    Isoform 2 is expressed in placenta and lung.1 Publication

    Gene expression databases

    ArrayExpressiQ7Z465.
    BgeeiQ7Z465.
    CleanExiHS_BNIPL.
    GenevestigatoriQ7Z465.

    Organism-specific databases

    HPAiHPA019946.
    HPA023464.

    Interactioni

    Subunit structurei

    Homodimer. Interacts with BCL2, ARHGAP1, MIF and GFER.2 Publications

    Protein-protein interaction databases

    BioGridi127211. 16 interactions.
    IntActiQ7Z465. 8 interactions.
    MINTiMINT-263518.
    STRINGi9606.ENSP00000357927.

    Structurei

    3D structure databases

    ProteinModelPortaliQ7Z465.
    SMRiQ7Z465. Positions 206-338.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini191 – 352162CRAL-TRIOPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 CRAL-TRIO domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG146834.
    HOGENOMiHOG000230952.
    HOVERGENiHBG054692.
    InParanoidiQ7Z465.
    OMAiRVFRTGQ.
    OrthoDBiEOG7HB59B.
    PhylomeDBiQ7Z465.
    TreeFamiTF324164.

    Family and domain databases

    Gene3Di3.40.525.10. 1 hit.
    InterProiIPR022181. Bcl2-/adenovirus-E1B.
    IPR001251. CRAL-TRIO_dom.
    [Graphical view]
    PfamiPF12496. BNIP2. 1 hit.
    PF13716. CRAL_TRIO_2. 1 hit.
    [Graphical view]
    SMARTiSM00516. SEC14. 1 hit.
    [Graphical view]
    SUPFAMiSSF52087. SSF52087. 1 hit.
    PROSITEiPS50191. CRAL_TRIO. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q7Z465-1) [UniParc]FASTAAdd to Basket

    Also known as: BNIPL-2

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGTIQEAGKK TDVGVREIAE APELGAALRH GELELKEEWQ DEEFPRLLPE    50
    EAGTSEDPED PKGDSQAAAG TPSTLALCGQ RPMRKRLSAP ELRLSLTKGP 100
    GNDGASPTQS APSSPDGSSD LEIDELETPS DSEQLDSGHE FEWEDELPRA 150
    EGLGTSETAE RLGRGCMWDV TGEDGHHWRV FRMGPREQRV DMTVIEPYKK 200
    VLSHGGYHGD GLNAVILFAS CYLPRSSIPN YTYVMEHLFR YMVGTLELLV 250
    AENYLLVHLS GGTSRAQVPP LSWIRQCYRT LDRRLRKNLR ALVVVHATWY 300
    VKAFLALLRP FISSKFTRKI RFLDSLGELA QLISLDQVHI PEAVRQLDRD 350
    LHGSGGT 357
    Length:357
    Mass (Da):39,713
    Last modified:October 1, 2003 - v1
    Checksum:iC0BCF92BACE9DE4F
    GO
    Isoform 2 (identifier: Q7Z465-2) [UniParc]FASTAAdd to Basket

    Also known as: BNIPL-1, BNIP-Salpha

    The sequence of this isoform differs from the canonical sequence as follows:
         1-82: Missing.

    Show »
    Length:275
    Mass (Da):30,974
    Checksum:iC4C63FDB0EA356CE
    GO
    Isoform 3 (identifier: Q7Z465-3) [UniParc]FASTAAdd to Basket

    Also known as: BNIP-Sbeta

    The sequence of this isoform differs from the canonical sequence as follows:
         1-82: Missing.
         285-357: LRKNLRALVVVHATWYVKAFLALLRPFISSKFTRKIRFLDSLGELAQLISLDQVHIPEAVRQLDRDLHGSGGT → VL

    Show »
    Length:204
    Mass (Da):22,908
    Checksum:iE771FBD9F1B2E2AB
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti65 – 651S → N.
    Corresponds to variant rs12068365 [ dbSNP | Ensembl ].
    VAR_051917
    Natural varianti226 – 2261S → N.
    Corresponds to variant rs12068365 [ dbSNP | Ensembl ].
    VAR_051918

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 8282Missing in isoform 2 and isoform 3. 2 PublicationsVSP_012448Add
    BLAST
    Alternative sequencei285 – 35773LRKNL…GSGGT → VL in isoform 3. 1 PublicationVSP_012449Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF193056 mRNA. Translation: AAG22484.1.
    AY078983 mRNA. Translation: AAL85483.1.
    AY078984 mRNA. Translation: AAL85484.1.
    AY033000 mRNA. Translation: AAK54348.1.
    AL590133 Genomic DNA. Translation: CAI13344.1.
    AL590133 Genomic DNA. Translation: CAI13347.1.
    BC027868 mRNA. Translation: AAH27868.2.
    BC074779 mRNA. Translation: AAH74779.3.
    BC074780 mRNA. Translation: AAH74780.3.
    CCDSiCCDS53362.1. [Q7Z465-2]
    CCDS978.2. [Q7Z465-1]
    RefSeqiNP_001153114.1. NM_001159642.1. [Q7Z465-2]
    NP_612122.2. NM_138278.3. [Q7Z465-1]
    UniGeneiHs.591473.

    Genome annotation databases

    EnsembliENST00000295294; ENSP00000295294; ENSG00000163141. [Q7Z465-2]
    ENST00000368931; ENSP00000357927; ENSG00000163141. [Q7Z465-1]
    ENST00000485855; ENSP00000435072; ENSG00000163141. [Q7Z465-3]
    GeneIDi149428.
    KEGGihsa:149428.
    UCSCiuc001ewl.2. human. [Q7Z465-1]

    Polymorphism databases

    DMDMi57012595.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF193056 mRNA. Translation: AAG22484.1 .
    AY078983 mRNA. Translation: AAL85483.1 .
    AY078984 mRNA. Translation: AAL85484.1 .
    AY033000 mRNA. Translation: AAK54348.1 .
    AL590133 Genomic DNA. Translation: CAI13344.1 .
    AL590133 Genomic DNA. Translation: CAI13347.1 .
    BC027868 mRNA. Translation: AAH27868.2 .
    BC074779 mRNA. Translation: AAH74779.3 .
    BC074780 mRNA. Translation: AAH74780.3 .
    CCDSi CCDS53362.1. [Q7Z465-2 ]
    CCDS978.2. [Q7Z465-1 ]
    RefSeqi NP_001153114.1. NM_001159642.1. [Q7Z465-2 ]
    NP_612122.2. NM_138278.3. [Q7Z465-1 ]
    UniGenei Hs.591473.

    3D structure databases

    ProteinModelPortali Q7Z465.
    SMRi Q7Z465. Positions 206-338.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 127211. 16 interactions.
    IntActi Q7Z465. 8 interactions.
    MINTi MINT-263518.
    STRINGi 9606.ENSP00000357927.

    PTM databases

    PhosphoSitei Q7Z465.

    Polymorphism databases

    DMDMi 57012595.

    Proteomic databases

    PaxDbi Q7Z465.
    PRIDEi Q7Z465.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000295294 ; ENSP00000295294 ; ENSG00000163141 . [Q7Z465-2 ]
    ENST00000368931 ; ENSP00000357927 ; ENSG00000163141 . [Q7Z465-1 ]
    ENST00000485855 ; ENSP00000435072 ; ENSG00000163141 . [Q7Z465-3 ]
    GeneIDi 149428.
    KEGGi hsa:149428.
    UCSCi uc001ewl.2. human. [Q7Z465-1 ]

    Organism-specific databases

    CTDi 149428.
    GeneCardsi GC01P151009.
    HGNCi HGNC:16976. BNIPL.
    HPAi HPA019946.
    HPA023464.
    MIMi 611275. gene.
    neXtProti NX_Q7Z465.
    PharmGKBi PA38196.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG146834.
    HOGENOMi HOG000230952.
    HOVERGENi HBG054692.
    InParanoidi Q7Z465.
    OMAi RVFRTGQ.
    OrthoDBi EOG7HB59B.
    PhylomeDBi Q7Z465.
    TreeFami TF324164.

    Miscellaneous databases

    GeneWikii BNIPL.
    GenomeRNAii 149428.
    NextBioi 86145.
    PROi Q7Z465.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q7Z465.
    Bgeei Q7Z465.
    CleanExi HS_BNIPL.
    Genevestigatori Q7Z465.

    Family and domain databases

    Gene3Di 3.40.525.10. 1 hit.
    InterProi IPR022181. Bcl2-/adenovirus-E1B.
    IPR001251. CRAL-TRIO_dom.
    [Graphical view ]
    Pfami PF12496. BNIP2. 1 hit.
    PF13716. CRAL_TRIO_2. 1 hit.
    [Graphical view ]
    SMARTi SM00516. SEC14. 1 hit.
    [Graphical view ]
    SUPFAMi SSF52087. SSF52087. 1 hit.
    PROSITEi PS50191. CRAL_TRIO. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The BNIP-2 and Cdc42GAP homology/Sec14p-like domain of BNIP-Salpha is a novel apoptosis-inducing sequence."
      Zhou Y.T., Soh U.J.K., Shang X., Guy G.R., Low B.C.
      J. Biol. Chem. 277:7483-7492(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3).
    2. "BNIPL-2, a novel homologue of BNIP-2, interacts with Bcl-2 and Cdc42GAP in apoptosis."
      Qin W., Hu J., Guo M., Xu J., Li J., Yao G., Zhou X., Jiang H., Zhang P., Shen L., Wan D., Gu J.
      Biochem. Biophys. Res. Commun. 308:379-385(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH BCL2 AND ARHGAP1, FUNCTION.
      Tissue: Placenta.
    3. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    5. "The apoptosis-associated protein BNIPL interacts with two cell proliferation-related proteins, MIF and GFER."
      Shen L., Hu J., Lu H., Wu M., Qin W., Wan D., Li Y.-Y., Gu J.
      FEBS Lett. 540:86-90(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH GIF AND GFER, TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiBNIPL_HUMAN
    AccessioniPrimary (citable) accession number: Q7Z465
    Secondary accession number(s): Q6DK43, Q8TCY7, Q8WYG2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 4, 2005
    Last sequence update: October 1, 2003
    Last modified: October 1, 2014
    This is version 100 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3