Q7Z465 (BNIPL_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 86.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 357 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
Ontologies
| Keywords | |
|---|---|
| Biological process | Apoptosis |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | apoptotic process Inferred from direct assay Ref.1Ref.2. Source: UniProtKB induction of apoptosisInferred from direct assay Ref.1. Source: MGI negative regulation of cell proliferationInferred from direct assay Ref.5. Source: UniProtKB regulation of growth rateInferred from direct assay Ref.5. Source: UniProtKB |
| Cellular_component | cytosol Inferred from direct assay Ref.1. Source: UniProtKB nucleusInferred from direct assay Ref.1. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q7Z465-1) Also known as: BNIPL-2; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q7Z465-2) Also known as: BNIPL-1; BNIP-Salpha; The sequence of this isoform differs from the canonical sequence as follows: 1-82: Missing. | ||||||
| Isoform 3 (identifier: Q7Z465-3) Also known as: BNIP-Sbeta; The sequence of this isoform differs from the canonical sequence as follows: 1-82: Missing. 285-357: LRKNLRALVVVHATWYVKAFLALLRPFISSKFTRKIRFLDSLGELAQLISLDQVHIPEAVRQLDRDLHGSGGT → VL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 357 | 357 | Bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein | PRO_0000210770 | |||||
Regions | |||||||||
| Domain | 191 – 352 | 162 | CRAL-TRIO | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 82 | 82 | Missing in isoform 2 and isoform 3. | VSP_012448 | |||||
| Alternative sequence | 285 – 357 | 73 | LRKNL…GSGGT → VL in isoform 3. | VSP_012449 | |||||
| Natural variant | 65 | 1 | S → N. Corresponds to variant rs12068365 [ dbSNP | Ensembl ]. | VAR_051917 | |||||
| Natural variant | 226 | 1 | S → N. Corresponds to variant rs12068365 [ dbSNP | Ensembl ]. | VAR_051918 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The BNIP-2 and Cdc42GAP homology/Sec14p-like domain of BNIP-Salpha is a novel apoptosis-inducing sequence." Zhou Y.T., Soh U.J.K., Shang X., Guy G.R., Low B.C. J. Biol. Chem. 277:7483-7492(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3). |
| [2] | "BNIPL-2, a novel homologue of BNIP-2, interacts with Bcl-2 and Cdc42GAP in apoptosis." Qin W., Hu J., Guo M., Xu J., Li J., Yao G., Zhou X., Jiang H., Zhang P., Shen L., Wan D., Gu J. Biochem. Biophys. Res. Commun. 308:379-385(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH BCL2 AND ARHGAP1, FUNCTION. Tissue: Placenta. |
| [3] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). |
| [5] | "The apoptosis-associated protein BNIPL interacts with two cell proliferation-related proteins, MIF and GFER." Shen L., Hu J., Lu H., Wu M., Qin W., Wan D., Li Y.-Y., Gu J. FEBS Lett. 540:86-90(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH GIF AND GFER, TISSUE SPECIFICITY. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF193056 mRNA. Translation: AAG22484.1. AY078983 mRNA. Translation: AAL85483.1. AY078984 mRNA. Translation: AAL85484.1. AY033000 mRNA. Translation: AAK54348.1. AL590133 Genomic DNA. Translation: CAI13344.1. AL590133 Genomic DNA. Translation: CAI13347.1. BC027868 mRNA. Translation: AAH27868.2. BC074779 mRNA. Translation: AAH74779.3. BC074780 mRNA. Translation: AAH74780.3. |
| IPI | IPI00107433. IPI00412103. IPI00513690. |
| RefSeq | NP_001153114.1. NM_001159642.1. NP_612122.2. NM_138278.3. |
| UniGene | Hs.591473. |
3D structure databases | |
| ProteinModelPortal | Q7Z465. |
| SMR | Q7Z465. Positions 196-338. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q7Z465. 8 interactions. |
| STRING | 9606.ENSP00000357927. |
PTM databases | |
| PhosphoSite | Q7Z465. |
Polymorphism databases | |
| DMDM | 57012595. |
Proteomic databases | |
| PaxDb | Q7Z465. |
| PRIDE | Q7Z465. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000295294; ENSP00000295294; ENSG00000163141. ENST00000368931; ENSP00000357927; ENSG00000163141. ENST00000485855; ENSP00000435072; ENSG00000163141. |
| GeneID | 149428. |
| KEGG | hsa:149428. |
| UCSC | uc001ewl.2. human. |
Organism-specific databases | |
| CTD | 149428. |
| GeneCards | GC01P151009. |
| HGNC | HGNC:16976. BNIPL. |
| HPA | HPA019946. HPA023464. |
| MIM | 611275. gene. |
| neXtProt | NX_Q7Z465. |
| PharmGKB | PA38196. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG146834. |
| HOGENOM | HOG000230952. |
| HOVERGEN | HBG054692. |
| InParanoid | Q7Z465. |
| OMA | TYVMEHL. |
| OrthoDB | EOG4001JH. |
Gene expression databases | |
| ArrayExpress | Q7Z465. |
| Bgee | Q7Z465. |
| CleanEx | HS_BNIPL. |
| Genevestigator | Q7Z465. |
| GermOnline | ENSG00000163141. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.40.525.10. 1 hit. |
| InterPro | IPR022181. Bcl2-/adenovirus-E1B. IPR001251. CRAL-TRIO_dom. [Graphical view] |
| Pfam | PF12496. BNIP2. 1 hit. [Graphical view] |
| SMART | SM00516. SEC14. 1 hit. [Graphical view] |
| SUPFAM | SSF52087. CRAL_TRIO_C. 1 hit. |
| PROSITE | PS50191. CRAL_TRIO. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 149428. |
| NextBio | 86145. |
| SOURCE | Search... |
Entry information
| Entry name | BNIPL_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q7Z465 Secondary accession number(s): Q6DK43, Q8TCY7, Q8WYG2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
