Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein

Gene

BNIPL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May be a bridge molecule between BCL2 and ARHGAP1/CDC42 in promoting cell death.1 Publication

GO - Molecular functioni

  • identical protein binding Source: UniProtKB

GO - Biological processi

  • apoptotic process Source: UniProtKB
  • negative regulation of cell proliferation Source: UniProtKB
  • regulation of growth rate Source: UniProtKB

Keywordsi

Biological processApoptosis

Names & Taxonomyi

Protein namesi
Recommended name:
Bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein
Gene namesi
Name:BNIPL
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000163141.18
HGNCiHGNC:16976 BNIPL
MIMi611275 gene
neXtProtiNX_Q7Z465

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

DisGeNETi149428
OpenTargetsiENSG00000163141
PharmGKBiPA38196

Polymorphism and mutation databases

BioMutaiBNIPL
DMDMi57012595

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002107701 – 357Bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like proteinAdd BLAST357

Proteomic databases

PaxDbiQ7Z465
PeptideAtlasiQ7Z465
PRIDEiQ7Z465

PTM databases

iPTMnetiQ7Z465
PhosphoSitePlusiQ7Z465

Expressioni

Tissue specificityi

Isoform 2 is expressed in placenta and lung.1 Publication

Gene expression databases

BgeeiENSG00000163141
CleanExiHS_BNIPL
ExpressionAtlasiQ7Z465 baseline and differential
GenevisibleiQ7Z465 HS

Interactioni

Subunit structurei

Homodimer. Interacts with BCL2, ARHGAP1, MIF and GFER.2 Publications

GO - Molecular functioni

  • identical protein binding Source: UniProtKB

Protein-protein interaction databases

BioGridi127211, 14 interactors
ELMiQ7Z465
IntActiQ7Z465, 8 interactors
STRINGi9606.ENSP00000357927

Structurei

3D structure databases

ProteinModelPortaliQ7Z465
SMRiQ7Z465
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini191 – 352CRAL-TRIOPROSITE-ProRule annotationAdd BLAST162

Phylogenomic databases

eggNOGiENOG410IE6U Eukaryota
ENOG4111F6D LUCA
GeneTreeiENSGT00420000029688
HOGENOMiHOG000230952
HOVERGENiHBG054692
InParanoidiQ7Z465
KOiK18448
OMAiVVHATWY
OrthoDBiEOG091G0E88
PhylomeDBiQ7Z465
TreeFamiTF324164

Family and domain databases

CDDicd00170 SEC14, 1 hit
Gene3Di3.40.525.10, 1 hit
InterProiView protein in InterPro
IPR022181 Bcl2-/adenovirus-E1B
IPR001251 CRAL-TRIO_dom
IPR036865 CRAL-TRIO_dom_sf
PfamiView protein in Pfam
PF12496 BNIP2, 1 hit
PF13716 CRAL_TRIO_2, 1 hit
SMARTiView protein in SMART
SM00516 SEC14, 1 hit
SUPFAMiSSF52087 SSF52087, 1 hit
PROSITEiView protein in PROSITE
PS50191 CRAL_TRIO, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7Z465-1) [UniParc]FASTAAdd to basket
Also known as: BNIPL-2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGTIQEAGKK TDVGVREIAE APELGAALRH GELELKEEWQ DEEFPRLLPE
60 70 80 90 100
EAGTSEDPED PKGDSQAAAG TPSTLALCGQ RPMRKRLSAP ELRLSLTKGP
110 120 130 140 150
GNDGASPTQS APSSPDGSSD LEIDELETPS DSEQLDSGHE FEWEDELPRA
160 170 180 190 200
EGLGTSETAE RLGRGCMWDV TGEDGHHWRV FRMGPREQRV DMTVIEPYKK
210 220 230 240 250
VLSHGGYHGD GLNAVILFAS CYLPRSSIPN YTYVMEHLFR YMVGTLELLV
260 270 280 290 300
AENYLLVHLS GGTSRAQVPP LSWIRQCYRT LDRRLRKNLR ALVVVHATWY
310 320 330 340 350
VKAFLALLRP FISSKFTRKI RFLDSLGELA QLISLDQVHI PEAVRQLDRD

LHGSGGT
Length:357
Mass (Da):39,713
Last modified:October 1, 2003 - v1
Checksum:iC0BCF92BACE9DE4F
GO
Isoform 2 (identifier: Q7Z465-2) [UniParc]FASTAAdd to basket
Also known as: BNIPL-1, BNIP-Salpha

The sequence of this isoform differs from the canonical sequence as follows:
     1-82: Missing.

Show »
Length:275
Mass (Da):30,974
Checksum:iC4C63FDB0EA356CE
GO
Isoform 3 (identifier: Q7Z465-3) [UniParc]FASTAAdd to basket
Also known as: BNIP-Sbeta

The sequence of this isoform differs from the canonical sequence as follows:
     1-82: Missing.
     285-357: LRKNLRALVVVHATWYVKAFLALLRPFISSKFTRKIRFLDSLGELAQLISLDQVHIPEAVRQLDRDLHGSGGT → VL

Show »
Length:204
Mass (Da):22,908
Checksum:iE771FBD9F1B2E2AB
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05191765S → N. Corresponds to variant dbSNP:rs12068365Ensembl.1
Natural variantiVAR_051918226S → N. Corresponds to variant dbSNP:rs12068365Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0124481 – 82Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST82
Alternative sequenceiVSP_012449285 – 357LRKNL…GSGGT → VL in isoform 3. 1 PublicationAdd BLAST73

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF193056 mRNA Translation: AAG22484.1
AY078983 mRNA Translation: AAL85483.1
AY078984 mRNA Translation: AAL85484.1
AY033000 mRNA Translation: AAK54348.1
AL590133 Genomic DNA No translation available.
BC027868 mRNA Translation: AAH27868.2
BC074779 mRNA Translation: AAH74779.3
BC074780 mRNA Translation: AAH74780.3
CCDSiCCDS53362.1 [Q7Z465-2]
CCDS978.2 [Q7Z465-1]
RefSeqiNP_001153114.1, NM_001159642.1 [Q7Z465-2]
NP_612122.2, NM_138278.3 [Q7Z465-1]
UniGeneiHs.591473

Genome annotation databases

EnsembliENST00000295294; ENSP00000295294; ENSG00000163141 [Q7Z465-2]
ENST00000368931; ENSP00000357927; ENSG00000163141 [Q7Z465-1]
ENST00000485855; ENSP00000435072; ENSG00000163141 [Q7Z465-3]
GeneIDi149428
KEGGihsa:149428
UCSCiuc001ewl.3 human [Q7Z465-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiBNIPL_HUMAN
AccessioniPrimary (citable) accession number: Q7Z465
Secondary accession number(s): Q6DK43, Q8TCY7, Q8WYG2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 4, 2005
Last sequence update: October 1, 2003
Last modified: February 28, 2018
This is version 129 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health