Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q7Z465 (BNIPL_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 99. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein
Gene names
Name:BNIPL
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length357 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May be a bridge molecule between BCL2 and ARHGAP1/CDC42 in promoting cell death. Ref.2

Subunit structure

Homodimer. Interacts with BCL2, ARHGAP1, MIF and GFER. Ref.2 Ref.5

Tissue specificity

Isoform 2 is expressed in placenta and lung. Ref.5

Sequence similarities

Contains 1 CRAL-TRIO domain.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q7Z465-1)

Also known as: BNIPL-2;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q7Z465-2)

Also known as: BNIPL-1; BNIP-Salpha;

The sequence of this isoform differs from the canonical sequence as follows:
     1-82: Missing.
Isoform 3 (identifier: Q7Z465-3)

Also known as: BNIP-Sbeta;

The sequence of this isoform differs from the canonical sequence as follows:
     1-82: Missing.
     285-357: LRKNLRALVVVHATWYVKAFLALLRPFISSKFTRKIRFLDSLGELAQLISLDQVHIPEAVRQLDRDLHGSGGT → VL

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 357357Bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein
PRO_0000210770

Regions

Domain191 – 352162CRAL-TRIO

Natural variations

Alternative sequence1 – 8282Missing in isoform 2 and isoform 3.
VSP_012448
Alternative sequence285 – 35773LRKNL…GSGGT → VL in isoform 3.
VSP_012449
Natural variant651S → N.
Corresponds to variant rs12068365 [ dbSNP | Ensembl ].
VAR_051917
Natural variant2261S → N.
Corresponds to variant rs12068365 [ dbSNP | Ensembl ].
VAR_051918

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (BNIPL-2) [UniParc].

Last modified October 1, 2003. Version 1.
Checksum: C0BCF92BACE9DE4F

FASTA35739,713
        10         20         30         40         50         60 
MGTIQEAGKK TDVGVREIAE APELGAALRH GELELKEEWQ DEEFPRLLPE EAGTSEDPED 

        70         80         90        100        110        120 
PKGDSQAAAG TPSTLALCGQ RPMRKRLSAP ELRLSLTKGP GNDGASPTQS APSSPDGSSD 

       130        140        150        160        170        180 
LEIDELETPS DSEQLDSGHE FEWEDELPRA EGLGTSETAE RLGRGCMWDV TGEDGHHWRV 

       190        200        210        220        230        240 
FRMGPREQRV DMTVIEPYKK VLSHGGYHGD GLNAVILFAS CYLPRSSIPN YTYVMEHLFR 

       250        260        270        280        290        300 
YMVGTLELLV AENYLLVHLS GGTSRAQVPP LSWIRQCYRT LDRRLRKNLR ALVVVHATWY 

       310        320        330        340        350 
VKAFLALLRP FISSKFTRKI RFLDSLGELA QLISLDQVHI PEAVRQLDRD LHGSGGT 

« Hide

Isoform 2 (BNIPL-1) (BNIP-Salpha) [UniParc].

Checksum: C4C63FDB0EA356CE
Show »

FASTA27530,974
Isoform 3 (BNIP-Sbeta) [UniParc].

Checksum: E771FBD9F1B2E2AB
Show »

FASTA20422,908

References

« Hide 'large scale' references
[1]"The BNIP-2 and Cdc42GAP homology/Sec14p-like domain of BNIP-Salpha is a novel apoptosis-inducing sequence."
Zhou Y.T., Soh U.J.K., Shang X., Guy G.R., Low B.C.
J. Biol. Chem. 277:7483-7492(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3).
[2]"BNIPL-2, a novel homologue of BNIP-2, interacts with Bcl-2 and Cdc42GAP in apoptosis."
Qin W., Hu J., Guo M., Xu J., Li J., Yao G., Zhou X., Jiang H., Zhang P., Shen L., Wan D., Gu J.
Biochem. Biophys. Res. Commun. 308:379-385(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH BCL2 AND ARHGAP1, FUNCTION.
Tissue: Placenta.
[3]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
[5]"The apoptosis-associated protein BNIPL interacts with two cell proliferation-related proteins, MIF and GFER."
Shen L., Hu J., Lu H., Wu M., Qin W., Wan D., Li Y.-Y., Gu J.
FEBS Lett. 540:86-90(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH GIF AND GFER, TISSUE SPECIFICITY.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF193056 mRNA. Translation: AAG22484.1.
AY078983 mRNA. Translation: AAL85483.1.
AY078984 mRNA. Translation: AAL85484.1.
AY033000 mRNA. Translation: AAK54348.1.
AL590133 Genomic DNA. Translation: CAI13344.1.
AL590133 Genomic DNA. Translation: CAI13347.1.
BC027868 mRNA. Translation: AAH27868.2.
BC074779 mRNA. Translation: AAH74779.3.
BC074780 mRNA. Translation: AAH74780.3.
CCDSCCDS53362.1. [Q7Z465-2]
CCDS978.2. [Q7Z465-1]
RefSeqNP_001153114.1. NM_001159642.1. [Q7Z465-2]
NP_612122.2. NM_138278.3. [Q7Z465-1]
UniGeneHs.591473.

3D structure databases

ProteinModelPortalQ7Z465.
SMRQ7Z465. Positions 206-338.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid127211. 16 interactions.
IntActQ7Z465. 8 interactions.
MINTMINT-263518.
STRING9606.ENSP00000357927.

PTM databases

PhosphoSiteQ7Z465.

Polymorphism databases

DMDM57012595.

Proteomic databases

PaxDbQ7Z465.
PRIDEQ7Z465.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000295294; ENSP00000295294; ENSG00000163141. [Q7Z465-2]
ENST00000368931; ENSP00000357927; ENSG00000163141. [Q7Z465-1]
ENST00000485855; ENSP00000435072; ENSG00000163141. [Q7Z465-3]
GeneID149428.
KEGGhsa:149428.
UCSCuc001ewl.2. human. [Q7Z465-1]

Organism-specific databases

CTD149428.
GeneCardsGC01P151009.
HGNCHGNC:16976. BNIPL.
HPAHPA019946.
HPA023464.
MIM611275. gene.
neXtProtNX_Q7Z465.
PharmGKBPA38196.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG146834.
HOGENOMHOG000230952.
HOVERGENHBG054692.
InParanoidQ7Z465.
OMARVFRTGQ.
OrthoDBEOG7HB59B.
PhylomeDBQ7Z465.
TreeFamTF324164.

Gene expression databases

ArrayExpressQ7Z465.
BgeeQ7Z465.
CleanExHS_BNIPL.
GenevestigatorQ7Z465.

Family and domain databases

Gene3D3.40.525.10. 1 hit.
InterProIPR022181. Bcl2-/adenovirus-E1B.
IPR001251. CRAL-TRIO_dom.
[Graphical view]
PfamPF12496. BNIP2. 1 hit.
PF13716. CRAL_TRIO_2. 1 hit.
[Graphical view]
SMARTSM00516. SEC14. 1 hit.
[Graphical view]
SUPFAMSSF52087. SSF52087. 1 hit.
PROSITEPS50191. CRAL_TRIO. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiBNIPL.
GenomeRNAi149428.
NextBio86145.
PROQ7Z465.
SOURCESearch...

Entry information

Entry nameBNIPL_HUMAN
AccessionPrimary (citable) accession number: Q7Z465
Secondary accession number(s): Q6DK43, Q8TCY7, Q8WYG2
Entry history
Integrated into UniProtKB/Swiss-Prot: January 4, 2005
Last sequence update: October 1, 2003
Last modified: July 9, 2014
This is version 99 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM