Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein

Gene

BNIPL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May be a bridge molecule between BCL2 and ARHGAP1/CDC42 in promoting cell death.1 Publication

GO - Molecular functioni

  • identical protein binding Source: UniProtKB

GO - Biological processi

  • apoptotic process Source: UniProtKB
  • negative regulation of cell proliferation Source: UniProtKB
  • regulation of growth rate Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Apoptosis

Names & Taxonomyi

Protein namesi
Recommended name:
Bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein
Gene namesi
Name:BNIPL
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:16976. BNIPL.

Subcellular locationi

GO - Cellular componenti

  • cytosol Source: UniProtKB
  • nucleus Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

DisGeNETi149428.
OpenTargetsiENSG00000163141.
PharmGKBiPA38196.

Polymorphism and mutation databases

BioMutaiBNIPL.
DMDMi57012595.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002107701 – 357Bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like proteinAdd BLAST357

Proteomic databases

PaxDbiQ7Z465.
PeptideAtlasiQ7Z465.
PRIDEiQ7Z465.

PTM databases

iPTMnetiQ7Z465.
PhosphoSitePlusiQ7Z465.

Expressioni

Tissue specificityi

Isoform 2 is expressed in placenta and lung.1 Publication

Gene expression databases

BgeeiENSG00000163141.
CleanExiHS_BNIPL.
ExpressionAtlasiQ7Z465. baseline and differential.
GenevisibleiQ7Z465. HS.

Organism-specific databases

HPAiHPA019946.
HPA023464.

Interactioni

Subunit structurei

Homodimer. Interacts with BCL2, ARHGAP1, MIF and GFER.2 Publications

GO - Molecular functioni

  • identical protein binding Source: UniProtKB

Protein-protein interaction databases

BioGridi127211. 14 interactors.
IntActiQ7Z465. 8 interactors.
MINTiMINT-263518.
STRINGi9606.ENSP00000357927.

Structurei

3D structure databases

ProteinModelPortaliQ7Z465.
SMRiQ7Z465.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini191 – 352CRAL-TRIOPROSITE-ProRule annotationAdd BLAST162

Sequence similaritiesi

Contains 1 CRAL-TRIO domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiENOG410IE6U. Eukaryota.
ENOG4111F6D. LUCA.
GeneTreeiENSGT00420000029688.
HOGENOMiHOG000230952.
HOVERGENiHBG054692.
InParanoidiQ7Z465.
KOiK18448.
OMAiVVHATWY.
OrthoDBiEOG091G0E88.
PhylomeDBiQ7Z465.
TreeFamiTF324164.

Family and domain databases

Gene3Di3.40.525.10. 1 hit.
InterProiIPR022181. Bcl2-/adenovirus-E1B.
IPR001251. CRAL-TRIO_dom.
[Graphical view]
PfamiPF12496. BNIP2. 1 hit.
PF13716. CRAL_TRIO_2. 1 hit.
[Graphical view]
SMARTiSM00516. SEC14. 1 hit.
[Graphical view]
SUPFAMiSSF52087. SSF52087. 1 hit.
PROSITEiPS50191. CRAL_TRIO. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7Z465-1) [UniParc]FASTAAdd to basket
Also known as: BNIPL-2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGTIQEAGKK TDVGVREIAE APELGAALRH GELELKEEWQ DEEFPRLLPE
60 70 80 90 100
EAGTSEDPED PKGDSQAAAG TPSTLALCGQ RPMRKRLSAP ELRLSLTKGP
110 120 130 140 150
GNDGASPTQS APSSPDGSSD LEIDELETPS DSEQLDSGHE FEWEDELPRA
160 170 180 190 200
EGLGTSETAE RLGRGCMWDV TGEDGHHWRV FRMGPREQRV DMTVIEPYKK
210 220 230 240 250
VLSHGGYHGD GLNAVILFAS CYLPRSSIPN YTYVMEHLFR YMVGTLELLV
260 270 280 290 300
AENYLLVHLS GGTSRAQVPP LSWIRQCYRT LDRRLRKNLR ALVVVHATWY
310 320 330 340 350
VKAFLALLRP FISSKFTRKI RFLDSLGELA QLISLDQVHI PEAVRQLDRD

LHGSGGT
Length:357
Mass (Da):39,713
Last modified:October 1, 2003 - v1
Checksum:iC0BCF92BACE9DE4F
GO
Isoform 2 (identifier: Q7Z465-2) [UniParc]FASTAAdd to basket
Also known as: BNIPL-1, BNIP-Salpha

The sequence of this isoform differs from the canonical sequence as follows:
     1-82: Missing.

Show »
Length:275
Mass (Da):30,974
Checksum:iC4C63FDB0EA356CE
GO
Isoform 3 (identifier: Q7Z465-3) [UniParc]FASTAAdd to basket
Also known as: BNIP-Sbeta

The sequence of this isoform differs from the canonical sequence as follows:
     1-82: Missing.
     285-357: LRKNLRALVVVHATWYVKAFLALLRPFISSKFTRKIRFLDSLGELAQLISLDQVHIPEAVRQLDRDLHGSGGT → VL

Show »
Length:204
Mass (Da):22,908
Checksum:iE771FBD9F1B2E2AB
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05191765S → N.Corresponds to variant rs12068365dbSNPEnsembl.1
Natural variantiVAR_051918226S → N.Corresponds to variant rs12068365dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0124481 – 82Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST82
Alternative sequenceiVSP_012449285 – 357LRKNL…GSGGT → VL in isoform 3. 1 PublicationAdd BLAST73

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF193056 mRNA. Translation: AAG22484.1.
AY078983 mRNA. Translation: AAL85483.1.
AY078984 mRNA. Translation: AAL85484.1.
AY033000 mRNA. Translation: AAK54348.1.
AL590133 Genomic DNA. Translation: CAI13344.1.
AL590133 Genomic DNA. Translation: CAI13347.1.
BC027868 mRNA. Translation: AAH27868.2.
BC074779 mRNA. Translation: AAH74779.3.
BC074780 mRNA. Translation: AAH74780.3.
CCDSiCCDS53362.1. [Q7Z465-2]
CCDS978.2. [Q7Z465-1]
RefSeqiNP_001153114.1. NM_001159642.1. [Q7Z465-2]
NP_612122.2. NM_138278.3. [Q7Z465-1]
UniGeneiHs.591473.

Genome annotation databases

EnsembliENST00000295294; ENSP00000295294; ENSG00000163141. [Q7Z465-2]
ENST00000368931; ENSP00000357927; ENSG00000163141. [Q7Z465-1]
ENST00000485855; ENSP00000435072; ENSG00000163141. [Q7Z465-3]
GeneIDi149428.
KEGGihsa:149428.
UCSCiuc001ewl.3. human. [Q7Z465-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF193056 mRNA. Translation: AAG22484.1.
AY078983 mRNA. Translation: AAL85483.1.
AY078984 mRNA. Translation: AAL85484.1.
AY033000 mRNA. Translation: AAK54348.1.
AL590133 Genomic DNA. Translation: CAI13344.1.
AL590133 Genomic DNA. Translation: CAI13347.1.
BC027868 mRNA. Translation: AAH27868.2.
BC074779 mRNA. Translation: AAH74779.3.
BC074780 mRNA. Translation: AAH74780.3.
CCDSiCCDS53362.1. [Q7Z465-2]
CCDS978.2. [Q7Z465-1]
RefSeqiNP_001153114.1. NM_001159642.1. [Q7Z465-2]
NP_612122.2. NM_138278.3. [Q7Z465-1]
UniGeneiHs.591473.

3D structure databases

ProteinModelPortaliQ7Z465.
SMRiQ7Z465.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127211. 14 interactors.
IntActiQ7Z465. 8 interactors.
MINTiMINT-263518.
STRINGi9606.ENSP00000357927.

PTM databases

iPTMnetiQ7Z465.
PhosphoSitePlusiQ7Z465.

Polymorphism and mutation databases

BioMutaiBNIPL.
DMDMi57012595.

Proteomic databases

PaxDbiQ7Z465.
PeptideAtlasiQ7Z465.
PRIDEiQ7Z465.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000295294; ENSP00000295294; ENSG00000163141. [Q7Z465-2]
ENST00000368931; ENSP00000357927; ENSG00000163141. [Q7Z465-1]
ENST00000485855; ENSP00000435072; ENSG00000163141. [Q7Z465-3]
GeneIDi149428.
KEGGihsa:149428.
UCSCiuc001ewl.3. human. [Q7Z465-1]

Organism-specific databases

CTDi149428.
DisGeNETi149428.
GeneCardsiBNIPL.
HGNCiHGNC:16976. BNIPL.
HPAiHPA019946.
HPA023464.
MIMi611275. gene.
neXtProtiNX_Q7Z465.
OpenTargetsiENSG00000163141.
PharmGKBiPA38196.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IE6U. Eukaryota.
ENOG4111F6D. LUCA.
GeneTreeiENSGT00420000029688.
HOGENOMiHOG000230952.
HOVERGENiHBG054692.
InParanoidiQ7Z465.
KOiK18448.
OMAiVVHATWY.
OrthoDBiEOG091G0E88.
PhylomeDBiQ7Z465.
TreeFamiTF324164.

Miscellaneous databases

GeneWikiiBNIPL.
GenomeRNAii149428.
PROiQ7Z465.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000163141.
CleanExiHS_BNIPL.
ExpressionAtlasiQ7Z465. baseline and differential.
GenevisibleiQ7Z465. HS.

Family and domain databases

Gene3Di3.40.525.10. 1 hit.
InterProiIPR022181. Bcl2-/adenovirus-E1B.
IPR001251. CRAL-TRIO_dom.
[Graphical view]
PfamiPF12496. BNIP2. 1 hit.
PF13716. CRAL_TRIO_2. 1 hit.
[Graphical view]
SMARTiSM00516. SEC14. 1 hit.
[Graphical view]
SUPFAMiSSF52087. SSF52087. 1 hit.
PROSITEiPS50191. CRAL_TRIO. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiBNIPL_HUMAN
AccessioniPrimary (citable) accession number: Q7Z465
Secondary accession number(s): Q6DK43, Q8TCY7, Q8WYG2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 4, 2005
Last sequence update: October 1, 2003
Last modified: November 2, 2016
This is version 118 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.