Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein

Gene

BNIPL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May be a bridge molecule between BCL2 and ARHGAP1/CDC42 in promoting cell death.1 Publication

GO - Molecular functioni

  1. identical protein binding Source: UniProtKB

GO - Biological processi

  1. apoptotic process Source: UniProtKB
  2. negative regulation of cell proliferation Source: UniProtKB
  3. regulation of growth rate Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Apoptosis

Names & Taxonomyi

Protein namesi
Recommended name:
Bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein
Gene namesi
Name:BNIPL
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:16976. BNIPL.

Subcellular locationi

GO - Cellular componenti

  1. cytosol Source: UniProtKB
  2. nucleus Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38196.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 357357Bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like proteinPRO_0000210770Add
BLAST

Proteomic databases

PaxDbiQ7Z465.
PRIDEiQ7Z465.

PTM databases

PhosphoSiteiQ7Z465.

Expressioni

Tissue specificityi

Isoform 2 is expressed in placenta and lung.1 Publication

Gene expression databases

BgeeiQ7Z465.
CleanExiHS_BNIPL.
ExpressionAtlasiQ7Z465. baseline and differential.
GenevestigatoriQ7Z465.

Organism-specific databases

HPAiHPA019946.
HPA023464.

Interactioni

Subunit structurei

Homodimer. Interacts with BCL2, ARHGAP1, MIF and GFER.2 Publications

Protein-protein interaction databases

BioGridi127211. 16 interactions.
IntActiQ7Z465. 8 interactions.
MINTiMINT-263518.
STRINGi9606.ENSP00000357927.

Structurei

3D structure databases

ProteinModelPortaliQ7Z465.
SMRiQ7Z465. Positions 206-338.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini191 – 352162CRAL-TRIOPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 CRAL-TRIO domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG146834.
GeneTreeiENSGT00420000029688.
HOGENOMiHOG000230952.
HOVERGENiHBG054692.
InParanoidiQ7Z465.
KOiK18448.
OMAiISLDQVH.
OrthoDBiEOG7HB59B.
PhylomeDBiQ7Z465.
TreeFamiTF324164.

Family and domain databases

Gene3Di3.40.525.10. 1 hit.
InterProiIPR022181. Bcl2-/adenovirus-E1B.
IPR001251. CRAL-TRIO_dom.
[Graphical view]
PfamiPF12496. BNIP2. 1 hit.
PF13716. CRAL_TRIO_2. 1 hit.
[Graphical view]
SMARTiSM00516. SEC14. 1 hit.
[Graphical view]
SUPFAMiSSF52087. SSF52087. 1 hit.
PROSITEiPS50191. CRAL_TRIO. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q7Z465-1) [UniParc]FASTAAdd to Basket

Also known as: BNIPL-2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGTIQEAGKK TDVGVREIAE APELGAALRH GELELKEEWQ DEEFPRLLPE
60 70 80 90 100
EAGTSEDPED PKGDSQAAAG TPSTLALCGQ RPMRKRLSAP ELRLSLTKGP
110 120 130 140 150
GNDGASPTQS APSSPDGSSD LEIDELETPS DSEQLDSGHE FEWEDELPRA
160 170 180 190 200
EGLGTSETAE RLGRGCMWDV TGEDGHHWRV FRMGPREQRV DMTVIEPYKK
210 220 230 240 250
VLSHGGYHGD GLNAVILFAS CYLPRSSIPN YTYVMEHLFR YMVGTLELLV
260 270 280 290 300
AENYLLVHLS GGTSRAQVPP LSWIRQCYRT LDRRLRKNLR ALVVVHATWY
310 320 330 340 350
VKAFLALLRP FISSKFTRKI RFLDSLGELA QLISLDQVHI PEAVRQLDRD

LHGSGGT
Length:357
Mass (Da):39,713
Last modified:October 1, 2003 - v1
Checksum:iC0BCF92BACE9DE4F
GO
Isoform 2 (identifier: Q7Z465-2) [UniParc]FASTAAdd to Basket

Also known as: BNIPL-1, BNIP-Salpha

The sequence of this isoform differs from the canonical sequence as follows:
     1-82: Missing.

Show »
Length:275
Mass (Da):30,974
Checksum:iC4C63FDB0EA356CE
GO
Isoform 3 (identifier: Q7Z465-3) [UniParc]FASTAAdd to Basket

Also known as: BNIP-Sbeta

The sequence of this isoform differs from the canonical sequence as follows:
     1-82: Missing.
     285-357: LRKNLRALVVVHATWYVKAFLALLRPFISSKFTRKIRFLDSLGELAQLISLDQVHIPEAVRQLDRDLHGSGGT → VL

Show »
Length:204
Mass (Da):22,908
Checksum:iE771FBD9F1B2E2AB
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti65 – 651S → N.
Corresponds to variant rs12068365 [ dbSNP | Ensembl ].
VAR_051917
Natural varianti226 – 2261S → N.
Corresponds to variant rs12068365 [ dbSNP | Ensembl ].
VAR_051918

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 8282Missing in isoform 2 and isoform 3. 2 PublicationsVSP_012448Add
BLAST
Alternative sequencei285 – 35773LRKNL…GSGGT → VL in isoform 3. 1 PublicationVSP_012449Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF193056 mRNA. Translation: AAG22484.1.
AY078983 mRNA. Translation: AAL85483.1.
AY078984 mRNA. Translation: AAL85484.1.
AY033000 mRNA. Translation: AAK54348.1.
AL590133 Genomic DNA. Translation: CAI13344.1.
AL590133 Genomic DNA. Translation: CAI13347.1.
BC027868 mRNA. Translation: AAH27868.2.
BC074779 mRNA. Translation: AAH74779.3.
BC074780 mRNA. Translation: AAH74780.3.
CCDSiCCDS53362.1. [Q7Z465-2]
CCDS978.2. [Q7Z465-1]
RefSeqiNP_001153114.1. NM_001159642.1. [Q7Z465-2]
NP_612122.2. NM_138278.3. [Q7Z465-1]
UniGeneiHs.591473.

Genome annotation databases

EnsembliENST00000295294; ENSP00000295294; ENSG00000163141. [Q7Z465-2]
ENST00000368931; ENSP00000357927; ENSG00000163141. [Q7Z465-1]
ENST00000485855; ENSP00000435072; ENSG00000163141. [Q7Z465-3]
GeneIDi149428.
KEGGihsa:149428.
UCSCiuc001ewl.2. human. [Q7Z465-1]

Polymorphism databases

DMDMi57012595.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF193056 mRNA. Translation: AAG22484.1.
AY078983 mRNA. Translation: AAL85483.1.
AY078984 mRNA. Translation: AAL85484.1.
AY033000 mRNA. Translation: AAK54348.1.
AL590133 Genomic DNA. Translation: CAI13344.1.
AL590133 Genomic DNA. Translation: CAI13347.1.
BC027868 mRNA. Translation: AAH27868.2.
BC074779 mRNA. Translation: AAH74779.3.
BC074780 mRNA. Translation: AAH74780.3.
CCDSiCCDS53362.1. [Q7Z465-2]
CCDS978.2. [Q7Z465-1]
RefSeqiNP_001153114.1. NM_001159642.1. [Q7Z465-2]
NP_612122.2. NM_138278.3. [Q7Z465-1]
UniGeneiHs.591473.

3D structure databases

ProteinModelPortaliQ7Z465.
SMRiQ7Z465. Positions 206-338.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127211. 16 interactions.
IntActiQ7Z465. 8 interactions.
MINTiMINT-263518.
STRINGi9606.ENSP00000357927.

PTM databases

PhosphoSiteiQ7Z465.

Polymorphism databases

DMDMi57012595.

Proteomic databases

PaxDbiQ7Z465.
PRIDEiQ7Z465.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000295294; ENSP00000295294; ENSG00000163141. [Q7Z465-2]
ENST00000368931; ENSP00000357927; ENSG00000163141. [Q7Z465-1]
ENST00000485855; ENSP00000435072; ENSG00000163141. [Q7Z465-3]
GeneIDi149428.
KEGGihsa:149428.
UCSCiuc001ewl.2. human. [Q7Z465-1]

Organism-specific databases

CTDi149428.
GeneCardsiGC01P151009.
HGNCiHGNC:16976. BNIPL.
HPAiHPA019946.
HPA023464.
MIMi611275. gene.
neXtProtiNX_Q7Z465.
PharmGKBiPA38196.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG146834.
GeneTreeiENSGT00420000029688.
HOGENOMiHOG000230952.
HOVERGENiHBG054692.
InParanoidiQ7Z465.
KOiK18448.
OMAiISLDQVH.
OrthoDBiEOG7HB59B.
PhylomeDBiQ7Z465.
TreeFamiTF324164.

Miscellaneous databases

GeneWikiiBNIPL.
GenomeRNAii149428.
NextBioi86145.
PROiQ7Z465.
SOURCEiSearch...

Gene expression databases

BgeeiQ7Z465.
CleanExiHS_BNIPL.
ExpressionAtlasiQ7Z465. baseline and differential.
GenevestigatoriQ7Z465.

Family and domain databases

Gene3Di3.40.525.10. 1 hit.
InterProiIPR022181. Bcl2-/adenovirus-E1B.
IPR001251. CRAL-TRIO_dom.
[Graphical view]
PfamiPF12496. BNIP2. 1 hit.
PF13716. CRAL_TRIO_2. 1 hit.
[Graphical view]
SMARTiSM00516. SEC14. 1 hit.
[Graphical view]
SUPFAMiSSF52087. SSF52087. 1 hit.
PROSITEiPS50191. CRAL_TRIO. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The BNIP-2 and Cdc42GAP homology/Sec14p-like domain of BNIP-Salpha is a novel apoptosis-inducing sequence."
    Zhou Y.T., Soh U.J.K., Shang X., Guy G.R., Low B.C.
    J. Biol. Chem. 277:7483-7492(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3).
  2. "BNIPL-2, a novel homologue of BNIP-2, interacts with Bcl-2 and Cdc42GAP in apoptosis."
    Qin W., Hu J., Guo M., Xu J., Li J., Yao G., Zhou X., Jiang H., Zhang P., Shen L., Wan D., Gu J.
    Biochem. Biophys. Res. Commun. 308:379-385(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH BCL2 AND ARHGAP1, FUNCTION.
    Tissue: Placenta.
  3. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
  5. "The apoptosis-associated protein BNIPL interacts with two cell proliferation-related proteins, MIF and GFER."
    Shen L., Hu J., Lu H., Wu M., Qin W., Wan D., Li Y.-Y., Gu J.
    FEBS Lett. 540:86-90(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH GIF AND GFER, TISSUE SPECIFICITY.

Entry informationi

Entry nameiBNIPL_HUMAN
AccessioniPrimary (citable) accession number: Q7Z465
Secondary accession number(s): Q6DK43, Q8TCY7, Q8WYG2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 4, 2005
Last sequence update: October 1, 2003
Last modified: January 7, 2015
This is version 102 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.