Reviewed,
UniProtKB/Swiss-Prot Q7Z434 (MAVS_HUMAN)
Last modified
January 19, 2010.
Version 66.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Mitochondrial antiviral-signaling protein Alternative name(s): Interferon-beta promoter stimulator protein 1 Short name=IPS-1 Virus-induced-signaling adapter CARD adapter inducing interferon-beta Short name=Cardif Putative NF-kappa-B-activating protein 031N | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 540 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Required for innate immune defense against viruses. Acts downstream of DDX58 and IFIH1/MDA5, which detect intracellular dsRNA produced during viral replication, to coordinate pathways leading to the activation of NF-kappa-B, IRF3 and IRF7, and to the subsequent induction of antiviral cytokines such as IFN-beta and RANTES (CCL5). May activate the same pathways following detection of extracellular dsRNA by TLR3. May protect cells from apoptosis. Ref.1 Ref.2 Ref.3 Ref.4 Ref.22 |
| Subunit structure | Interacts with DDX58, IFIH1, TRAF2 and TRAF6. May interact with IRF3, FADD, RIPK1, IKBKE, CHUK and IKBKB. Does not interact with TBK1. Interacts with and is cleaved by HCV and hepatitis GB virus B NS3/4A proteases. Interacts with and is cleaved by HHAV protein 3ABC. Interacts with NLRX1. Interaction with NLRX1 requires the CARD domain. Interacts with PSMA7. Ref.1 Ref.2 Ref.3 Ref.4 Ref.11 Ref.13 Ref.14 Ref.18 |
| Subcellular location | |
| Tissue specificity | Present in T-cells, monocytes, epithelial cells and hepatocytes (at protein level). Ubiquitously expressed, with highest levels in heart, skeletal muscle, liver, placenta and peripheral blood leukocytes. Ref.1 Ref.2 Ref.4 |
| Domain | Both CARD and transmembrane domains are essential for antiviral function. The CARD domain is responsible for interaction with DDX58 and IFIH1. |
| Miscellaneous | Cleavage by HCV protease complex leads to inactivation. |
| Sequence similarities | Contains 1 CARD domain. |
| Sequence caution | The sequence BAB14684.1 differs from that shown. Reason: Frameshift at position 333. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CHUK | O15111 | 1 | EBI-995373,EBI-81249 | |
| DDX58 | O95786 | 1 | EBI-995373,EBI-995350 | |
| IKBKB | O14920 | 1 | EBI-995373,EBI-81266 | |
| IKBKE | Q14164 | 1 | EBI-995373,EBI-307369 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q7Z434-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q7Z434-2) The sequence of this isoform differs from the canonical sequence as follows: 99-131: TSDRPPDPLEPPSLPAERPGPPTPAAAHSIPYN → ERPALALLDPQPAPWPPLSFSLSLYFLPFSVILFLVTVKR 132-540: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q7Z434-3) The sequence of this isoform differs from the canonical sequence as follows: 64-148: RRPGWVEYFI...SYPMPVQETQ → LPTWAGEETP...LLPSLSCPTW 149-540: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 540 | 540 | Mitochondrial antiviral-signaling protein | PRO_0000144096 | ||||||||||||||||||||
Regions | ||||||||||||||||||||||||
| Topological domain | 1 – 513 | 513 | Cytoplasmic Probable | |||||||||||||||||||||
| Transmembrane | 514 – 534 | 21 | Potential | |||||||||||||||||||||
| Topological domain | 535 – 540 | 6 | Mitochondrial intermembrane Probable | |||||||||||||||||||||
| Domain | 10 – 77 | 68 | CARD | |||||||||||||||||||||
| Region | 10 – 77 | 68 | Required for interaction with NLRX1 | |||||||||||||||||||||
| Region | 143 – 147 | 5 | Interaction with TRAF2 | |||||||||||||||||||||
| Region | 153 – 158 | 6 | Interaction with TRAF6 | |||||||||||||||||||||
| Region | 455 – 460 | 6 | Interaction with TRAF6 | |||||||||||||||||||||
| Compositional bias | 103 – 153 | 51 | Pro-rich | |||||||||||||||||||||
Sites | ||||||||||||||||||||||||
| Site | 427 – 428 | 2 | Cleavage; by HHAV protein 3ABC | |||||||||||||||||||||
| Site | 508 – 509 | 2 | Cleavage; by HCV and hepatitis GB virus B NS3/4A protease complex | |||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||
| Modified residue | 147 | 1 | Phosphothreonine By similarity | |||||||||||||||||||||
| Modified residue | 152 | 1 | Phosphoserine Ref.17 Ref.19 Ref.24 | |||||||||||||||||||||
| Modified residue | 157 | 1 | Phosphoserine Ref.19 | |||||||||||||||||||||
| Modified residue | 163 | 1 | Phosphothreonine Ref.19 | |||||||||||||||||||||
| Modified residue | 165 | 1 | Phosphoserine Ref.17 Ref.19 Ref.24 | |||||||||||||||||||||
| Modified residue | 222 | 1 | Phosphoserine Ref.17 Ref.19 Ref.24 Ref.12 Ref.15 Ref.16 Ref.21 | |||||||||||||||||||||
| Modified residue | 233 | 1 | Phosphoserine Ref.19 | |||||||||||||||||||||
| Modified residue | 234 | 1 | Phosphothreonine Ref.19 | |||||||||||||||||||||
| Modified residue | 253 | 1 | Phosphoserine Ref.19 | |||||||||||||||||||||
| Modified residue | 258 | 1 | Phosphoserine Ref.19 | |||||||||||||||||||||
| Modified residue | 366 | 1 | Phosphoserine By similarity | |||||||||||||||||||||
| Modified residue | 373 | 1 | Phosphoserine By similarity | |||||||||||||||||||||
| Modified residue | 375 | 1 | Phosphoserine By similarity | |||||||||||||||||||||
| Modified residue | 398 | 1 | Phosphothreonine By similarity | |||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||
| Alternative sequence | 64 – 148 | 85 | RRPGW…VQETQ → LPTWAGEETPGGQSSGRGLD FSSLTSGAVWLWQMSDFWSC FSTWTVSIWLILHWVLLRLN LQVFAKCLAQSKWPLLLPSL SCPTW in isoform 3. | VSP_010261 | ||||||||||||||||||||
| Alternative sequence | 99 – 131 | 33 | TSDRP…SIPYN → ERPALALLDPQPAPWPPLSF SLSLYFLPFSVILFLVTVKR in isoform 2. | VSP_010262 | ||||||||||||||||||||
| Alternative sequence | 132 – 540 | 409 | Missing in isoform 2. | VSP_010263 | ||||||||||||||||||||
| Alternative sequence | 149 – 540 | 392 | Missing in isoform 3. | VSP_010264 | ||||||||||||||||||||
| Natural variant | 79 | 1 | C → F: dbSNP rs11905552. | VAR_048609 | ||||||||||||||||||||
| Natural variant | 79 | 1 | C → S: dbSNP rs11908032. | VAR_059197 | ||||||||||||||||||||
| Natural variant | 93 | 1 | Q → E: dbSNP rs17857295. Ref.2 Ref.4 Ref.7 Ref.10 | VAR_048610 | ||||||||||||||||||||
| Natural variant | 198 | 1 | Q → K: dbSNP rs7262903. Ref.1 Ref.3 Ref.10 | VAR_048611 | ||||||||||||||||||||
| Natural variant | 409 | 1 | S → F: dbSNP rs7269320. Ref.1 Ref.3 Ref.10 | VAR_018448 | ||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||
| Mutagenesis | 54 | 1 | T → A: Impairs ability to induce IFN-beta. Ref.1 | |||||||||||||||||||||
| Mutagenesis | 67 – 69 | 3 | GWV → AAA: Impairs ability to induce IFN-beta. Ref.1 | |||||||||||||||||||||
| Mutagenesis | 145 | 1 | Q → N: No interaction with TRAF2. Ref.2 | |||||||||||||||||||||
| Mutagenesis | 155 | 1 | E → D: No interaction with TRAF6; when associated with D-457. Ref.2 | |||||||||||||||||||||
| Mutagenesis | 427 | 1 | Q → A: No cleavage by HHAV 3ABC. Ref.14 | |||||||||||||||||||||
| Mutagenesis | 435 | 1 | C → R: No effect on cleavage by NS3/4A protease complex. Ref.11 | |||||||||||||||||||||
| Mutagenesis | 452 | 1 | C → R: No effect on cleavage by NS3/4A protease complex. Ref.11 | |||||||||||||||||||||
| Mutagenesis | 457 | 1 | E → D: No interaction with TRAF6; when associated with D-155. Ref.2 | |||||||||||||||||||||
| Mutagenesis | 463 | 1 | E → A: No effect on cleavage by HHAV 3ABC. Ref.14 | |||||||||||||||||||||
| Mutagenesis | 508 | 1 | C → A or R: No cleavage by HCV and hepatitis GB virus B NS3/4A protease complex. Ref.3 Ref.11 Ref.13 | |||||||||||||||||||||
| Sequence conflict | 42 | 1 | L → P in BAC77356. Ref.6 | |||||||||||||||||||||
| Sequence conflict | 356 | 1 | A → V in BAC77356. Ref.6 | |||||||||||||||||||||
| Sequence conflict | 373 | 1 | S → P in BAC77356. Ref.6 | |||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||
| Helix | 3 – 14 | 12 | ||||||||||||||||||||||
| Helix | 16 – 19 | 4 | ||||||||||||||||||||||
| Helix | 24 – 27 | 4 | ||||||||||||||||||||||
| Helix | 28 – 30 | 3 | ||||||||||||||||||||||
| Helix | 36 – 48 | 13 | ||||||||||||||||||||||
| Helix | 52 – 62 | 11 | ||||||||||||||||||||||
| Helix | 69 – 76 | 8 | ||||||||||||||||||||||
| Helix | 82 – 92 | 11 | ||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification and characterization of MAVS, a mitochondrial antiviral signaling protein that activates NF-kappaB and IRF 3." Seth R.B., Sun L., Ea C.-K., Chen Z.J. Cell 122:669-682(2005) [PubMed: 16125763] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, MUTAGENESIS OF THR-54 AND 67-GLY--VAL-69, INTERACTION WITH DDX58 AND TRAF6, SUBCELLULAR LOCATION, VARIANTS LYS-198 AND PHE-409. |
| [2] | "VISA is an adapter protein required for virus-triggered IFN-beta Signaling." Xu L.-G., Wang Y.-Y., Han K.-J., Li L.-Y., Zhai Z., Shu H.-B. Mol. Cell 19:727-740(2005) [PubMed: 16153868] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], TISSUE SPECIFICITY, INTERACTION WITH DDX58; IRF3; TRAF2 AND TRAF6, MUTAGENESIS OF GLN-145; GLU-155 AND GLU-457, FUNCTION, VARIANT GLU-93. |
| [3] | "Cardif is an adaptor protein in the RIG-I antiviral pathway and is targeted by hepatitis C virus." Meylan E., Curran J., Hofmann K., Moradpour D., Binder M., Bartenschlager R., Tschopp J. Nature 437:1167-1172(2005) [PubMed: 16177806] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH DDX58; IKBKE; CHUK AND IKBKB, FUNCTION, CLEAVAGE SITE, MUTAGENESIS OF CYS-508, VARIANTS LYS-198 AND PHE-409. |
| [4] | "IPS-1, an adaptor triggering RIG-I- and Mda5-mediated type I interferon induction." Kawai T., Takahashi K., Sato S., Coban C., Kumar H., Kato H., Ishii K.J., Takeuchi O., Akira S. Nat. Immunol. 6:981-988(2005) [PubMed: 16127453] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, INTERACTION WITH DDX58; IFIH1; FADD AND RIPK1, FUNCTION, VARIANT GLU-93. |
| [5] | "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O. DNA Res. 6:337-345(1999) [PubMed: 10574462] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [6] | "Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways." Matsuda A., Suzuki Y., Honda G., Muramatsu S., Matsuzaki O., Nagano Y., Doi T., Shimotohno K., Harada T., Nishida E., Hayashi H., Sugano S. Oncogene 22:3307-3318(2003) [PubMed: 12761501] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung fibroblast. |
| [7] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3), VARIANT GLU-93. Tissue: Pericardium and Placenta. |
| [8] | "The DNA sequence and comparative analysis of human chromosome 20." Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. Rogers J.Nature 414:865-871(2001) [PubMed: 11780052] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA], VARIANTS GLU-93; LYS-198 AND PHE-409. Tissue: Brain. |
| [11] | "Hepatitis C virus protease NS3/4A cleaves mitochondrial antiviral signaling protein off the mitochondria to evade innate immunity." Li X.D., Sun L., Seth R.B., Pineda G., Chen Z.J. Proc. Natl. Acad. Sci. U.S.A. 102:17717-17722(2005) [PubMed: 16301520] [Abstract] Cited for: INTERACTION WITH HCV NS3/4A PROTEASE, CLEAVAGE SITE, MUTAGENESIS OF CYS-435; CYS-452 AND CYS-508. |
| [12] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed: 16964243] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-222, MASS SPECTROMETRY. Tissue: Epithelium. |
| [13] | "GB virus B disrupts RIG-I signaling by NS3/4A-mediated cleavage of the adaptor protein MAVS." Chen Z., Benureau Y., Rijnbrand R., Yi J., Wang T., Warter L., Lanford R.E., Weinman S.A., Lemon S.M., Martin A., Li K. J. Virol. 81:964-976(2007) [PubMed: 17093192] [Abstract] Cited for: INTERACTION WITH HEPATITIS GB VIRUS B NS3/4A PROTEASE, CLEAVAGE SITE, MUTAGENESIS OF CYS-508. |
| [14] | "Disruption of innate immunity due to mitochondrial targeting of a picornaviral protease precursor." Yang Y., Liang Y., Qu L., Chen Z., Yi M., Li K., Lemon S.M. Proc. Natl. Acad. Sci. U.S.A. 104:7253-7258(2007) [PubMed: 17438296] [Abstract] Cited for: INTERACTION WITH HUMAN HEPATITIS A VIRUS PROTEIN 3ABC, CLEAVAGE SITE, MUTAGENESIS OF GLN-427 AND GLU-463. |
| [15] | "Phosphoproteome of resting human platelets." Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J., Schuetz C., Walter U., Gambaryan S., Sickmann A. J. Proteome Res. 7:526-534(2008) [PubMed: 18088087] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-222, MASS SPECTROMETRY. Tissue: Platelet. |
| [16] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed: 18220336] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-222, MASS SPECTROMETRY. |
| [17] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed: 18691976] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-152; SER-165 AND SER-222, MASS SPECTROMETRY. |
| [18] | "NLRX1 is a regulator of mitochondrial antiviral immunity." Moore C.B., Bergstralh D.T., Duncan J.A., Lei Y., Morrison T.E., Zimmermann A.G., Accavitti-Loper M.A., Madden V.J., Sun L., Ye Z., Lich J.D., Heise M.T., Chen Z., Ting J.P.-Y. Nature 451:573-577(2008) [PubMed: 18200010] [Abstract] Cited for: INTERACTION WITH NLRX1. |
| [19] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-152; SER-157; THR-163; SER-165; SER-222; SER-233; THR-234; SER-253 AND SER-258, MASS SPECTROMETRY. |
| [20] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [21] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-222, MASS SPECTROMETRY. |
| [22] | "RNA polymerase III detects cytosolic DNA and induces type I interferons through the RIG-I pathway." Chiu Y.-H., Macmillan J.B., Chen Z.J. Cell 138:576-591(2009) [PubMed: 19631370] [Abstract] Cited for: FUNCTION. |
| [23] | "Negative regulation of MAVS-mediated innate immune response by PSMA7." Jia Y., Song T., Wei C., Ni C., Zheng Z., Xu Q., Ma H., Li L., Zhang Y., He X., Xu Y., Shi W., Zhong H. J. Immunol. 183:4241-4248(2009) [PubMed: 19734229] [Abstract] Cited for: INTERACTION WITH PSMA7. |
| [24] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-152; SER-165 AND SER-222, MASS SPECTROMETRY. Tissue: T-cell. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | DQ174270 mRNA. Translation: AAZ80417.1. DQ167126 mRNA. Translation: ABA54890.1. DQ181928 mRNA. Translation: ABA19229.1. AB232371 mRNA. Translation: BAE79738.1. AB033097 mRNA. Translation: BAA86585.1. Different initiation. AB097003 mRNA. Translation: BAC77356.1. AK023799 mRNA. Translation: BAB14684.1. Frameshift. AK123956 mRNA. Translation: BAC85734.1. AK130992 mRNA. Translation: BAC85473.1. AL353194, AL109804 Genomic DNA. Translation: CAI11041.1. AL109804, AL353194 Genomic DNA. Translation: CAI18851.1. CH471133 Genomic DNA. Translation: EAX10481.1. BC044952 mRNA. Translation: AAH44952.1. | ||||||||||||
| IPI | IPI00020719. IPI00411576. IPI00411577. | ||||||||||||
| RefSeq | NP_065797.2. | ||||||||||||
| UniGene | Hs.570362 | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| DIP | DIP-35445N. | ||||||||||||
| IntAct | Q7Z434. 4 interactions. | ||||||||||||
| STRING | Q7Z434. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q7Z434. | ||||||||||||
Proteomic databases | |||||||||||||
| PeptideAtlas | Q7Z434. | ||||||||||||
| PRIDE | Q7Z434. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000428216; ENSP00000401980; ENSG00000088888; Homo sapiens. [Genome view] | ||||||||||||
| GeneID | 57506. | ||||||||||||
| KEGG | hsa:57506. | ||||||||||||
| UCSC | uc002wjv.2. human. uc002wjw.2. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 57506. | ||||||||||||
| GeneCards | GC20P003782. | ||||||||||||
| HGNC | HGNC:29233. MAVS. | ||||||||||||
| HPA | CAB009187. | ||||||||||||
| MIM | 609676. gene. | ||||||||||||
| HUGE | Search... | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | prNOG08143. | ||||||||||||
| HOVERGEN | Q7Z434. | ||||||||||||
| InParanoid | Q7Z434. | ||||||||||||
| OMA | LPINSTR. | ||||||||||||
| OrthoDB | EOG91ZHWH. | ||||||||||||
| PhylomeDB | Q7Z434. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q7Z434. | ||||||||||||
| Bgee | Q7Z434. | ||||||||||||
| Genevestigator | Q7Z434. | ||||||||||||
| GermOnline | ENSG00000088888. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| PROSITE | PS50209. CARD. False negative. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| NextBio | 63845. | ||||||||||||
| PMAP-CutDB | Q7Z434. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | MAVS_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q7Z434 Secondary accession number(s): Q2HWT5 Q9ULE9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


