Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SUZ domain-containing protein 1

Gene

SZRD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
SUZ domain-containing protein 1
Alternative name(s):
Putative MAPK-activating protein PM18/PM20/PM22
Gene namesi
Name:SZRD1
Synonyms:C1orf144
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:30232. SZRD1.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142672461.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 152152SUZ domain-containing protein 1PRO_0000303068Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionineCombined sources
Modified residuei37 – 371PhosphoserineCombined sources
Modified residuei39 – 391PhosphoserineCombined sources
Modified residuei51 – 511PhosphoserineCombined sources
Modified residuei105 – 1051PhosphoserineCombined sources
Modified residuei107 – 1071PhosphoserineCombined sources

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ7Z422.
MaxQBiQ7Z422.
PaxDbiQ7Z422.
PRIDEiQ7Z422.
TopDownProteomicsiQ7Z422-1. [Q7Z422-1]
Q7Z422-2. [Q7Z422-2]
Q7Z422-3. [Q7Z422-3]
Q7Z422-4. [Q7Z422-4]

PTM databases

iPTMnetiQ7Z422.
PhosphoSiteiQ7Z422.

Expressioni

Gene expression databases

BgeeiQ7Z422.
CleanExiHS_C1orf144.
ExpressionAtlasiQ7Z422. baseline and differential.
GenevisibleiQ7Z422. HS.

Organism-specific databases

HPAiHPA024221.

Interactioni

Protein-protein interaction databases

BioGridi117549. 13 interactions.
IntActiQ7Z422. 3 interactions.
STRINGi9606.ENSP00000383866.

Structurei

3D structure databases

ProteinModelPortaliQ7Z422.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini42 – 10766SUZPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the SZRD1 family.Curated
Contains 1 SUZ domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiENOG410IG3N. Eukaryota.
ENOG4111N0B. LUCA.
GeneTreeiENSGT00390000005532.
HOGENOMiHOG000231189.
HOVERGENiHBG057301.
InParanoidiQ7Z422.
OMAiKITQKEX.
OrthoDBiEOG76DTTK.
PhylomeDBiQ7Z422.
TreeFamiTF324643.

Family and domain databases

InterProiIPR024771. SUZ.
IPR024642. SUZ-C.
[Graphical view]
PfamiPF12752. SUZ. 1 hit.
PF12901. SUZ-C. 1 hit.
[Graphical view]
PROSITEiPS51673. SUZ. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7Z422-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEDEEVAESW EEAADSGEID RRLEKKLKIT QKESRKSKSP PKVPIVIQDD
60 70 80 90 100
SLPAGPPPQI RILKRPTSNG VVSSPNSTSR PTLPVKSLAQ REAEYAEARK
110 120 130 140 150
RILGSASPEE EQEKPILDRP TRISQPEDSR QPNNVIRQPL GPDGSQGFKQ

RR
Length:152
Mass (Da):16,997
Last modified:October 1, 2003 - v1
Checksum:i07F735690D669778
GO
Isoform 2 (identifier: Q7Z422-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MEDEEVAESWEEAADSGEIDRRLEKKLKITQKESR → MRRSLRAGKRRQTAG

Show »
Length:132
Mass (Da):14,605
Checksum:i09739EF3FA39D8CD
GO
Isoform 3 (identifier: Q7Z422-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     18-35: Missing.

Note: No experimental confirmation available.
Show »
Length:134
Mass (Da):14,744
Checksum:iCAC73453FE73D851
GO
Isoform 4 (identifier: Q7Z422-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MEDEEVAESWEEAADSGEIDRRLEKKLKITQKES → MRRSLRAGKRRQTAG

Show »
Length:133
Mass (Da):14,761
Checksum:i5DE84B0CC8611759
GO
Isoform 5 (identifier: Q7Z422-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     34-34: Missing.

Note: No experimental confirmation available. Derived from EST data.
Show »
Length:151
Mass (Da):16,910
Checksum:iE60DFB37FDB93EB0
GO

Sequence cautioni

The sequence CAB43245.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence CAC82500.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3535MEDEE…QKESR → MRRSLRAGKRRQTAG in isoform 2. 2 PublicationsVSP_027995Add
BLAST
Alternative sequencei1 – 3434MEDEE…TQKES → MRRSLRAGKRRQTAG in isoform 4. 2 PublicationsVSP_027996Add
BLAST
Alternative sequencei18 – 3518Missing in isoform 3. 1 PublicationVSP_027997Add
BLAST
Alternative sequencei34 – 341Missing in isoform 5. CuratedVSP_055690

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB097042 mRNA. Translation: BAC77395.1.
AB097044 mRNA. Translation: BAC77397.1.
AB097046 mRNA. Translation: BAC77399.1.
AJ295987 mRNA. Translation: CAC82500.1. Different initiation.
AL050028 mRNA. Translation: CAB43245.1. Different initiation.
AL358794 Genomic DNA. Translation: CAH73775.1.
BC023988 mRNA. Translation: AAH23988.1.
BC065538 mRNA. Translation: AAH65538.1.
CCDSiCCDS44065.1. [Q7Z422-1]
CCDS60000.1. [Q7Z422-5]
PIRiT08712.
RefSeqiNP_001108072.1. NM_001114600.2. [Q7Z422-1]
NP_001258798.1. NM_001271869.1. [Q7Z422-5]
UniGeneiHs.252967.

Genome annotation databases

EnsembliENST00000401088; ENSP00000383866; ENSG00000055070. [Q7Z422-1]
ENST00000401089; ENSP00000383867; ENSG00000055070. [Q7Z422-4]
ENST00000471507; ENSP00000419589; ENSG00000055070. [Q7Z422-5]
ENST00000492354; ENSP00000418012; ENSG00000055070. [Q7Z422-2]
GeneIDi26099.
KEGGihsa:26099.
UCSCiuc001ayi.6. human. [Q7Z422-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB097042 mRNA. Translation: BAC77395.1.
AB097044 mRNA. Translation: BAC77397.1.
AB097046 mRNA. Translation: BAC77399.1.
AJ295987 mRNA. Translation: CAC82500.1. Different initiation.
AL050028 mRNA. Translation: CAB43245.1. Different initiation.
AL358794 Genomic DNA. Translation: CAH73775.1.
BC023988 mRNA. Translation: AAH23988.1.
BC065538 mRNA. Translation: AAH65538.1.
CCDSiCCDS44065.1. [Q7Z422-1]
CCDS60000.1. [Q7Z422-5]
PIRiT08712.
RefSeqiNP_001108072.1. NM_001114600.2. [Q7Z422-1]
NP_001258798.1. NM_001271869.1. [Q7Z422-5]
UniGeneiHs.252967.

3D structure databases

ProteinModelPortaliQ7Z422.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117549. 13 interactions.
IntActiQ7Z422. 3 interactions.
STRINGi9606.ENSP00000383866.

PTM databases

iPTMnetiQ7Z422.
PhosphoSiteiQ7Z422.

Proteomic databases

EPDiQ7Z422.
MaxQBiQ7Z422.
PaxDbiQ7Z422.
PRIDEiQ7Z422.
TopDownProteomicsiQ7Z422-1. [Q7Z422-1]
Q7Z422-2. [Q7Z422-2]
Q7Z422-3. [Q7Z422-3]
Q7Z422-4. [Q7Z422-4]

Protocols and materials databases

DNASUi26099.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000401088; ENSP00000383866; ENSG00000055070. [Q7Z422-1]
ENST00000401089; ENSP00000383867; ENSG00000055070. [Q7Z422-4]
ENST00000471507; ENSP00000419589; ENSG00000055070. [Q7Z422-5]
ENST00000492354; ENSP00000418012; ENSG00000055070. [Q7Z422-2]
GeneIDi26099.
KEGGihsa:26099.
UCSCiuc001ayi.6. human. [Q7Z422-1]

Organism-specific databases

CTDi26099.
GeneCardsiSZRD1.
HGNCiHGNC:30232. SZRD1.
HPAiHPA024221.
neXtProtiNX_Q7Z422.
PharmGKBiPA142672461.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IG3N. Eukaryota.
ENOG4111N0B. LUCA.
GeneTreeiENSGT00390000005532.
HOGENOMiHOG000231189.
HOVERGENiHBG057301.
InParanoidiQ7Z422.
OMAiKITQKEX.
OrthoDBiEOG76DTTK.
PhylomeDBiQ7Z422.
TreeFamiTF324643.

Miscellaneous databases

GenomeRNAii26099.
NextBioi35488625.
PROiQ7Z422.

Gene expression databases

BgeeiQ7Z422.
CleanExiHS_C1orf144.
ExpressionAtlasiQ7Z422. baseline and differential.
GenevisibleiQ7Z422. HS.

Family and domain databases

InterProiIPR024771. SUZ.
IPR024642. SUZ-C.
[Graphical view]
PfamiPF12752. SUZ. 1 hit.
PF12901. SUZ-C. 1 hit.
[Graphical view]
PROSITEiPS51673. SUZ. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways."
    Matsuda A., Suzuki Y., Honda G., Muramatsu S., Matsuzaki O., Nagano Y., Doi T., Shimotohno K., Harada T., Nishida E., Hayashi H., Sugano S.
    Oncogene 22:3307-3318(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 4).
    Tissue: Lung fibroblast.
  2. "Full length sequencing of some human and murine muscular transcripts (Telethon Italy project B41)."
    Ievolella C., Zara I., Millino C., Faulkner G., Lanfranchi G.
    Submitted (JAN-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Skeletal muscle.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Kidney.
  4. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Kidney and Pancreas.
  6. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-37; SER-39; SER-105 AND SER-107, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  9. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-39, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  10. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-37; SER-39 AND SER-51, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  11. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-51, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  12. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-37; SER-39 AND SER-105, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiSZRD1_HUMAN
AccessioniPrimary (citable) accession number: Q7Z422
Secondary accession number(s): A8MXJ2
, C9K0U0, Q7Z424, Q8IVM2, Q8TBV3, Q9Y403
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: October 1, 2003
Last modified: March 16, 2016
This is version 101 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.