Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

C-myc promoter-binding protein

Gene

DENND4A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Probable guanine nucleotide exchange factor (GEF) which may activate RAB10. Promotes the exchange of GDP to GTP, converting inactive GDP-bound Rab proteins into their active GTP-bound form. According to PubMed:8056341, it may bind to ISRE-like element (interferon-stimulated response element) of MYC P2 promoter.2 Publications

GO - Molecular functioni

  • DNA binding Source: UniProtKB
  • Rab guanyl-nucleotide exchange factor activity Source: UniProtKB

GO - Biological processi

  • positive regulation of GTPase activity Source: GOC
  • regulation of transcription, DNA-templated Source: UniProtKB
  • transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Guanine-nucleotide releasing factor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
C-myc promoter-binding protein
Alternative name(s):
DENN domain-containing protein 4A
Gene namesi
Name:DENND4A
Synonyms:IRLB, MYCPBP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

HGNCiHGNC:24321. DENND4A.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134887513.

Polymorphism and mutation databases

BioMutaiDENND4A.
DMDMi88909230.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 18631863C-myc promoter-binding proteinPRO_0000223952Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei731 – 7311PhosphoserineCombined sources
Modified residuei1035 – 10351PhosphoserineCombined sources
Modified residuei1587 – 15871PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ7Z401.
MaxQBiQ7Z401.
PaxDbiQ7Z401.
PRIDEiQ7Z401.

PTM databases

iPTMnetiQ7Z401.
PhosphoSiteiQ7Z401.

Expressioni

Tissue specificityi

Expressed ubiquitously. Highest expression in bone marrow, medium in peripheral blood lymphocytes and lowest in spleen. In brain, breast, and prostate, higher expression was seen in normal cells than in tumor cells. Expression is regulated in a growth- and cell cycle-dependent manner.1 Publication

Developmental stagei

Highly expressed in fetal liver.1 Publication

Inductioni

By serum in low-passage fibroblasts.1 Publication

Gene expression databases

BgeeiQ7Z401.
CleanExiHS_DENND4A.
ExpressionAtlasiQ7Z401. baseline and differential.
GenevisibleiQ7Z401. HS.

Interactioni

Protein-protein interaction databases

BioGridi115552. 15 interactions.
IntActiQ7Z401. 5 interactions.
MINTiMINT-1631757.
STRINGi9606.ENSP00000391167.

Structurei

3D structure databases

ProteinModelPortaliQ7Z401.
SMRiQ7Z401. Positions 215-630.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini42 – 200159MABPPROSITE-ProRule annotationAdd
BLAST
Domaini203 – 27674UDENNAdd
BLAST
Domaini308 – 492185DENNPROSITE-ProRule annotationAdd
BLAST
Domaini558 – 63275dDENNPROSITE-ProRule annotationAdd
BLAST
Repeati772 – 80837PPR 1Add
BLAST
Repeati809 – 84335PPR 2Add
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi917 – 93317Bipartite nuclear localization signalSequence analysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi1183 – 11897Poly-Glu

Sequence similaritiesi

Contains 1 dDENN domain.PROSITE-ProRule annotation
Contains 1 DENN domain.PROSITE-ProRule annotation
Contains 1 MABP domain.PROSITE-ProRule annotation
Contains 2 PPR (pentatricopeptide) repeats.PROSITE-ProRule annotation
Contains 1 uDENN domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG2127. Eukaryota.
ENOG410XQMX. LUCA.
GeneTreeiENSGT00760000118819.
HOGENOMiHOG000231590.
HOVERGENiHBG058313.
InParanoidiQ7Z401.
OMAiLFEMQKA.
OrthoDBiEOG790FZV.
PhylomeDBiQ7Z401.
TreeFamiTF313237.

Family and domain databases

InterProiIPR005112. dDENN_dom.
IPR001194. DENN_dom.
IPR023341. MABP.
IPR002885. Pentatricopeptide_repeat.
IPR005113. uDENN_dom.
[Graphical view]
PfamiPF03455. dDENN. 1 hit.
PF02141. DENN. 1 hit.
PF03456. uDENN. 1 hit.
[Graphical view]
SMARTiSM00801. dDENN. 1 hit.
SM00799. DENN. 1 hit.
SM00800. uDENN. 1 hit.
[Graphical view]
TIGRFAMsiTIGR00756. PPR. 1 hit.
PROSITEiPS50947. DDENN. 1 hit.
PS50211. DENN. 1 hit.
PS51498. MABP. 1 hit.
PS51375. PPR. 1 hit.
PS50946. UDENN. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7Z401-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MIEDKGPRVA DYFVVAGLTD VSKPLEEEIH FNDACHKVAK PKEPITDVSV
60 70 80 90 100
IIKSLGEEVP QDYICIDVTP TGLSADLNNG SLVGPQIYLC YRRGRDKPPL
110 120 130 140 150
TDLGVLYDWK ERLKQGCEII QSTPYGRPAN ISGSTSSQRI YITYRRASEN
160 170 180 190 200
MTQNTLAVTD ICIIIPSKGE SPPHTFCKVD KNLNNSMWGS AVYLCYKKSV
210 220 230 240 250
AKTNTVSYKA GLICRYPQED YESFSLPESV PLFCLPMGAT IECWPSNSKY
260 270 280 290 300
PLPVFSTFVL TGASAEKVYG AAIQFYEPYS EENLTEKQRL LLGLTSADGK
310 320 330 340 350
SDSSKTIHTN KCICLLSHWP FFDAFRKFLT FLYRYSISGP HVLPIEKHIS
360 370 380 390 400
HFMHKVPFPS PQRPRILVQL SPHDNLILSQ PVSSPLPLSG GKFSTLLQNL
410 420 430 440 450
GPENAVTLLV FAVTEHKILI HSLRPSVLTS VTEALVSMIF PFHWPCPYVP
460 470 480 490 500
LCPLALADVL SAPCPFIVGI DSRYFDLYDP PPDVSCVDVD TNTISQIGDK
510 520 530 540 550
KNVAWKILPK KPCKNLMNTL NNLHQQLAKL QQRPRDDGLM DLAINDYDFN
560 570 580 590 600
SGKRLHMIDL EIQEAFLFFM ASILKGYRSY LRPITQAPSE TATDAASLFA
610 620 630 640 650
LQAFLRSRDR SHQKFYNMMT KTQMFIRFIE ECSFVSDKDA SLAFFDDCVD
660 670 680 690 700
KVDMDKSGEV RLIELDESFK SEHTVFVTPP EIPHLPNGEE PPLQYSYNGF
710 720 730 740 750
PVLRNNLFER PEGFLQAKKN KLPSKSSSPN SPLPMFRRTK QEIKSAHKIA
760 770 780 790 800
KRYSSIPQMW SRCLLRHCYG LWFICLPAYV KVCHSKVRAL KTAYDVLKKM
810 820 830 840 850
QSKKMDPPDE VCYRILMQLC GQYDQPVLAV RVLFEMQKAG IDPNAITYGY
860 870 880 890 900
YNKAVLESTW PSRSRSGYFL WTKVRNVVLG VTQFKRALKK HAHLSQTTLS
910 920 930 940 950
GGQSDLGYNS LSKDEVRRGD TSTEDIQEEK DKKGSDCSSL SESESTKGSA
960 970 980 990 1000
DCLPKLSYQN SSSIVRLTGT SNNSAGKISG ESMESTPELL LISSLEDTNE
1010 1020 1030 1040 1050
TRNIQSRCFR KRHKSDNETN LQQQVVWGNR NRNLSGGVLM GFMLNRINQE
1060 1070 1080 1090 1100
ATPGDIVEKL GADAKILSNV ISKSTRPNTL DIGKPPLRSK RDSLEKESSD
1110 1120 1130 1140 1150
DDTPFDGSNY LADKVDSPVI FDLEDLDSET DVSKAGCVAT QNPKRIQRMN
1160 1170 1180 1190 1200
SSFSVKPFEK TDVATGFDPL SLLVAETEQQ QKEEEEEDED DSKSISTPSA
1210 1220 1230 1240 1250
RRDLAEEIVM YMNNMSSPLT SRTPSIDLQR ACDDKLNKKS PPLVKACRRS
1260 1270 1280 1290 1300
SLPPNSPKPV RLTKSKSYTK SEEKPRDRLW SSPAFSPTCP FREESQDTLT
1310 1320 1330 1340 1350
HSSPSFNLDT LLVPKLDVLR NSMFTAGKGV AEKASKWYSR FTMYTTSSKD
1360 1370 1380 1390 1400
QSSDRTSLSS VGAQDSESTS LTDEDVCHEL EGPISSQETS ATSGTKRIDL
1410 1420 1430 1440 1450
SRISLESSAS LEGSLSKFAL PGKSEVTSSF NASNTNIFQN YAMEVLISSC
1460 1470 1480 1490 1500
SRCRTCDCLV HDEEIMAGWT ADDSNLNTTC PFCGNIFLPF LNIEIRDLRR
1510 1520 1530 1540 1550
PGRYFLKSSP STENMHFPSS ISSQTRQSCI STSASGLDTS ALSVQGNFDL
1560 1570 1580 1590 1600
NSKSKLQENF CTRSIQIPAN RSKTAMSKCP IFPMARSIST SGPLDKEDTG
1610 1620 1630 1640 1650
RQKLISTGSL PATLQGATDS LGLEWHLPSP DPVTVPYLSP LVVWKELESL
1660 1670 1680 1690 1700
LENEGDHAIT VADFVDHHPI VFWNLVWYFR RLDLPSNLPG LILSSEHCNK
1710 1720 1730 1740 1750
YSKIPRHCMS EDSKYVLIQM LWDNMKLHQD PGQPLYILWN AHTQKYPMVH
1760 1770 1780 1790 1800
LLQKSDNSFN QELLKSMVKS IKMNDVYGPM SQILETLNKC PHFKRQRSLY
1810 1820 1830 1840 1850
REILFLSLVA LGRENIDIDA FDKEYKMAYD RLTPSQVKST HNCDRPPSTG
1860
VMECRKTFGE PYL
Length:1,863
Mass (Da):209,244
Last modified:February 21, 2006 - v2
Checksum:i7432EEC9DB9711E6
GO
Isoform 2 (identifier: Q7Z401-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     900-900: S → SDGSDLDAVSHGSMDSGHGTHTVEQAPFNTGLIKVYATDDRSST

Note: No experimental confirmation available.
Show »
Length:1,906
Mass (Da):213,704
Checksum:i4A2E0BB91759E401
GO

Sequence cautioni

The sequence AL833317 differs from that shown. Reason: Frameshift at position 1774. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti256 – 2561S → P in AL833317 (PubMed:17974005).Curated
Sequence conflicti383 – 3831S → P in CAD89960 (PubMed:17974005).Curated
Sequence conflicti983 – 9831M → MGK in AAQ10514 (PubMed:12906859).Curated
Sequence conflicti1532 – 15321T → A in AL833317 (PubMed:17974005).Curated
Sequence conflicti1726 – 17261K → Q in AL833317 (PubMed:17974005).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti284 – 2841L → P.1 Publication
Corresponds to variant rs17854146 [ dbSNP | Ensembl ].
VAR_025362

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei900 – 9001S → SDGSDLDAVSHGSMDSGHGT HTVEQAPFNTGLIKVYATDD RSST in isoform 2. 1 PublicationVSP_044630

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF534403 mRNA. Translation: AAQ10514.1.
AL832602 mRNA. Translation: CAD89960.1.
AL833317 mRNA. No translation available.
AC011939 Genomic DNA. No translation available.
BC041706 mRNA. Translation: AAH41706.1.
AK091368 mRNA. Translation: BAC03648.1.
X63417 mRNA. Translation: CAA45013.1.
CCDSiCCDS45285.1. [Q7Z401-1]
CCDS53949.1. [Q7Z401-2]
PIRiI37904.
RefSeqiNP_001138295.1. NM_001144823.2. [Q7Z401-2]
NP_005839.3. NM_005848.4. [Q7Z401-1]
XP_005254178.1. XM_005254121.2. [Q7Z401-1]
UniGeneiHs.654567.

Genome annotation databases

EnsembliENST00000431932; ENSP00000396830; ENSG00000174485. [Q7Z401-1]
ENST00000443035; ENSP00000391167; ENSG00000174485. [Q7Z401-2]
GeneIDi10260.
KEGGihsa:10260.
UCSCiuc002aph.4. human. [Q7Z401-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF534403 mRNA. Translation: AAQ10514.1.
AL832602 mRNA. Translation: CAD89960.1.
AL833317 mRNA. No translation available.
AC011939 Genomic DNA. No translation available.
BC041706 mRNA. Translation: AAH41706.1.
AK091368 mRNA. Translation: BAC03648.1.
X63417 mRNA. Translation: CAA45013.1.
CCDSiCCDS45285.1. [Q7Z401-1]
CCDS53949.1. [Q7Z401-2]
PIRiI37904.
RefSeqiNP_001138295.1. NM_001144823.2. [Q7Z401-2]
NP_005839.3. NM_005848.4. [Q7Z401-1]
XP_005254178.1. XM_005254121.2. [Q7Z401-1]
UniGeneiHs.654567.

3D structure databases

ProteinModelPortaliQ7Z401.
SMRiQ7Z401. Positions 215-630.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115552. 15 interactions.
IntActiQ7Z401. 5 interactions.
MINTiMINT-1631757.
STRINGi9606.ENSP00000391167.

PTM databases

iPTMnetiQ7Z401.
PhosphoSiteiQ7Z401.

Polymorphism and mutation databases

BioMutaiDENND4A.
DMDMi88909230.

Proteomic databases

EPDiQ7Z401.
MaxQBiQ7Z401.
PaxDbiQ7Z401.
PRIDEiQ7Z401.

Protocols and materials databases

DNASUi10260.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000431932; ENSP00000396830; ENSG00000174485. [Q7Z401-1]
ENST00000443035; ENSP00000391167; ENSG00000174485. [Q7Z401-2]
GeneIDi10260.
KEGGihsa:10260.
UCSCiuc002aph.4. human. [Q7Z401-1]

Organism-specific databases

CTDi10260.
GeneCardsiDENND4A.
H-InvDBHIX0012356.
HGNCiHGNC:24321. DENND4A.
MIMi600382. gene.
neXtProtiNX_Q7Z401.
PharmGKBiPA134887513.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2127. Eukaryota.
ENOG410XQMX. LUCA.
GeneTreeiENSGT00760000118819.
HOGENOMiHOG000231590.
HOVERGENiHBG058313.
InParanoidiQ7Z401.
OMAiLFEMQKA.
OrthoDBiEOG790FZV.
PhylomeDBiQ7Z401.
TreeFamiTF313237.

Miscellaneous databases

ChiTaRSiDENND4A. human.
GeneWikiiDENND4A.
GenomeRNAii10260.
NextBioi38872.
PROiQ7Z401.
SOURCEiSearch...

Gene expression databases

BgeeiQ7Z401.
CleanExiHS_DENND4A.
ExpressionAtlasiQ7Z401. baseline and differential.
GenevisibleiQ7Z401. HS.

Family and domain databases

InterProiIPR005112. dDENN_dom.
IPR001194. DENN_dom.
IPR023341. MABP.
IPR002885. Pentatricopeptide_repeat.
IPR005113. uDENN_dom.
[Graphical view]
PfamiPF03455. dDENN. 1 hit.
PF02141. DENN. 1 hit.
PF03456. uDENN. 1 hit.
[Graphical view]
SMARTiSM00801. dDENN. 1 hit.
SM00799. DENN. 1 hit.
SM00800. uDENN. 1 hit.
[Graphical view]
TIGRFAMsiTIGR00756. PPR. 1 hit.
PROSITEiPS50947. DDENN. 1 hit.
PS50211. DENN. 1 hit.
PS51498. MABP. 1 hit.
PS51375. PPR. 1 hit.
PS50946. UDENN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning, structural analysis, and expression of a human IRLB, MYC promoter-binding protein: new DENN domain-containing protein family emerges."
    Semova N., Kapanadze B., Corcoran M., Kutsenko A., Baranova A., Semov A.
    Genomics 82:343-354(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE, INDUCTION.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 33-1863 (ISOFORM 1).
    Tissue: Bone marrow and Spinal cord.
  3. "Analysis of the DNA sequence and duplication history of human chromosome 15."
    Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
    , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
    Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT PRO-284.
    Tissue: Uterus.
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-928 (ISOFORM 1).
    Tissue: Brain.
  6. "Cloning of a cDNA encoding a human protein which binds a sequence in the c-myc gene similar to the interferon-stimulated response element."
    Stasiv Y.Z., Mashkova T.D., Chernov B.K., Sokolava I.V., Itkes A.V., Kisselev L.L.
    Gene 145:267-272(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1673-1863 (ISOFORM 1), FUNCTION.
  7. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
    Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
    J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-731 AND SER-1587, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  10. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1035, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  11. "Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors."
    Yoshimura S., Gerondopoulos A., Linford A., Rigden D.J., Barr F.A.
    J. Cell Biol. 191:367-381(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION AS GUANYL-NUCLEOTIDE EXCHANGE FACTOR.
  12. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  14. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiMYCPP_HUMAN
AccessioniPrimary (citable) accession number: Q7Z401
Secondary accession number(s): E7EPL3
, Q14655, Q86T77, Q8IVX2, Q8NB93
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 21, 2006
Last sequence update: February 21, 2006
Last modified: May 11, 2016
This is version 116 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.