Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ubiquitin-protein ligase E3B

Gene

UBE3B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.By similarity

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei1036 – 10361Glycyl thioester intermediatePROSITE-ProRule annotation

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Ligase

Keywords - Biological processi

Ubl conjugation pathway

Enzyme and pathway databases

ReactomeiR-HSA-983168. Antigen processing: Ubiquitination & Proteasome degradation.
UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
Ubiquitin-protein ligase E3B (EC:6.3.2.-)
Gene namesi
Name:UBE3B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:13478. UBE3B.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Pathology & Biotechi

Involvement in diseasei

Kaufman oculocerebrofacial syndrome (KOS)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA syndrome characterized by blepharophimosis, ptosis, mild upslanting of the palpebral fissures, epicanthus, ectodermal anomalies, developmental delay, and severe intellectual disability with absent speech. Proportionate growth retardation with a small head circumference/microcephaly, congenital malformations, muscular hypotonia, anomalies on brain imaging with hypoplasia of the corpus callosum, and low cholesterol levels are variably present.
See also OMIM:244450
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti727 – 7271Q → P in KOS. 1 Publication
VAR_069712

Keywords - Diseasei

Disease mutation, Mental retardation

Organism-specific databases

MalaCardsiUBE3B.
MIMi244450. phenotype.
Orphaneti329255. Blepharophimosis-intellectual disability syndrome due to UBE3B deficiency.
2707. Oculocerebrofacial syndrome, Kaufman type.
PharmGKBiPA134872189.

Polymorphism and mutation databases

BioMutaiUBE3B.
DMDMi296453010.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10681068Ubiquitin-protein ligase E3BPRO_0000281882Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionineCombined sources
Modified residuei419 – 4191PhosphoserineCombined sources

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ7Z3V4.
MaxQBiQ7Z3V4.
PaxDbiQ7Z3V4.
PRIDEiQ7Z3V4.

PTM databases

iPTMnetiQ7Z3V4.
PhosphoSiteiQ7Z3V4.

Expressioni

Tissue specificityi

Widely expressed.1 Publication

Gene expression databases

BgeeiQ7Z3V4.
CleanExiHS_UBE3B.
ExpressionAtlasiQ7Z3V4. baseline and differential.
GenevisibleiQ7Z3V4. HS.

Organism-specific databases

HPAiHPA041012.

Interactioni

Protein-protein interaction databases

BioGridi124642. 8 interactions.
IntActiQ7Z3V4. 3 interactions.
STRINGi9606.ENSP00000340596.

Structurei

3D structure databases

ProteinModelPortaliQ7Z3V4.
SMRiQ7Z3V4. Positions 683-1059.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini29 – 5830IQPROSITE-ProRule annotationAdd
BLAST
Domaini702 – 1068367HECTPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain.PROSITE-ProRule annotation
Contains 1 IQ domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0942. Eukaryota.
COG5021. LUCA.
GeneTreeiENSGT00550000074668.
HOGENOMiHOG000232154.
HOVERGENiHBG108644.
InParanoidiQ7Z3V4.
KOiK10588.
OMAiFQSVHGW.
OrthoDBiEOG7R56RN.
PhylomeDBiQ7Z3V4.
TreeFamiTF313215.

Family and domain databases

InterProiIPR000569. HECT_dom.
IPR000048. IQ_motif_EF-hand-BS.
[Graphical view]
PfamiPF00632. HECT. 1 hit.
[Graphical view]
SMARTiSM00119. HECTc. 1 hit.
SM00015. IQ. 1 hit.
[Graphical view]
SUPFAMiSSF56204. SSF56204. 1 hit.
PROSITEiPS50237. HECT. 1 hit.
PS50096. IQ. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7Z3V4-1) [UniParc]FASTAAdd to basket

Also known as: UBE3B_v1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFTLSQTSRA WFIDRARQAR EERLVQKERE RAAVVIQAHV RSFLCRSRLQ
60 70 80 90 100
RDIRREIDDF FKADDPESTK RSALCIFKIA RKLLFLFRIK EDNERFEKLC
110 120 130 140 150
RSILSSMDAE NEPKVWYVSL ACSKDLTLLW IQQIKNILWY CCDFLKQLKP
160 170 180 190 200
EILQDSRLIT LYLTMLVTFT DTSTWKILRG KGESLRPAMN HICANIMGHL
210 220 230 240 250
NQHGFYSVLQ ILLTRGLARP RPCLSKGTLT AAFSLALRPV IAAQFSDNLI
260 270 280 290 300
RPFLIHIMSV PALVTHLSTV TPERLTVLES HDMLRKFIIF LRDQDRCRDV
310 320 330 340 350
CESLEGCHTL CLMGNLLHLG SLSPRVLEEE TDGFVSLLTQ TLCYCRKYVS
360 370 380 390 400
QKKSNLTHWH PVLGWFSQSV DYGLNESMHL ITKQLQFLWG VPLIRIFFCD
410 420 430 440 450
ILSKKLLESQ EPAHAQPASP QNVLPVKSLL KRAFQKSASV RNILRPVGGK
460 470 480 490 500
RVDSAEVQKV CNICVLYQTS LTTLTQIRLQ ILTGLTYLDD LLPKLWAFIC
510 520 530 540 550
ELGPHGGLKL FLECLNNDTE ESKQLLAMLM LFCDCSRHLI TILDDIEVYE
560 570 580 590 600
EQISFKLEEL VTISSFLNSF VFKMIWDGIV ENAKGETLEL FQSVHGWLMV
610 620 630 640 650
LYERDCRRRF TPEDHWLRKD LKPSVLFQEL DRDRKRAQLI LQYIPHVIPH
660 670 680 690 700
KNRVLLFRTM VTKEKEKLGL VETSSASPHV THITIRRSRM LEDGYEQLRQ
710 720 730 740 750
LSQHAMKGVI RVKFVNDLGV DEAGIDQDGV FKEFLEEIIK RVFDPALNLF
760 770 780 790 800
KTTSGDERLY PSPTSYIHEN YLQLFEFVGK MLGKAVYEGI VVDVPFASFF
810 820 830 840 850
LSQLLGHHHS VFYSSVDELP SLDSEFYKNL TSIKRYDGDI TDLGLTLSYD
860 870 880 890 900
EDVMGQLVCH ELIPGGKTIP VTNENKISYI HLMAHFRMHT QIKNQTAALI
910 920 930 940 950
SGFRSIIKPE WIRMFSTPEL QRLISGDNAE IDLEDLKKHT VYYGGFHGSH
960 970 980 990 1000
RVIIWLWDIL ASDFTPDERA MFLKFVTSCS RPPLLGFAYL KPPFSIRCVE
1010 1020 1030 1040 1050
VSDDQDTGDT LGSVLRGFFT IRKREPGGRL PTSSTCFNLL KLPNYSKKSV
1060
LREKLRYAIS MNTGFELS
Note: Major isoform.
Length:1,068
Mass (Da):123,098
Last modified:May 18, 2010 - v3
Checksum:iA1740A3DDC5E1A4D
GO
Isoform 2 (identifier: Q7Z3V4-2) [UniParc]FASTAAdd to basket

Also known as: UBE3B_v2

The sequence of this isoform differs from the canonical sequence as follows:
     693-708: DGYEQLRQLSQHAMKG → SLFECPWPLVINAESC
     709-1068: Missing.

Show »
Length:708
Mass (Da):82,097
Checksum:iA4BF5D68DEFA6DD2
GO
Isoform 3 (identifier: Q7Z3V4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     211-244: ILLTRGLARPRPCLSKGTLTAAFSLALRPVIAAQ → CCDGLFPDLVSYAPHNNPVRWSVGRSWYDWQLSR
     245-1068: Missing.

Note: No experimental confirmation available.
Show »
Length:244
Mass (Da):28,934
Checksum:iC2B67EC118442978
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti151 – 1511E → V in CAD97645 (PubMed:17974005).Curated
Sequence conflicti907 – 9071I → V in CAD97645 (PubMed:17974005).Curated
Sequence conflicti942 – 9421Y → H in CAD97645 (PubMed:17974005).Curated
Sequence conflicti1018 – 10181F → S in CAD97645 (PubMed:17974005).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti346 – 3461R → Q.2 Publications
Corresponds to variant rs7298565 [ dbSNP | Ensembl ].
VAR_031302
Natural varianti727 – 7271Q → P in KOS. 1 Publication
VAR_069712

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei211 – 24434ILLTR…VIAAQ → CCDGLFPDLVSYAPHNNPVR WSVGRSWYDWQLSR in isoform 3. 1 PublicationVSP_024085Add
BLAST
Alternative sequencei245 – 1068824Missing in isoform 3. 1 PublicationVSP_024086Add
BLAST
Alternative sequencei693 – 70816DGYEQ…HAMKG → SLFECPWPLVINAESC in isoform 2. 2 PublicationsVSP_024087Add
BLAST
Alternative sequencei709 – 1068360Missing in isoform 2. 2 PublicationsVSP_024088Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF251046 mRNA. Translation: AAK28419.2.
AL096740 mRNA. Translation: CAH56410.1.
BX537403 mRNA. Translation: CAD97645.1.
AC007570 Genomic DNA. No translation available.
BC032301 mRNA. Translation: AAH32301.1.
BC051266 mRNA. Translation: AAH51266.1.
BC068221 mRNA. Translation: AAH68221.1.
BC108705 mRNA. Translation: AAI08706.1.
BC141880 mRNA. Translation: AAI41881.1.
CCDSiCCDS58277.1. [Q7Z3V4-3]
CCDS9129.1. [Q7Z3V4-1]
RefSeqiNP_001257378.1. NM_001270449.1. [Q7Z3V4-3]
NP_001257379.1. NM_001270450.1. [Q7Z3V4-3]
NP_001257380.1. NM_001270451.1. [Q7Z3V4-3]
NP_569733.2. NM_130466.3. [Q7Z3V4-1]
NP_904324.1. NM_183415.2. [Q7Z3V4-1]
XP_005254044.1. XM_005253987.1. [Q7Z3V4-1]
XP_011537261.1. XM_011538959.1. [Q7Z3V4-1]
UniGeneiHs.374067.

Genome annotation databases

EnsembliENST00000340074; ENSP00000342614; ENSG00000151148. [Q7Z3V4-3]
ENST00000342494; ENSP00000340596; ENSG00000151148. [Q7Z3V4-1]
ENST00000434735; ENSP00000391529; ENSG00000151148. [Q7Z3V4-1]
ENST00000449510; ENSP00000395802; ENSG00000151148. [Q7Z3V4-2]
ENST00000536398; ENSP00000440585; ENSG00000151148. [Q7Z3V4-3]
ENST00000540230; ENSP00000443565; ENSG00000151148. [Q7Z3V4-3]
GeneIDi89910.
KEGGihsa:89910.
UCSCiuc001tom.5. human. [Q7Z3V4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF251046 mRNA. Translation: AAK28419.2.
AL096740 mRNA. Translation: CAH56410.1.
BX537403 mRNA. Translation: CAD97645.1.
AC007570 Genomic DNA. No translation available.
BC032301 mRNA. Translation: AAH32301.1.
BC051266 mRNA. Translation: AAH51266.1.
BC068221 mRNA. Translation: AAH68221.1.
BC108705 mRNA. Translation: AAI08706.1.
BC141880 mRNA. Translation: AAI41881.1.
CCDSiCCDS58277.1. [Q7Z3V4-3]
CCDS9129.1. [Q7Z3V4-1]
RefSeqiNP_001257378.1. NM_001270449.1. [Q7Z3V4-3]
NP_001257379.1. NM_001270450.1. [Q7Z3V4-3]
NP_001257380.1. NM_001270451.1. [Q7Z3V4-3]
NP_569733.2. NM_130466.3. [Q7Z3V4-1]
NP_904324.1. NM_183415.2. [Q7Z3V4-1]
XP_005254044.1. XM_005253987.1. [Q7Z3V4-1]
XP_011537261.1. XM_011538959.1. [Q7Z3V4-1]
UniGeneiHs.374067.

3D structure databases

ProteinModelPortaliQ7Z3V4.
SMRiQ7Z3V4. Positions 683-1059.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124642. 8 interactions.
IntActiQ7Z3V4. 3 interactions.
STRINGi9606.ENSP00000340596.

PTM databases

iPTMnetiQ7Z3V4.
PhosphoSiteiQ7Z3V4.

Polymorphism and mutation databases

BioMutaiUBE3B.
DMDMi296453010.

Proteomic databases

EPDiQ7Z3V4.
MaxQBiQ7Z3V4.
PaxDbiQ7Z3V4.
PRIDEiQ7Z3V4.

Protocols and materials databases

DNASUi89910.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000340074; ENSP00000342614; ENSG00000151148. [Q7Z3V4-3]
ENST00000342494; ENSP00000340596; ENSG00000151148. [Q7Z3V4-1]
ENST00000434735; ENSP00000391529; ENSG00000151148. [Q7Z3V4-1]
ENST00000449510; ENSP00000395802; ENSG00000151148. [Q7Z3V4-2]
ENST00000536398; ENSP00000440585; ENSG00000151148. [Q7Z3V4-3]
ENST00000540230; ENSP00000443565; ENSG00000151148. [Q7Z3V4-3]
GeneIDi89910.
KEGGihsa:89910.
UCSCiuc001tom.5. human. [Q7Z3V4-1]

Organism-specific databases

CTDi89910.
GeneCardsiUBE3B.
H-InvDBHIX0020836.
HIX0036751.
HIX0129665.
HGNCiHGNC:13478. UBE3B.
HPAiHPA041012.
MalaCardsiUBE3B.
MIMi244450. phenotype.
608047. gene.
neXtProtiNX_Q7Z3V4.
Orphaneti329255. Blepharophimosis-intellectual disability syndrome due to UBE3B deficiency.
2707. Oculocerebrofacial syndrome, Kaufman type.
PharmGKBiPA134872189.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0942. Eukaryota.
COG5021. LUCA.
GeneTreeiENSGT00550000074668.
HOGENOMiHOG000232154.
HOVERGENiHBG108644.
InParanoidiQ7Z3V4.
KOiK10588.
OMAiFQSVHGW.
OrthoDBiEOG7R56RN.
PhylomeDBiQ7Z3V4.
TreeFamiTF313215.

Enzyme and pathway databases

UniPathwayiUPA00143.
ReactomeiR-HSA-983168. Antigen processing: Ubiquitination & Proteasome degradation.

Miscellaneous databases

ChiTaRSiUBE3B. human.
GenomeRNAii89910.
PROiQ7Z3V4.
SOURCEiSearch...

Gene expression databases

BgeeiQ7Z3V4.
CleanExiHS_UBE3B.
ExpressionAtlasiQ7Z3V4. baseline and differential.
GenevisibleiQ7Z3V4. HS.

Family and domain databases

InterProiIPR000569. HECT_dom.
IPR000048. IQ_motif_EF-hand-BS.
[Graphical view]
PfamiPF00632. HECT. 1 hit.
[Graphical view]
SMARTiSM00119. HECTc. 1 hit.
SM00015. IQ. 1 hit.
[Graphical view]
SUPFAMiSSF56204. SSF56204. 1 hit.
PROSITEiPS50237. HECT. 1 hit.
PS50096. IQ. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Characterization of the human UBE3B gene: structure, expression, evolution, and alternative splicing."
    Gong T.-W.L., Huang L., Warner S.J., Lomax M.I.
    Genomics 82:143-152(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT GLN-346.
    Tissue: Endometrial adenocarcinoma.
  3. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANT GLN-346.
    Tissue: Brain, Lung, Prostate and Skin.
  5. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-419, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  6. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  7. Cited for: VARIANT KOS PRO-727.

Entry informationi

Entry nameiUBE3B_HUMAN
AccessioniPrimary (citable) accession number: Q7Z3V4
Secondary accession number(s): A5D8Z3
, Q05BX9, Q659F7, Q7Z7Q1, Q9BXZ4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: May 18, 2010
Last modified: June 8, 2016
This is version 111 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.