Q7Z3V4 (UBE3B_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 67.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ubiquitin-protein ligase E3B EC=6.3.2.- | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1068 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates By similarity. |
| Pathway | |
| Tissue specificity | Widely expressed. Ref.1 |
| Sequence similarities | Contains 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain. Contains 1 IQ domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ubl conjugation pathway |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Molecular function | Ligase |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | protein ubiquitination involved in ubiquitin-dependent protein catabolic process Inferred from Biological aspect of Ancestor. Source: RefGenome |
| Cellular component | intracellular Inferred from electronic annotation. Source: InterPro |
| Molecular function | ubiquitin-protein ligase activity Inferred from Biological aspect of Ancestor. Source: RefGenome |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q7Z3V4-1) Also known as: UBE3B_v1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Major isoform. | ||||||
| Isoform 2 (identifier: Q7Z3V4-2) Also known as: UBE3B_v2; The sequence of this isoform differs from the canonical sequence as follows: 693-708: DGYEQLRQLSQHAMKG → SLFECPWPLVINAESC 709-1068: Missing. | ||||||
| Isoform 3 (identifier: Q7Z3V4-3) The sequence of this isoform differs from the canonical sequence as follows: 211-244: ILLTRGLARPRPCLSKGTLTAAFSLALRPVIAAQ → CCDGLFPDLVSYAPHNNPVRWSVGRSWYDWQLSR 245-1068: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1068 | 1068 | Ubiquitin-protein ligase E3B | PRO_0000281882 | |||||
Regions | |||||||||
| Domain | 29 – 58 | 30 | IQ | ||||||
| Domain | 702 – 1068 | 367 | HECT | ||||||
Sites | |||||||||
| Active site | 1036 | 1 | Glycyl thioester intermediate By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 419 | 1 | Phosphoserine Ref.5 | ||||||
Natural variations | |||||||||
| Alternative sequence | 211 – 244 | 34 | ILLTR…VIAAQ → CCDGLFPDLVSYAPHNNPVR WSVGRSWYDWQLSR in isoform 3. | VSP_024085 | |||||
| Alternative sequence | 245 – 1068 | 824 | Missing in isoform 3. | VSP_024086 | |||||
| Alternative sequence | 693 – 708 | 16 | DGYEQ…HAMKG → SLFECPWPLVINAESC in isoform 2. | VSP_024087 | |||||
| Alternative sequence | 709 – 1068 | 360 | Missing in isoform 2. | VSP_024088 | |||||
| Natural variant | 346 | 1 | R → Q. Ref.2 Ref.4 Corresponds to variant rs7298565 [ dbSNP | Ensembl ]. | VAR_031302 | |||||
Experimental info | |||||||||
| Sequence conflict | 151 | 1 | E → V in CAD97645. Ref.2 | ||||||
| Sequence conflict | 907 | 1 | I → V in CAD97645. Ref.2 | ||||||
| Sequence conflict | 942 | 1 | Y → H in CAD97645. Ref.2 | ||||||
| Sequence conflict | 1018 | 1 | F → S in CAD97645. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization of the human UBE3B gene: structure, expression, evolution, and alternative splicing." Gong T.-W.L., Huang L., Warner S.J., Lomax M.I. Genomics 82:143-152(2003) [PubMed: 12837265] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY. |
| [2] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT GLN-346. Tissue: Endometrial adenocarcinoma. |
| [3] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed: 16541075] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANT GLN-346. Tissue: Brain, Lung, Prostate and Skin. |
| [5] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed: 18691976] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-419, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF251046 mRNA. Translation: AAK28419.2. AL096740 mRNA. Translation: CAH56410.1. BX537403 mRNA. Translation: CAD97645.1. AC007570 Genomic DNA. No translation available. BC032301 mRNA. Translation: AAH32301.1. BC051266 mRNA. Translation: AAH51266.1. BC068221 mRNA. Translation: AAH68221.1. BC108705 mRNA. Translation: AAI08706.1. BC141880 mRNA. Translation: AAI41881.1. |
| IPI | IPI00385576. IPI00411596. IPI00470597. |
| RefSeq | NP_569733.2. NM_130466.2. NP_904324.1. NM_183415.1. |
| UniGene | Hs.374067. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1ND7 based on UniProtKB Q9H0M0. |
| ProteinModelPortal | Q7Z3V4. |
| SMR | Q7Z3V4. Positions 637-1061. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q7Z3V4. 1 interaction. |
| STRING | Q7Z3V4. |
PTM databases | |
| PhosphoSite | Q7Z3V4. |
Polymorphism databases | |
| DMDM | 296453010. |
Proteomic databases | |
| PRIDE | Q7Z3V4. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000342494; ENSP00000340596; ENSG00000151148. ENST00000434735; ENSP00000391529; ENSG00000151148. |
| GeneID | 89910. |
| KEGG | hsa:89910. |
| UCSC | uc001tom.2. human. uc009zvj.1. human. |
Organism-specific databases | |
| CTD | 89910. |
| GeneCards | GC12P109915. |
| H-InvDB | HIX0020836. |
| HGNC | HGNC:13478. UBE3B. |
| HPA | HPA041012. |
| MIM | 608047. gene. |
| neXtProt | NX_Q7Z3V4. |
| PharmGKB | PA134872189. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG10089. |
| GeneTree | ENSGT00550000074668. |
| HOGENOM | HBG315289. |
| HOVERGEN | HBG108644. |
| InParanoid | Q7Z3V4. |
| OMA | FFTIRKR. |
| OrthoDB | EOG4R501Z. |
| PhylomeDB | Q7Z3V4. |
Enzyme and pathway databases | |
| Reactome | REACT_6900. Immune System. |
Gene expression databases | |
| ArrayExpress | Q7Z3V4. |
| Bgee | Q7Z3V4. |
| CleanEx | HS_UBE3B. |
| Genevestigator | Q7Z3V4. |
Family and domain databases | |
| InterPro | IPR000569. HECT. IPR000048. IQ_motif_EF-hand-BS. [Graphical view] |
| KO | K10588. |
| Pfam | PF00632. HECT. 1 hit. PF00612. IQ. 1 hit. [Graphical view] |
| SMART | SM00119. HECTc. 1 hit. SM00015. IQ. 1 hit. [Graphical view] |
| SUPFAM | SSF56204. HECT. 1 hit. |
| PROSITE | PS50237. HECT. 1 hit. PS50096. IQ. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 76429. |
| SOURCE | Search... |
Entry information
| Entry name | UBE3B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q7Z3V4 Secondary accession number(s): A5D8Z3 Q9BXZ4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with