Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

UPF0505 protein C16orf62

Gene

C16orf62

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Involved in copper-dependent ATP7A trafficking between the trans-Golgi network and vesicles in the cell periphery; the function is proposed to depend on its association within the CCC complex and cooperation with the WASH complex on early endosomes. Seems not to be required for CCC complex stability (PubMed:25355947).1 Publication

GO - Biological processi

  1. Golgi to plasma membrane transport Source: UniProtKB
  2. protein transport Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Protein transport, Transport

Names & Taxonomyi

Protein namesi
Recommended name:
UPF0505 protein C16orf62
Alternative name(s):
Esophageal cancer-associated protein
Gene namesi
ORF Names:101F10.2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:24641. C16orf62.

Subcellular locationi

Membrane Curated; Single-pass membrane protein Curated. Early endosome 1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei703 – 71917HelicalSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. early endosome Source: UniProtKB-SubCell
  2. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Endosome, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162378300.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 963963UPF0505 protein C16orf62PRO_0000311352Add
BLAST

Proteomic databases

MaxQBiQ7Z3J2.
PaxDbiQ7Z3J2.
PRIDEiQ7Z3J2.

PTM databases

PhosphoSiteiQ7Z3J2.

Expressioni

Gene expression databases

BgeeiQ7Z3J2.
CleanExiHS_C16orf62.
ExpressionAtlasiQ7Z3J2. baseline and differential.
GenevestigatoriQ7Z3J2.

Organism-specific databases

HPAiHPA042969.
HPA053547.

Interactioni

Subunit structurei

Interacts with COMMD1, CCDC93 and CCDC22; proposed to be a component of the CCC (COMMD/CCDC22/CCDC93) complex which contains at least COMMD1 (and possibly other COMM domain-containing proteins), CCDC22, CCDC93 and C16orf62. Interacts with FAM21C, WASH1 (PubMed:25355947).1 Publication1 Publication

Protein-protein interaction databases

BioGridi121329. 4 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ7Z3J2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi53 – 7119Ser-richAdd
BLAST

Sequence similaritiesi

Belongs to the UPF0505 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG327943.
GeneTreeiENSGT00390000011343.
HOVERGENiHBG107748.
InParanoidiQ7Z3J2.
PhylomeDBiQ7Z3J2.

Family and domain databases

InterProiIPR029705. UPF0505.
IPR029706. UPF0505_C16ORF62.
[Graphical view]
PANTHERiPTHR13673. PTHR13673. 1 hit.
PTHR13673:SF2. PTHR13673:SF2. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7Z3J2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAVFPWHSRN RNYKAEFASC RLEAVPLEFG DYHPLKPITV TESKTKKVNR
60 70 80 90 100
KGSTSSTSSS SSSSVVDPLS SVLDGTDPLS MFAATADPAA LAAAMDSSRR
110 120 130 140 150
KRDRDDNSVV GSDFEPWTNK RGEILARYTT TEKLSINLFM GSEKGKAGTA
160 170 180 190 200
TLAMSEKVRT RLEELDDFEE GSQKELLNLT QQDYVNRIEE LNQSLKDAWA
210 220 230 240 250
SDQKVKALKI VIQCSKLLSD TSVIQFYPSK FVLITDILDT FGKLVYERIF
260 270 280 290 300
SMCVDSRSVL PDHFSPENAN DTAKETCLNW FFKIASIREL IPRFYVEASI
310 320 330 340 350
LKCNKFLSKT GISECLPRLT CMIRGIGDPL VSVYARAYLC RVGMEVAPHL
360 370 380 390 400
KETLNKNFFD FLLTFKQIHG DTVQNQLVVQ GVELPSYLPL YPPAMDWIFQ
410 420 430 440 450
CISYHAPEAL LTEMMERCKK LGNNALLLNS VMSAFRAEFI ATRSMDFIGM
460 470 480 490 500
IKECDESGFP KHLLFRSLGL NLALADPPES DRLQILNEAW KVITKLKNPQ
510 520 530 540 550
DYINCAEVWV EYTCKHFTKR EVNTVLADVI KHMTPDRAFE DSYPQLQLII
560 570 580 590 600
KKVIAHFHDF SVLFSVEKFL PFLDMFQKES VRVEVCKCIM DAFIKHQQEP
610 620 630 640 650
TKDPVILNAL LHVCKTMHDS VNALTLEDEK RMLSYLINGF IKMVSFGRDF
660 670 680 690 700
EQQLSFYVES RSMFCNLEPV LVQLIHSVNR LAMETRKVMK GNHSRKTAAF
710 720 730 740 750
VRACVAYCFI TIPSLAGIFT RLNLYLHSGQ VALANQCLSQ ADAFFKAAIS
760 770 780 790 800
LVPEVPKMIN IDGKMRPSES FLLEFLCNFF STLLIVPDHP EHGVLFLVRE
810 820 830 840 850
LLNVIQDYTW EDNSDEKIRI YTCVLHLLSA MSQETYLYHI DKVDSNDSLY
860 870 880 890 900
GGDSKFLAEN NKLCETVMAQ ILEHLKTLAK DEALKRQSSL GLSFFNSILA
910 920 930 940 950
HGDLRNNKLN QLSVNLWHLA QRHGCADTRT MVKTLEYIKK QSKQPDMTHL
960
TELALRLPLQ TRT
Length:963
Mass (Da):109,563
Last modified:November 13, 2007 - v2
Checksum:i5500471390F85683
GO
Isoform 2 (identifier: Q7Z3J2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-122: Missing.
     123-144: EILARYTTTEKLSINLFMGSEK → MPPLGVLVHEKSHLCDVNSFCL
     214-243: CSKLLSDTSVIQFYPSKFVLITDILDTFGK → EE

Show »
Length:813
Mass (Da):93,086
Checksum:iD5D3817BDA5B0129
GO

Sequence cautioni

The sequence AAH14900.2 differs from that shown. Reason: Erroneous initiation. Curated
The sequence CAD97869.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti168 – 1681F → S in CAH10399 (PubMed:17974005).Curated
Sequence conflicti340 – 3401C → G in AAL67806 (Ref. 1) Curated
Sequence conflicti675 – 6751I → V in CAD97869 (PubMed:17974005).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti32 – 321Y → C.1 Publication
Corresponds to variant rs17854969 [ dbSNP | Ensembl ].
VAR_037230
Natural varianti186 – 1861N → I.
Corresponds to variant rs7206637 [ dbSNP | Ensembl ].
VAR_037231
Natural varianti506 – 5061A → V.1 Publication
Corresponds to variant rs17854970 [ dbSNP | Ensembl ].
VAR_037232

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 122122Missing in isoform 2. 1 PublicationVSP_029536Add
BLAST
Alternative sequencei123 – 14422EILAR…MGSEK → MPPLGVLVHEKSHLCDVNSF CL in isoform 2. 1 PublicationVSP_029537Add
BLAST
Alternative sequencei214 – 24330CSKLL…DTFGK → EE in isoform 2. 1 PublicationVSP_029538Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF461052 mRNA. Translation: AAL67806.2.
AK024693 mRNA. Translation: BAB14965.1.
AK290286 mRNA. Translation: BAF82975.1.
BX537867 mRNA. Translation: CAD97869.1. Different initiation.
AL833428 mRNA. Translation: CAH10399.1.
BC014900 mRNA. Translation: AAH14900.2. Different initiation.
BC050464 mRNA. Translation: AAH50464.1.
BC058845 mRNA. Translation: AAH58845.1.
AL136744 mRNA. Translation: CAB66678.1.
AC002550 Genomic DNA. Translation: AAC05806.1.
RefSeqiNP_064710.4. NM_020314.5.
UniGeneiHs.654964.

Genome annotation databases

EnsembliENST00000417362; ENSP00000395973; ENSG00000103544. [Q7Z3J2-1]
GeneIDi57020.
KEGGihsa:57020.
UCSCiuc002dgp.2. human. [Q7Z3J2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF461052 mRNA. Translation: AAL67806.2.
AK024693 mRNA. Translation: BAB14965.1.
AK290286 mRNA. Translation: BAF82975.1.
BX537867 mRNA. Translation: CAD97869.1. Different initiation.
AL833428 mRNA. Translation: CAH10399.1.
BC014900 mRNA. Translation: AAH14900.2. Different initiation.
BC050464 mRNA. Translation: AAH50464.1.
BC058845 mRNA. Translation: AAH58845.1.
AL136744 mRNA. Translation: CAB66678.1.
AC002550 Genomic DNA. Translation: AAC05806.1.
RefSeqiNP_064710.4. NM_020314.5.
UniGeneiHs.654964.

3D structure databases

ProteinModelPortaliQ7Z3J2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121329. 4 interactions.

PTM databases

PhosphoSiteiQ7Z3J2.

Proteomic databases

MaxQBiQ7Z3J2.
PaxDbiQ7Z3J2.
PRIDEiQ7Z3J2.

Protocols and materials databases

DNASUi57020.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000417362; ENSP00000395973; ENSG00000103544. [Q7Z3J2-1]
GeneIDi57020.
KEGGihsa:57020.
UCSCiuc002dgp.2. human. [Q7Z3J2-1]

Organism-specific databases

CTDi57020.
GeneCardsiGC16P019566.
H-InvDBHIX0022848.
HGNCiHGNC:24641. C16orf62.
HPAiHPA042969.
HPA053547.
neXtProtiNX_Q7Z3J2.
PharmGKBiPA162378300.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG327943.
GeneTreeiENSGT00390000011343.
HOVERGENiHBG107748.
InParanoidiQ7Z3J2.
PhylomeDBiQ7Z3J2.

Miscellaneous databases

ChiTaRSiC16orf62. human.
GenomeRNAii57020.
NextBioi62774.

Gene expression databases

BgeeiQ7Z3J2.
CleanExiHS_C16orf62.
ExpressionAtlasiQ7Z3J2. baseline and differential.
GenevestigatoriQ7Z3J2.

Family and domain databases

InterProiIPR029705. UPF0505.
IPR029706. UPF0505_C16ORF62.
[Graphical view]
PANTHERiPTHR13673. PTHR13673. 1 hit.
PTHR13673:SF2. PTHR13673:SF2. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Lu J., Liu Z., Hu G., Wu M., Wang X.
    Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    Tissue: Tongue.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Heart.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS CYS-32 AND VAL-506.
    Tissue: Pancreas and Uterus.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 396-963 (ISOFORM 1).
    Tissue: Testis.
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] OF 758-963.
  7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  8. Cited for: FUNCTION, IDENTIFICATION IN THE CCC COMPLEX, SUBCELLULAR LOCATION, SUBUNIT.

Entry informationi

Entry nameiCP062_HUMAN
AccessioniPrimary (citable) accession number: Q7Z3J2
Secondary accession number(s): A8K2M1
, O43329, Q69YI1, Q6PDA0, Q7L371, Q86W66, Q8WXA5, Q9H0L7, Q9H7C8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: November 13, 2007
Last modified: April 1, 2015
This is version 73 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families
  5. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.