Reviewed,
UniProtKB/Swiss-Prot Q7Z3J2 (CP062_HUMAN)
Last modified
November 4, 2008.
Version 23.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin · Protein attributes · General annotation (Comments) · Ontologies · Alternative products · Sequence annotation (Features) · Sequences · References · Cross-references · Entry information · Relevant documents
Names and origin
| Protein names | Recommended name: UPF0505 protein C16orf62 Alternative name(s): Esophageal cancer-associated protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 963 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Subcellular location | Membrane; Single-pass membrane proteinPotential. |
| Sequence similarities | Belongs to the UPF0505 family. |
Ontologies
Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane |
| PTM | Phosphoprotein |
Gene Ontology (GO) | |
| Cellular component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q7Z3J2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q7Z3J2-2) The sequence of this isoform differs from the canonical sequence as follows: 1-122: Missing. 123-144: EILARYTTTEKLSINLFMGSEK → MPPLGVLVHEKSHLCDVNSFCL 214-243: CSKLLSDTSVIQFYPSKFVLITDILDTFGK → EE |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 963 | 963 | UPF0505 protein C16orf62 | PRO_0000311352 | |||||
Regions | |||||||||
| Transmembrane | 703 – 719 | 17 | Potential | ||||||
| Compositional bias | 53 – 71 | 19 | Ser-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 58 | 1 | Phosphoserine | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 122 | 122 | Missing in isoform 2. | VSP_029536 | |||||
| Alternative sequence | 123 – 144 | 22 | EILAR…MGSEK → MPPLGVLVHEKSHLCDVNSF CL in isoform 2. | VSP_029537 | |||||
| Alternative sequence | 214 – 243 | 30 | CSKLL…DTFGK → EE in isoform 2. | VSP_029538 | |||||
| Natural variant | 32 | 1 | Y → C: dbSNP rs17854969. | VAR_037230 | |||||
| Natural variant | 186 | 1 | N → I: dbSNP rs7206637. | VAR_037231 | |||||
| Natural variant | 506 | 1 | A → V: dbSNP rs17854970. | VAR_037232 | |||||
Experimental info | |||||||||
| Sequence conflict | 168 | 1 | F → S in CAH10399. Ref.2 | ||||||
| Sequence conflict | 340 | 1 | C → G in AAL67806. Ref.1 | ||||||
| Sequence conflict | 675 | 1 | I → V in CAD97869. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | Lu J., Liu Z., Hu G., Wu M., Wang X. Submitted (FEB-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [2] | The German cDNA consortium Submitted (JUL-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Heart. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS CYS-32 AND VAL-506. Tissue: Pancreas and Uterus. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 140-963. |
| [5] | "Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. Poustka A.Genome Res. 11:422-435(2001) [PubMed: 11230166] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 396-963 (ISOFORM 1). Tissue: Testis. |
| [6] | "Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q." Loftus B.J., Kim U.-J., Sneddon V.P., Kalush F., Brandon R., Fuhrmann J., Mason T., Crosby M.L., Barnstead M., Cronin L., Mays A.D., Cao Y., Xu R.X., Kang H.-L., Mitchell S., Eichler E.E., Harris P.C., Venter J.C., Adams M.D. Genomics 60:295-308(1999) [PubMed: 10493829] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] OF 758-963 (ISOFORM 1). |
| [7] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-58, MASS SPECTROMETRY. Tissue: Epithelium. |
Cross-references
Sequence databases | |
|---|---|
| AF461052 mRNA. Translation: AAL67806.2. BX537867 mRNA. Translation: CAD97869.1. Different initiation. AL833428 mRNA. Translation: CAH10399.1. BC014900 mRNA. Translation: AAH14900.2. Different initiation. BC050464 mRNA. Translation: AAH50464.1. BC058845 mRNA. Translation: AAH58845.1. AK024693 mRNA. Translation: BAB14965.1. AL136744 mRNA. Translation: CAB66678.1. AC002550 Genomic DNA. Translation: AAC05806.1. | |
| RefSeq | NP_064710.3. |
| UniGene | Hs.654964 |
3D structure databases | |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q7Z3J2. |
Genome annotation databases | |
| Ensembl | ENSG00000103544. Homo sapiens. [Contig view] |
| GeneID | 57020. |
| KEGG | hsa:57020. |
Organism-specific databases | |
| HGNC | HGNC:24641. C16orf62. |
| GenAtlas | Search... |
| GeneCards | Search... |
Phylogenomic databases | |
| HOGENOM | Q7Z3J2. |
| HOVERGEN | Q7Z3J2. |
Gene expression databases | |
| ArrayExpress | Q7Z3J2. |
| CleanEx | HS_C16orf62. |
Family and domain databases | |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 62774. |
Entry information
| Entry name | CP062_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q7Z3J2 Secondary accession number(s): O43329 Q9H7C8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| UniProtKB secondary accession numbers Index of UniProtKB secondary accession numbers |
| SIMILARITY comments Index of protein domains and families |
| Uncharacterized protein families (UPF) List of uncharacterized protein family (UPF) entries |

Clusters with


