Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q7Z3J2 (CP062_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified May 14, 2014. Version 67. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
UPF0505 protein C16orf62
Alternative name(s):
Esophageal cancer-associated protein
Gene names
Name:C16orf62
ORF Names:101F10.2
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length963 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Subcellular location

Membrane; Single-pass membrane protein Potential.

Sequence similarities

Belongs to the UPF0505 family.

Sequence caution

The sequence AAH14900.2 differs from that shown. Reason: Erroneous initiation.

The sequence CAD97869.1 differs from that shown. Reason: Erroneous initiation.

Ontologies

Keywords
   Cellular componentMembrane
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainTransmembrane
Transmembrane helix
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentintegral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q7Z3J2-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q7Z3J2-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-122: Missing.
     123-144: EILARYTTTEKLSINLFMGSEK → MPPLGVLVHEKSHLCDVNSFCL
     214-243: CSKLLSDTSVIQFYPSKFVLITDILDTFGK → EE

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 963963UPF0505 protein C16orf62
PRO_0000311352

Regions

Transmembrane703 – 71917Helical; Potential
Compositional bias53 – 7119Ser-rich

Natural variations

Alternative sequence1 – 122122Missing in isoform 2.
VSP_029536
Alternative sequence123 – 14422EILAR…MGSEK → MPPLGVLVHEKSHLCDVNSF CL in isoform 2.
VSP_029537
Alternative sequence214 – 24330CSKLL…DTFGK → EE in isoform 2.
VSP_029538
Natural variant321Y → C. Ref.4
Corresponds to variant rs17854969 [ dbSNP | Ensembl ].
VAR_037230
Natural variant1861N → I.
Corresponds to variant rs7206637 [ dbSNP | Ensembl ].
VAR_037231
Natural variant5061A → V. Ref.4
Corresponds to variant rs17854970 [ dbSNP | Ensembl ].
VAR_037232

Experimental info

Sequence conflict1681F → S in CAH10399. Ref.3
Sequence conflict3401C → G in AAL67806. Ref.1
Sequence conflict6751I → V in CAD97869. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 13, 2007. Version 2.
Checksum: 5500471390F85683

FASTA963109,563
        10         20         30         40         50         60 
MAVFPWHSRN RNYKAEFASC RLEAVPLEFG DYHPLKPITV TESKTKKVNR KGSTSSTSSS 

        70         80         90        100        110        120 
SSSSVVDPLS SVLDGTDPLS MFAATADPAA LAAAMDSSRR KRDRDDNSVV GSDFEPWTNK 

       130        140        150        160        170        180 
RGEILARYTT TEKLSINLFM GSEKGKAGTA TLAMSEKVRT RLEELDDFEE GSQKELLNLT 

       190        200        210        220        230        240 
QQDYVNRIEE LNQSLKDAWA SDQKVKALKI VIQCSKLLSD TSVIQFYPSK FVLITDILDT 

       250        260        270        280        290        300 
FGKLVYERIF SMCVDSRSVL PDHFSPENAN DTAKETCLNW FFKIASIREL IPRFYVEASI 

       310        320        330        340        350        360 
LKCNKFLSKT GISECLPRLT CMIRGIGDPL VSVYARAYLC RVGMEVAPHL KETLNKNFFD 

       370        380        390        400        410        420 
FLLTFKQIHG DTVQNQLVVQ GVELPSYLPL YPPAMDWIFQ CISYHAPEAL LTEMMERCKK 

       430        440        450        460        470        480 
LGNNALLLNS VMSAFRAEFI ATRSMDFIGM IKECDESGFP KHLLFRSLGL NLALADPPES 

       490        500        510        520        530        540 
DRLQILNEAW KVITKLKNPQ DYINCAEVWV EYTCKHFTKR EVNTVLADVI KHMTPDRAFE 

       550        560        570        580        590        600 
DSYPQLQLII KKVIAHFHDF SVLFSVEKFL PFLDMFQKES VRVEVCKCIM DAFIKHQQEP 

       610        620        630        640        650        660 
TKDPVILNAL LHVCKTMHDS VNALTLEDEK RMLSYLINGF IKMVSFGRDF EQQLSFYVES 

       670        680        690        700        710        720 
RSMFCNLEPV LVQLIHSVNR LAMETRKVMK GNHSRKTAAF VRACVAYCFI TIPSLAGIFT 

       730        740        750        760        770        780 
RLNLYLHSGQ VALANQCLSQ ADAFFKAAIS LVPEVPKMIN IDGKMRPSES FLLEFLCNFF 

       790        800        810        820        830        840 
STLLIVPDHP EHGVLFLVRE LLNVIQDYTW EDNSDEKIRI YTCVLHLLSA MSQETYLYHI 

       850        860        870        880        890        900 
DKVDSNDSLY GGDSKFLAEN NKLCETVMAQ ILEHLKTLAK DEALKRQSSL GLSFFNSILA 

       910        920        930        940        950        960 
HGDLRNNKLN QLSVNLWHLA QRHGCADTRT MVKTLEYIKK QSKQPDMTHL TELALRLPLQ 


TRT 

« Hide

Isoform 2 [UniParc].

Checksum: D5D3817BDA5B0129
Show »

FASTA81393,086

References

« Hide 'large scale' references
[1]Lu J., Liu Z., Hu G., Wu M., Wang X.
Submitted (FEB-2002) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
Tissue: Tongue.
[3]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Heart.
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS CYS-32 AND VAL-506.
Tissue: Pancreas and Uterus.
[5]"Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs."
Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. expand/collapse author list , Tampe J., Heubner D., Wambutt R., Korn B., Klein M., Poustka A.
Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 396-963 (ISOFORM 1).
Tissue: Testis.
[6]"Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q."
Loftus B.J., Kim U.-J., Sneddon V.P., Kalush F., Brandon R., Fuhrmann J., Mason T., Crosby M.L., Barnstead M., Cronin L., Mays A.D., Cao Y., Xu R.X., Kang H.-L., Mitchell S., Eichler E.E., Harris P.C., Venter J.C., Adams M.D.
Genomics 60:295-308(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] OF 758-963.
[7]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF461052 mRNA. Translation: AAL67806.2.
AK024693 mRNA. Translation: BAB14965.1.
AK290286 mRNA. Translation: BAF82975.1.
BX537867 mRNA. Translation: CAD97869.1. Different initiation.
AL833428 mRNA. Translation: CAH10399.1.
BC014900 mRNA. Translation: AAH14900.2. Different initiation.
BC050464 mRNA. Translation: AAH50464.1.
BC058845 mRNA. Translation: AAH58845.1.
AL136744 mRNA. Translation: CAB66678.1.
AC002550 Genomic DNA. Translation: AAC05806.1.
RefSeqNP_064710.4. NM_020314.5.
UniGeneHs.654964.

3D structure databases

ProteinModelPortalQ7Z3J2.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid121329. 1 interaction.

PTM databases

PhosphoSiteQ7Z3J2.

Proteomic databases

MaxQBQ7Z3J2.
PaxDbQ7Z3J2.
PRIDEQ7Z3J2.

Protocols and materials databases

DNASU57020.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000251143; ENSP00000251143; ENSG00000103544. [Q7Z3J2-1]
GeneID57020.
KEGGhsa:57020.
UCSCuc002dgp.2. human. [Q7Z3J2-1]

Organism-specific databases

CTD57020.
GeneCardsGC16P019566.
H-InvDBHIX0022848.
HGNCHGNC:24641. C16orf62.
HPAHPA042969.
HPA053547.
neXtProtNX_Q7Z3J2.
PharmGKBPA162378300.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG327943.
HOVERGENHBG107748.
InParanoidQ7Z3J2.
PhylomeDBQ7Z3J2.

Gene expression databases

ArrayExpressQ7Z3J2.
BgeeQ7Z3J2.
CleanExHS_C16orf62.
GenevestigatorQ7Z3J2.

Family and domain databases

ProtoNetSearch...

Other

ChiTaRSC16orf62. human.
GenomeRNAi57020.
NextBio62774.

Entry information

Entry nameCP062_HUMAN
AccessionPrimary (citable) accession number: Q7Z3J2
Secondary accession number(s): A8K2M1 expand/collapse secondary AC list , O43329, Q69YI1, Q6PDA0, Q7L371, Q86W66, Q8WXA5, Q9H0L7, Q9H7C8
Entry history
Integrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: November 13, 2007
Last modified: May 14, 2014
This is version 67 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

Uncharacterized protein families (UPF)

List of uncharacterized protein family (UPF) entries

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 16

Human chromosome 16: entries, gene names and cross-references to MIM