Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q7Z3J2

- CP062_HUMAN

UniProt

Q7Z3J2 - CP062_HUMAN

Protein

UPF0505 protein C16orf62

Gene

C16orf62

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 69 (01 Oct 2014)
      Sequence version 2 (13 Nov 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    UPF0505 protein C16orf62
    Alternative name(s):
    Esophageal cancer-associated protein
    Gene namesi
    ORF Names:101F10.2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 16

    Organism-specific databases

    HGNCiHGNC:24641. C16orf62.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA162378300.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 963963UPF0505 protein C16orf62PRO_0000311352Add
    BLAST

    Proteomic databases

    MaxQBiQ7Z3J2.
    PaxDbiQ7Z3J2.
    PRIDEiQ7Z3J2.

    PTM databases

    PhosphoSiteiQ7Z3J2.

    Expressioni

    Gene expression databases

    ArrayExpressiQ7Z3J2.
    BgeeiQ7Z3J2.
    CleanExiHS_C16orf62.
    GenevestigatoriQ7Z3J2.

    Organism-specific databases

    HPAiHPA042969.
    HPA053547.

    Interactioni

    Protein-protein interaction databases

    BioGridi121329. 1 interaction.

    Structurei

    3D structure databases

    ProteinModelPortaliQ7Z3J2.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei703 – 71917HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi53 – 7119Ser-richAdd
    BLAST

    Sequence similaritiesi

    Belongs to the UPF0505 family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG327943.
    HOVERGENiHBG107748.
    InParanoidiQ7Z3J2.
    PhylomeDBiQ7Z3J2.

    Family and domain databases

    InterProiIPR029705. UPF0505.
    IPR029706. UPF0505_C16ORF62.
    [Graphical view]
    PANTHERiPTHR13673. PTHR13673. 1 hit.
    PTHR13673:SF2. PTHR13673:SF2. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q7Z3J2-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAVFPWHSRN RNYKAEFASC RLEAVPLEFG DYHPLKPITV TESKTKKVNR    50
    KGSTSSTSSS SSSSVVDPLS SVLDGTDPLS MFAATADPAA LAAAMDSSRR 100
    KRDRDDNSVV GSDFEPWTNK RGEILARYTT TEKLSINLFM GSEKGKAGTA 150
    TLAMSEKVRT RLEELDDFEE GSQKELLNLT QQDYVNRIEE LNQSLKDAWA 200
    SDQKVKALKI VIQCSKLLSD TSVIQFYPSK FVLITDILDT FGKLVYERIF 250
    SMCVDSRSVL PDHFSPENAN DTAKETCLNW FFKIASIREL IPRFYVEASI 300
    LKCNKFLSKT GISECLPRLT CMIRGIGDPL VSVYARAYLC RVGMEVAPHL 350
    KETLNKNFFD FLLTFKQIHG DTVQNQLVVQ GVELPSYLPL YPPAMDWIFQ 400
    CISYHAPEAL LTEMMERCKK LGNNALLLNS VMSAFRAEFI ATRSMDFIGM 450
    IKECDESGFP KHLLFRSLGL NLALADPPES DRLQILNEAW KVITKLKNPQ 500
    DYINCAEVWV EYTCKHFTKR EVNTVLADVI KHMTPDRAFE DSYPQLQLII 550
    KKVIAHFHDF SVLFSVEKFL PFLDMFQKES VRVEVCKCIM DAFIKHQQEP 600
    TKDPVILNAL LHVCKTMHDS VNALTLEDEK RMLSYLINGF IKMVSFGRDF 650
    EQQLSFYVES RSMFCNLEPV LVQLIHSVNR LAMETRKVMK GNHSRKTAAF 700
    VRACVAYCFI TIPSLAGIFT RLNLYLHSGQ VALANQCLSQ ADAFFKAAIS 750
    LVPEVPKMIN IDGKMRPSES FLLEFLCNFF STLLIVPDHP EHGVLFLVRE 800
    LLNVIQDYTW EDNSDEKIRI YTCVLHLLSA MSQETYLYHI DKVDSNDSLY 850
    GGDSKFLAEN NKLCETVMAQ ILEHLKTLAK DEALKRQSSL GLSFFNSILA 900
    HGDLRNNKLN QLSVNLWHLA QRHGCADTRT MVKTLEYIKK QSKQPDMTHL 950
    TELALRLPLQ TRT 963
    Length:963
    Mass (Da):109,563
    Last modified:November 13, 2007 - v2
    Checksum:i5500471390F85683
    GO
    Isoform 2 (identifier: Q7Z3J2-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-122: Missing.
         123-144: EILARYTTTEKLSINLFMGSEK → MPPLGVLVHEKSHLCDVNSFCL
         214-243: CSKLLSDTSVIQFYPSKFVLITDILDTFGK → EE

    Show »
    Length:813
    Mass (Da):93,086
    Checksum:iD5D3817BDA5B0129
    GO

    Sequence cautioni

    The sequence AAH14900.2 differs from that shown. Reason: Erroneous initiation.
    The sequence CAD97869.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti168 – 1681F → S in CAH10399. (PubMed:17974005)Curated
    Sequence conflicti340 – 3401C → G in AAL67806. 1 PublicationCurated
    Sequence conflicti675 – 6751I → V in CAD97869. (PubMed:17974005)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti32 – 321Y → C.1 Publication
    Corresponds to variant rs17854969 [ dbSNP | Ensembl ].
    VAR_037230
    Natural varianti186 – 1861N → I.
    Corresponds to variant rs7206637 [ dbSNP | Ensembl ].
    VAR_037231
    Natural varianti506 – 5061A → V.1 Publication
    Corresponds to variant rs17854970 [ dbSNP | Ensembl ].
    VAR_037232

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 122122Missing in isoform 2. 1 PublicationVSP_029536Add
    BLAST
    Alternative sequencei123 – 14422EILAR…MGSEK → MPPLGVLVHEKSHLCDVNSF CL in isoform 2. 1 PublicationVSP_029537Add
    BLAST
    Alternative sequencei214 – 24330CSKLL…DTFGK → EE in isoform 2. 1 PublicationVSP_029538Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF461052 mRNA. Translation: AAL67806.2.
    AK024693 mRNA. Translation: BAB14965.1.
    AK290286 mRNA. Translation: BAF82975.1.
    BX537867 mRNA. Translation: CAD97869.1. Different initiation.
    AL833428 mRNA. Translation: CAH10399.1.
    BC014900 mRNA. Translation: AAH14900.2. Different initiation.
    BC050464 mRNA. Translation: AAH50464.1.
    BC058845 mRNA. Translation: AAH58845.1.
    AL136744 mRNA. Translation: CAB66678.1.
    AC002550 Genomic DNA. Translation: AAC05806.1.
    RefSeqiNP_064710.4. NM_020314.5.
    UniGeneiHs.654964.

    Genome annotation databases

    EnsembliENST00000251143; ENSP00000251143; ENSG00000103544. [Q7Z3J2-1]
    GeneIDi57020.
    KEGGihsa:57020.
    UCSCiuc002dgp.2. human. [Q7Z3J2-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF461052 mRNA. Translation: AAL67806.2 .
    AK024693 mRNA. Translation: BAB14965.1 .
    AK290286 mRNA. Translation: BAF82975.1 .
    BX537867 mRNA. Translation: CAD97869.1 . Different initiation.
    AL833428 mRNA. Translation: CAH10399.1 .
    BC014900 mRNA. Translation: AAH14900.2 . Different initiation.
    BC050464 mRNA. Translation: AAH50464.1 .
    BC058845 mRNA. Translation: AAH58845.1 .
    AL136744 mRNA. Translation: CAB66678.1 .
    AC002550 Genomic DNA. Translation: AAC05806.1 .
    RefSeqi NP_064710.4. NM_020314.5.
    UniGenei Hs.654964.

    3D structure databases

    ProteinModelPortali Q7Z3J2.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 121329. 1 interaction.

    PTM databases

    PhosphoSitei Q7Z3J2.

    Proteomic databases

    MaxQBi Q7Z3J2.
    PaxDbi Q7Z3J2.
    PRIDEi Q7Z3J2.

    Protocols and materials databases

    DNASUi 57020.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000251143 ; ENSP00000251143 ; ENSG00000103544 . [Q7Z3J2-1 ]
    GeneIDi 57020.
    KEGGi hsa:57020.
    UCSCi uc002dgp.2. human. [Q7Z3J2-1 ]

    Organism-specific databases

    CTDi 57020.
    GeneCardsi GC16P019566.
    H-InvDB HIX0022848.
    HGNCi HGNC:24641. C16orf62.
    HPAi HPA042969.
    HPA053547.
    neXtProti NX_Q7Z3J2.
    PharmGKBi PA162378300.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG327943.
    HOVERGENi HBG107748.
    InParanoidi Q7Z3J2.
    PhylomeDBi Q7Z3J2.

    Miscellaneous databases

    ChiTaRSi C16orf62. human.
    GenomeRNAii 57020.
    NextBioi 62774.

    Gene expression databases

    ArrayExpressi Q7Z3J2.
    Bgeei Q7Z3J2.
    CleanExi HS_C16orf62.
    Genevestigatori Q7Z3J2.

    Family and domain databases

    InterProi IPR029705. UPF0505.
    IPR029706. UPF0505_C16ORF62.
    [Graphical view ]
    PANTHERi PTHR13673. PTHR13673. 1 hit.
    PTHR13673:SF2. PTHR13673:SF2. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. Lu J., Liu Z., Hu G., Wu M., Wang X.
      Submitted (FEB-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
      Tissue: Tongue.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Heart.
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS CYS-32 AND VAL-506.
      Tissue: Pancreas and Uterus.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 396-963 (ISOFORM 1).
      Tissue: Testis.
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] OF 758-963.
    7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiCP062_HUMAN
    AccessioniPrimary (citable) accession number: Q7Z3J2
    Secondary accession number(s): A8K2M1
    , O43329, Q69YI1, Q6PDA0, Q7L371, Q86W66, Q8WXA5, Q9H0L7, Q9H7C8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 13, 2007
    Last sequence update: November 13, 2007
    Last modified: October 1, 2014
    This is version 69 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 16
      Human chromosome 16: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families
    5. Uncharacterized protein families (UPF)
      List of uncharacterized protein family (UPF) entries

    External Data

    Dasty 3