Q7Z3J2 (CP062_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 62.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: UPF0505 protein C16orf62 Alternative name(s): Esophageal cancer-associated protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 963 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subcellular location | Membrane; Single-pass membrane protein Potential. |
| Sequence similarities | Belongs to the UPF0505 family. |
| Sequence caution | The sequence AAH14900.2 differs from that shown. Reason: Erroneous initiation. The sequence CAD97869.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q7Z3J2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q7Z3J2-2) The sequence of this isoform differs from the canonical sequence as follows: 1-122: Missing. 123-144: EILARYTTTEKLSINLFMGSEK → MPPLGVLVHEKSHLCDVNSFCL 214-243: CSKLLSDTSVIQFYPSKFVLITDILDTFGK → EE |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 963 | 963 | UPF0505 protein C16orf62 | PRO_0000311352 | |||||
Regions | |||||||||
| Transmembrane | 703 – 719 | 17 | Helical; Potential | ||||||
| Compositional bias | 53 – 71 | 19 | Ser-rich | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 122 | 122 | Missing in isoform 2. | VSP_029536 | |||||
| Alternative sequence | 123 – 144 | 22 | EILAR…MGSEK → MPPLGVLVHEKSHLCDVNSF CL in isoform 2. | VSP_029537 | |||||
| Alternative sequence | 214 – 243 | 30 | CSKLL…DTFGK → EE in isoform 2. | VSP_029538 | |||||
| Natural variant | 32 | 1 | Y → C. Ref.4 Corresponds to variant rs17854969 [ dbSNP | Ensembl ]. | VAR_037230 | |||||
| Natural variant | 186 | 1 | N → I. Corresponds to variant rs7206637 [ dbSNP | Ensembl ]. | VAR_037231 | |||||
| Natural variant | 506 | 1 | A → V. Ref.4 Corresponds to variant rs17854970 [ dbSNP | Ensembl ]. | VAR_037232 | |||||
Experimental info | |||||||||
| Sequence conflict | 168 | 1 | F → S in CAH10399. Ref.3 | ||||||
| Sequence conflict | 340 | 1 | C → G in AAL67806. Ref.1 | ||||||
| Sequence conflict | 675 | 1 | I → V in CAD97869. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF461052 mRNA. Translation: AAL67806.2. AK024693 mRNA. Translation: BAB14965.1. AK290286 mRNA. Translation: BAF82975.1. BX537867 mRNA. Translation: CAD97869.1. Different initiation. AL833428 mRNA. Translation: CAH10399.1. BC014900 mRNA. Translation: AAH14900.2. Different initiation. BC050464 mRNA. Translation: AAH50464.1. BC058845 mRNA. Translation: AAH58845.1. AL136744 mRNA. Translation: CAB66678.1. AC002550 Genomic DNA. Translation: AAC05806.1. |
| IPI | IPI00872797. IPI01018160. |
| RefSeq | NP_064710.4. NM_020314.5. |
| UniGene | Hs.654964. |
3D structure databases | |
| ProteinModelPortal | Q7Z3J2. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q7Z3J2. |
Polymorphism databases | |
| DMDM | 160380702. |
Proteomic databases | |
| PaxDb | Q7Z3J2. |
| PRIDE | Q7Z3J2. |
Protocols and materials databases | |
| DNASU | 57020. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000251143; ENSP00000251143; ENSG00000103544. |
| GeneID | 57020. |
| KEGG | hsa:57020. |
| UCSC | uc002dgp.2. human. |
Organism-specific databases | |
| CTD | 57020. |
| GeneCards | GC16P019566. |
| H-InvDB | HIX0022848. |
| HGNC | HGNC:24641. C16orf62. |
| HPA | HPA042969. |
| neXtProt | NX_Q7Z3J2. |
| PharmGKB | PA162378300. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG327943. |
| HOVERGEN | HBG107748. |
| InParanoid | Q7Z3J2. |
| PhylomeDB | Q7Z3J2. |
Gene expression databases | |
| ArrayExpress | Q7Z3J2. |
| Bgee | Q7Z3J2. |
| CleanEx | HS_C16orf62. |
| Genevestigator | Q7Z3J2. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| ChiTaRS | C16orf62. human. |
| GenomeRNAi | 57020. |
| NextBio | 62774. |
Entry information
| Entry name | CP062_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q7Z3J2 Secondary accession number(s): A8K2M1 Q9H7C8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Uncharacterized protein families (UPF) List of uncharacterized protein family (UPF) entries |
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
