SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q7Z3J2

- CP062_HUMAN

UniProt

Q7Z3J2 - CP062_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

UPF0505 protein C16orf62

Gene
C16orf62, 101F10.2
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
UPF0505 protein C16orf62
Alternative name(s):
Esophageal cancer-associated protein
Gene namesi
ORF Names:101F10.2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 16

Organism-specific databases

HGNCiHGNC:24641. C16orf62.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei703 – 71917Helical; Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162378300.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 963963UPF0505 protein C16orf62PRO_0000311352Add
BLAST

Proteomic databases

MaxQBiQ7Z3J2.
PaxDbiQ7Z3J2.
PRIDEiQ7Z3J2.

PTM databases

PhosphoSiteiQ7Z3J2.

Expressioni

Gene expression databases

ArrayExpressiQ7Z3J2.
BgeeiQ7Z3J2.
CleanExiHS_C16orf62.
GenevestigatoriQ7Z3J2.

Organism-specific databases

HPAiHPA042969.
HPA053547.

Interactioni

Protein-protein interaction databases

BioGridi121329. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ7Z3J2.

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi53 – 7119Ser-richAdd
BLAST

Sequence similaritiesi

Belongs to the UPF0505 family.

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG327943.
HOVERGENiHBG107748.
InParanoidiQ7Z3J2.
PhylomeDBiQ7Z3J2.

Family and domain databases

InterProiIPR029705. UPF0505.
IPR029706. UPF0505_C16ORF62.
[Graphical view]
PANTHERiPTHR13673. PTHR13673. 1 hit.
PTHR13673:SF2. PTHR13673:SF2. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q7Z3J2-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAVFPWHSRN RNYKAEFASC RLEAVPLEFG DYHPLKPITV TESKTKKVNR    50
KGSTSSTSSS SSSSVVDPLS SVLDGTDPLS MFAATADPAA LAAAMDSSRR 100
KRDRDDNSVV GSDFEPWTNK RGEILARYTT TEKLSINLFM GSEKGKAGTA 150
TLAMSEKVRT RLEELDDFEE GSQKELLNLT QQDYVNRIEE LNQSLKDAWA 200
SDQKVKALKI VIQCSKLLSD TSVIQFYPSK FVLITDILDT FGKLVYERIF 250
SMCVDSRSVL PDHFSPENAN DTAKETCLNW FFKIASIREL IPRFYVEASI 300
LKCNKFLSKT GISECLPRLT CMIRGIGDPL VSVYARAYLC RVGMEVAPHL 350
KETLNKNFFD FLLTFKQIHG DTVQNQLVVQ GVELPSYLPL YPPAMDWIFQ 400
CISYHAPEAL LTEMMERCKK LGNNALLLNS VMSAFRAEFI ATRSMDFIGM 450
IKECDESGFP KHLLFRSLGL NLALADPPES DRLQILNEAW KVITKLKNPQ 500
DYINCAEVWV EYTCKHFTKR EVNTVLADVI KHMTPDRAFE DSYPQLQLII 550
KKVIAHFHDF SVLFSVEKFL PFLDMFQKES VRVEVCKCIM DAFIKHQQEP 600
TKDPVILNAL LHVCKTMHDS VNALTLEDEK RMLSYLINGF IKMVSFGRDF 650
EQQLSFYVES RSMFCNLEPV LVQLIHSVNR LAMETRKVMK GNHSRKTAAF 700
VRACVAYCFI TIPSLAGIFT RLNLYLHSGQ VALANQCLSQ ADAFFKAAIS 750
LVPEVPKMIN IDGKMRPSES FLLEFLCNFF STLLIVPDHP EHGVLFLVRE 800
LLNVIQDYTW EDNSDEKIRI YTCVLHLLSA MSQETYLYHI DKVDSNDSLY 850
GGDSKFLAEN NKLCETVMAQ ILEHLKTLAK DEALKRQSSL GLSFFNSILA 900
HGDLRNNKLN QLSVNLWHLA QRHGCADTRT MVKTLEYIKK QSKQPDMTHL 950
TELALRLPLQ TRT 963
Length:963
Mass (Da):109,563
Last modified:November 13, 2007 - v2
Checksum:i5500471390F85683
GO
Isoform 2 (identifier: Q7Z3J2-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-122: Missing.
     123-144: EILARYTTTEKLSINLFMGSEK → MPPLGVLVHEKSHLCDVNSFCL
     214-243: CSKLLSDTSVIQFYPSKFVLITDILDTFGK → EE

Show »
Length:813
Mass (Da):93,086
Checksum:iD5D3817BDA5B0129
GO

Sequence cautioni

The sequence AAH14900.2 differs from that shown. Reason: Erroneous initiation.
The sequence CAD97869.1 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti32 – 321Y → C.1 Publication
Corresponds to variant rs17854969 [ dbSNP | Ensembl ].
VAR_037230
Natural varianti186 – 1861N → I.
Corresponds to variant rs7206637 [ dbSNP | Ensembl ].
VAR_037231
Natural varianti506 – 5061A → V.1 Publication
Corresponds to variant rs17854970 [ dbSNP | Ensembl ].
VAR_037232

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 122122Missing in isoform 2. VSP_029536Add
BLAST
Alternative sequencei123 – 14422EILAR…MGSEK → MPPLGVLVHEKSHLCDVNSF CL in isoform 2. VSP_029537Add
BLAST
Alternative sequencei214 – 24330CSKLL…DTFGK → EE in isoform 2. VSP_029538Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti168 – 1681F → S in CAH10399. 1 Publication
Sequence conflicti340 – 3401C → G in AAL67806. 1 Publication
Sequence conflicti675 – 6751I → V in CAD97869. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF461052 mRNA. Translation: AAL67806.2.
AK024693 mRNA. Translation: BAB14965.1.
AK290286 mRNA. Translation: BAF82975.1.
BX537867 mRNA. Translation: CAD97869.1. Different initiation.
AL833428 mRNA. Translation: CAH10399.1.
BC014900 mRNA. Translation: AAH14900.2. Different initiation.
BC050464 mRNA. Translation: AAH50464.1.
BC058845 mRNA. Translation: AAH58845.1.
AL136744 mRNA. Translation: CAB66678.1.
AC002550 Genomic DNA. Translation: AAC05806.1.
RefSeqiNP_064710.4. NM_020314.5.
UniGeneiHs.654964.

Genome annotation databases

EnsembliENST00000251143; ENSP00000251143; ENSG00000103544. [Q7Z3J2-1]
GeneIDi57020.
KEGGihsa:57020.
UCSCiuc002dgp.2. human. [Q7Z3J2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF461052 mRNA. Translation: AAL67806.2 .
AK024693 mRNA. Translation: BAB14965.1 .
AK290286 mRNA. Translation: BAF82975.1 .
BX537867 mRNA. Translation: CAD97869.1 . Different initiation.
AL833428 mRNA. Translation: CAH10399.1 .
BC014900 mRNA. Translation: AAH14900.2 . Different initiation.
BC050464 mRNA. Translation: AAH50464.1 .
BC058845 mRNA. Translation: AAH58845.1 .
AL136744 mRNA. Translation: CAB66678.1 .
AC002550 Genomic DNA. Translation: AAC05806.1 .
RefSeqi NP_064710.4. NM_020314.5.
UniGenei Hs.654964.

3D structure databases

ProteinModelPortali Q7Z3J2.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 121329. 1 interaction.

PTM databases

PhosphoSitei Q7Z3J2.

Proteomic databases

MaxQBi Q7Z3J2.
PaxDbi Q7Z3J2.
PRIDEi Q7Z3J2.

Protocols and materials databases

DNASUi 57020.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000251143 ; ENSP00000251143 ; ENSG00000103544 . [Q7Z3J2-1 ]
GeneIDi 57020.
KEGGi hsa:57020.
UCSCi uc002dgp.2. human. [Q7Z3J2-1 ]

Organism-specific databases

CTDi 57020.
GeneCardsi GC16P019566.
H-InvDB HIX0022848.
HGNCi HGNC:24641. C16orf62.
HPAi HPA042969.
HPA053547.
neXtProti NX_Q7Z3J2.
PharmGKBi PA162378300.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG327943.
HOVERGENi HBG107748.
InParanoidi Q7Z3J2.
PhylomeDBi Q7Z3J2.

Miscellaneous databases

ChiTaRSi C16orf62. human.
GenomeRNAii 57020.
NextBioi 62774.

Gene expression databases

ArrayExpressi Q7Z3J2.
Bgeei Q7Z3J2.
CleanExi HS_C16orf62.
Genevestigatori Q7Z3J2.

Family and domain databases

InterProi IPR029705. UPF0505.
IPR029706. UPF0505_C16ORF62.
[Graphical view ]
PANTHERi PTHR13673. PTHR13673. 1 hit.
PTHR13673:SF2. PTHR13673:SF2. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Lu J., Liu Z., Hu G., Wu M., Wang X.
    Submitted (FEB-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    Tissue: Tongue.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Heart.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS CYS-32 AND VAL-506.
    Tissue: Pancreas and Uterus.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 396-963 (ISOFORM 1).
    Tissue: Testis.
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] OF 758-963.
  7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiCP062_HUMAN
AccessioniPrimary (citable) accession number: Q7Z3J2
Secondary accession number(s): A8K2M1
, O43329, Q69YI1, Q6PDA0, Q7L371, Q86W66, Q8WXA5, Q9H0L7, Q9H7C8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: November 13, 2007
Last modified: September 3, 2014
This is version 68 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families
  5. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries

External Data

Dasty 3

Similar proteinsi