Q7Z333 (SETX_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 103.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Probable helicase senataxin EC=3.6.4.- Alternative name(s): Amyotrophic lateral sclerosis 4 protein SEN1 homolog | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 2677 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Probable helicase, which may be involved in RNA maturation By similarity. Involved in DNA double-strand breaks damage response generated by oxidative stress. Ref.1 Ref.9 |
| Subcellular location | Nucleus › nucleoplasm. Nucleus › nucleolus. Cytoplasm. Note: May be detected in the nucleolus only in cycling cells By similarity. Most abundant in the nucleus. Detected in granules. Colocalized in cycling cells with FBL in the nucleolus. Ref.9 Ref.16 |
| Tissue specificity | Highly expressed in skeletal muscle. Expressed in heart, fibroblast, placenta and liver. Weakly expressed in brain and lung. Expressed in the cortex of the kidney (highly expressed in tubular epithelial cells but low expression in the glomerulus). Ref.1 Ref.9 Ref.15 Ref.16 |
| Involvement in disease | Spinocerebellar ataxia, autosomal recessive, 1 (SCAR1) [MIM:606002]: Spinocerebellar ataxia is a clinically and genetically heterogeneous group of cerebellar disorders. Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to degeneration of the cerebellum with variable involvement of the brainstem and spinal cord. SCAR1 is an autosomal recessive form associated with peripheral neuropathy and elevated serum alpha-fetoprotein, immunoglobulins and, less commonly, creatine kinase levels. Some SCAR1 patients manifest oculomotor apraxia. Amyotrophic lateral sclerosis 4 (ALS4) [MIM:602433]: A form of amyotrophic lateral sclerosis with childhood- or adolescent-onset, and characterized by slow disease progression and the sparing of bulbar and respiratory muscles. Amyotrophic lateral sclerosis is a neurodegenerative disorder affecting upper motor neurons in the brain and lower motor neurons in the brain stem and spinal cord, resulting in fatal paralysis. Sensory abnormalities are absent. The pathologic hallmarks of the disease include pallor of the corticospinal tract due to loss of motor neurons, presence of ubiquitin-positive inclusions within surviving motor neurons, and deposition of pathologic aggregates. The etiology of amyotrophic lateral sclerosis is likely to be multifactorial, involving both genetic and environmental factors. The disease is inherited in 5-10% of the cases. |
| Sequence similarities | Belongs to the DNA2/NAM7 helicase family. |
| Sequence caution | The sequence BAA91701.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence BAB14299.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence CAD97857.1 differs from that shown. Reason: Frameshift at position 1626. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q7Z333-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 3 (identifier: Q7Z333-3) The sequence of this isoform differs from the canonical sequence as follows: 2367-2399: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q7Z333-4) The sequence of this isoform differs from the canonical sequence as follows: 2429-2429: M → MQLLPRSFCVHVNHSPFFSPEPKYLHWALK | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 2677 | 2677 | Probable helicase senataxin | PRO_0000080724 | |||||
Regions | |||||||||
| Nucleotide binding | 1963 – 1970 | 8 | ATP Potential | ||||||
| Region | 2661 – 2677 | 17 | Necessary for nuclear localization | ||||||
| Coiled coil | 2105 – 2136 | 32 | Potential | ||||||
| Motif | 2070 – 2087 | 18 | Bipartite nuclear localization signal Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 615 | 1 | Phosphoserine Ref.10 | ||||||
| Modified residue | 1017 | 1 | Phosphoserine Ref.7 Ref.10 Ref.11 Ref.12 Ref.14 | ||||||
| Modified residue | 1019 | 1 | Phosphoserine Ref.7 Ref.10 Ref.11 Ref.12 Ref.14 | ||||||
| Modified residue | 1621 | 1 | Phosphoserine Ref.8 | ||||||
Natural variations | |||||||||
| Alternative sequence | 2367 – 2399 | 33 | Missing in isoform 3. | VSP_017124 | |||||
| Alternative sequence | 2429 | 1 | M → MQLLPRSFCVHVNHSPFFSP EPKYLHWALK in isoform 4. | VSP_028826 | |||||
| Natural variant | 3 | 1 | T → I in ALS4; heterozygous. Corresponds to variant rs28941475 [ dbSNP | Ensembl ]. | VAR_018776 | |||||
| Natural variant | 274 | 1 | M → I in SCAR1. Ref.17 | VAR_036646 | |||||
| Natural variant | 305 | 1 | W → C in SCAR1. Ref.1 | VAR_018777 | |||||
| Natural variant | 332 | 1 | R → W in SCAR1. Ref.1 Corresponds to variant rs29001665 [ dbSNP | Ensembl ]. | VAR_018778 | |||||
| Natural variant | 389 | 1 | L → S in ALS4. Ref.15 Corresponds to variant rs29001584 [ dbSNP | Ensembl ]. | VAR_018779 | |||||
| Natural variant | 413 | 1 | P → L in SCAR1. Ref.1 | VAR_018780 | |||||
| Natural variant | 603 | 1 | N → D in SCAR1; atypical; associated with K-653. Ref.18 | VAR_036647 | |||||
| Natural variant | 653 | 1 | Q → K in SCAR1; atypical; associated with D-603. Ref.18 | VAR_036648 | |||||
| Natural variant | 660 | 1 | A → G. Corresponds to variant rs882709 [ dbSNP | Ensembl ]. | VAR_018781 | |||||
| Natural variant | 1061 | 1 | P → L. Corresponds to variant rs12352982 [ dbSNP | Ensembl ]. | VAR_018782 | |||||
| Natural variant | 1152 | 1 | F → C. Ref.1 Corresponds to variant rs3739922 [ dbSNP | Ensembl ]. | VAR_018783 | |||||
| Natural variant | 1192 | 1 | D → E. Ref.2 Ref.4 Corresponds to variant rs1185193 [ dbSNP | Ensembl ]. | VAR_018784 | |||||
| Natural variant | 1221 | 1 | K → N. Corresponds to variant rs12344006 [ dbSNP | Ensembl ]. | VAR_056208 | |||||
| Natural variant | 1252 | 1 | G → R. Ref.2 Ref.4 Corresponds to variant rs1183768 [ dbSNP | Ensembl ]. | VAR_018785 | |||||
| Natural variant | 1294 | 1 | R → C in SCAR1. Ref.17 | VAR_036649 | |||||
| Natural variant | 1331 | 1 | P → L. Corresponds to variant rs11243731 [ dbSNP | Ensembl ]. | VAR_018786 | |||||
| Natural variant | 1386 | 1 | I → V. Ref.2 Ref.4 Corresponds to variant rs543573 [ dbSNP | Ensembl ]. | VAR_018787 | |||||
| Natural variant | 1756 | 1 | F → S in SCAR1; heterozygous in a British family. Ref.1 | VAR_018788 | |||||
| Natural variant | 1855 | 1 | T → A. Ref.4 Corresponds to variant rs2296871 [ dbSNP | Ensembl ]. | VAR_018789 | |||||
| Natural variant | 1855 | 1 | T → P. Corresponds to variant rs2296871 [ dbSNP | Ensembl ]. | VAR_059458 | |||||
| Natural variant | 2136 | 1 | R → H in ALS4. Ref.15 | VAR_018790 | |||||
| Natural variant | 2213 | 1 | P → L in SCAR1. Ref.1 Corresponds to variant rs28940290 [ dbSNP | Ensembl ]. | VAR_018791 | |||||
| Natural variant | 2368 | 1 | P → R in SCAR1. Ref.16 | VAR_036650 | |||||
| Natural variant | 2587 | 1 | I → V. Ref.2 Ref.4 Ref.6 Corresponds to variant rs1056899 [ dbSNP | Ensembl ]. | VAR_018792 | |||||
| Natural variant | 2612 | 1 | S → G. Ref.4 Corresponds to variant rs3739927 [ dbSNP | Ensembl ]. | VAR_018793 | |||||
Experimental info | |||||||||
| Sequence conflict | 657 | 1 | L → S in CAD98045. Ref.2 | ||||||
| Sequence conflict | 866 | 1 | E → G in CAD97857. Ref.2 | ||||||
| Sequence conflict | 894 | 1 | K → E in CAH18105. Ref.2 | ||||||
| Sequence conflict | 895 | 1 | E → G in CAD98045. Ref.2 | ||||||
| Sequence conflict | 895 | 1 | E → G in BAA31600. Ref.5 | ||||||
| Sequence conflict | 977 | 1 | P → T in CAD97857. Ref.2 | ||||||
| Sequence conflict | 1073 | 1 | F → C in CAD97857. Ref.2 | ||||||
| Sequence conflict | 1276 | 1 | Q → E in BAA31600. Ref.5 | ||||||
| Sequence conflict | 1593 | 1 | R → G in CAH18105. Ref.2 | ||||||
| Sequence conflict | 1626 | 1 | N → K in CAD97857. Ref.2 | ||||||
| Sequence conflict | 1634 | 1 | I → V in CAH18105. Ref.2 | ||||||
| Sequence conflict | 1648 – 1650 | 3 | PVG → TRP in AAH32622. Ref.4 | ||||||
| Sequence conflict | 1725 | 1 | L → P in CAD97857. Ref.2 | ||||||
| Sequence conflict | 1826 | 1 | E → K in CAD98045. Ref.2 | ||||||
| Sequence conflict | 1826 | 1 | E → K in AAH32600. Ref.4 | ||||||
| Sequence conflict | 1826 | 1 | E → K in AAH32622. Ref.4 | ||||||
| Sequence conflict | 1867 | 1 | F → L in AAR13367. Ref.1 | ||||||
| Sequence conflict | 1867 | 1 | F → L in AAH32622. Ref.4 | ||||||
| Sequence conflict | 2078 | 1 | Q → L in CAD97857. Ref.2 | ||||||
| Sequence conflict | 2324 | 1 | M → E in BAB14299. Ref.6 | ||||||
| Sequence conflict | 2423 | 1 | G → E in CAH18105. Ref.2 | ||||||
| Sequence conflict | 2458 | 1 | D → G in CAH18105. Ref.2 | ||||||
| Sequence conflict | 2539 | 1 | P → S in CAD97857. Ref.2 | ||||||
| Sequence conflict | 2565 | 1 | H → R in CAD97857. Ref.2 | ||||||
| Sequence conflict | 2577 | 1 | F → L in BAB14299. Ref.6 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Senataxin, the ortholog of a yeast RNA helicase, is mutant in ataxia-ocular apraxia 2." Moreira M.-C., Klur S., Watanabe M., Nemeth A.H., Le Ber I., Moniz J.-C., Tranchant C., Aubourg P., Tazir M., Schoels L., Pandolfo M., Schulz J.B., Pouget J., Calvas P., Shizuka-Ikeda M., Shoji M., Tanaka M., Izatt L. Koenig M.Nat. Genet. 36:225-227(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, VARIANT CYS-1152, VARIANTS SCAR1 CYS-305; TRP-332; LEU-413; SER-1756 AND LEU-2213. |
| [2] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 447-2677 (ISOFORM 3), VARIANTS GLU-1192; ARG-1252; VAL-1386 AND VAL-2587. Tissue: Amygdala, Fetal kidney and Retina. |
| [3] | "DNA sequence and analysis of human chromosome 9." Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. Dunham I.Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS GLU-1192; ARG-1252; VAL-1386; ALA-1855; VAL-2587 AND GLY-2612. Tissue: Peripheral nerve, Retinoblastoma, Testis and Uterus. |
| [5] | "Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro." Ishikawa K., Nagase T., Suyama M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:169-176(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 15-2677 (ISOFORM 1). Tissue: Brain. |
| [6] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1762-2677 (ISOFORM 1), VARIANT VAL-2587. Tissue: Teratocarcinoma. |
| [7] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1017 AND SER-1019, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1621, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "Senataxin, defective in ataxia oculomotor apraxia type 2, is involved in the defense against oxidative DNA damage." Suraweera A., Becherel O.J., Chen P., Rundle N., Woods R., Nakamura J., Gatei M., Criscuolo C., Filla A., Chessa L., Fusser M., Epe B., Gueven N., Lavin M.F. J. Cell Biol. 177:969-979(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION. |
| [10] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-615; SER-1017 AND SER-1019, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [11] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1017 AND SER-1019, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [12] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1017 AND SER-1019, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [13] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [14] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1017 AND SER-1019, MASS SPECTROMETRY. |
| [15] | "DNA/RNA helicase gene mutations in a form of juvenile amyotrophic lateral sclerosis (ALS4)." Chen Y.-Z., Bennett C.L., Huynh H.M., Blair I.P., Puls I., Irobi J., Dierick I., Abel A., Kennerson M.L., Rabin B.A., Nicholson G.A., Auer-Grumbach M., Wagner K., De Jonghe P., Griffin J.W., Fischbeck K.H., Timmerman V., Cornblath D.R., Chance P.F. Am. J. Hum. Genet. 74:1128-1135(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS ALS4 SER-389 AND HIS-2136, TISSUE SPECIFICITY. |
| [16] | "Senataxin, the yeast Sen1p orthologue: characterization of a unique protein in which recessive mutations cause ataxia and dominant mutations cause motor neuron disease." Chen Y.-Z., Hashemi S.H., Anderson S.K., Huang Y., Moreira M.-C., Lynch D.R., Glass I.A., Chance P.F., Bennett C.L. Neurobiol. Dis. 23:97-108(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT SCAR1 ARG-2368, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [17] | "Autosomal recessive ataxia with peripheral neuropathy and elevated AFP: novel mutations in SETX." Asaka T., Yokoji H., Ito J., Yamaguchi K., Matsushima A. Neurology 66:1580-1581(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS SCAR1 ILE-274 AND CYS-1294. |
| [18] | "In cis autosomal dominant mutation of Senataxin associated with tremor/ataxia syndrome." Bassuk A.G., Chen Y.Z., Batish S.D., Nagan N., Opal P., Chance P.F., Bennett C.L. Neurogenetics 8:45-49(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS SCAR1 ASP-603 AND LYS-653. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY362728 mRNA. Translation: AAR13367.1. BX537849 mRNA. Translation: CAD97857.1. Frameshift. BX538166 mRNA. Translation: CAD98045.1. CR749249 mRNA. Translation: CAH18105.1. AL159997, AL353701 Genomic DNA. Translation: CAI40854.1. AL159997 Genomic DNA. Translation: CAI40857.1. AL353701, AL159997 Genomic DNA. Translation: CAM14151.1. BC032600 mRNA. Translation: AAH32600.2. BC032622 mRNA. Translation: AAH32622.2. BC078166 mRNA. Translation: AAH78166.1. BC106017 mRNA. Translation: AAI06018.1. BC137350 mRNA. Translation: AAI37351.1. AB014525 mRNA. Translation: BAA31600.2. AK001456 mRNA. Translation: BAA91701.1. Different initiation. AK022902 mRNA. Translation: BAB14299.1. Different initiation. |
| IPI | IPI00142538. IPI00646645. IPI00719643. |
| RefSeq | NP_055861.3. NM_015046.5. |
| UniGene | Hs.460317. |
3D structure databases | |
| ProteinModelPortal | Q7Z333. |
| SMR | Q7Z333. Positions 1958-2449. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q7Z333. 5 interactions. |
PTM databases | |
| PhosphoSite | Q7Z333. |
Polymorphism databases | |
| DMDM | 296453021. |
Proteomic databases | |
| PaxDb | Q7Z333. |
| PRIDE | Q7Z333. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000224140; ENSP00000224140; ENSG00000107290. ENST00000372169; ENSP00000361242; ENSG00000107290. ENST00000393220; ENSP00000376913; ENSG00000107290. ENST00000436441; ENSP00000409143; ENSG00000107290. |
| GeneID | 23064. |
| KEGG | hsa:23064. |
| UCSC | uc004cbj.3. human. uc004cbk.3. human. uc010mzt.3. human. |
Organism-specific databases | |
| CTD | 23064. |
| GeneCards | GC09M135136. |
| HGNC | HGNC:445. SETX. |
| HPA | HPA024105. |
| MIM | 602433. phenotype. 606002. phenotype. 608465. gene. |
| neXtProt | NX_Q7Z333. |
| Orphanet | 803. Amyotrophic lateral sclerosis. 64753. Spinocerebellar ataxia with axonal neuropathy type 2. |
| PharmGKB | PA24751. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG1112. |
| HOVERGEN | HBG108476. |
| InParanoid | Q7Z333. |
| KO | K10706. |
| OMA | RLINHFE. |
| OrthoDB | EOG4XWFWX. |
| PhylomeDB | Q7Z333. |
Gene expression databases | |
| ArrayExpress | Q7Z333. |
| Bgee | Q7Z333. |
| Genevestigator | Q7Z333. |
| GermOnline | ENSG00000107290. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR026121. Senataxin. [Graphical view] |
| PANTHER | PTHR10887:SF15. PTHR10887:SF15. 1 hit. |
| ProtoNet | Search... |
Other | |
| ChiTaRS | SETX. human. |
| GenomeRNAi | 23064. |
| NextBio | 44145. |
| SOURCE | Search... |
Entry information
| Entry name | SETX_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q7Z333 Secondary accession number(s): A2A396 Q9NVP9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
