Q7Z309 (F122B_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 71.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein FAM122B | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 247 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Post-translational modification | Isoform 3 and isoform 4 are phosphorylated on Ser-62 and Ser-64. |
| Sequence similarities | Belongs to the FAM122 family. |
| Sequence caution | The sequence AAH32419.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q7Z309-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q7Z309-2) The sequence of this isoform differs from the canonical sequence as follows: 146-146: S → SS | ||||||
| Isoform 3 (identifier: Q7Z309-3) The sequence of this isoform differs from the canonical sequence as follows: 59-59: L → LLLSSSPNRIPSSRLHQIKR | ||||||
| Note: Contains a phosphoserine at position 63. | ||||||
| Isoform 4 (identifier: Q7Z309-4) The sequence of this isoform differs from the canonical sequence as follows: 59-59: L → LLLSSSPNRIPSSRLHQIKR 200-247: CSDILDGSSSSSGLSSDPLAKGSATAESPVACSNSCSSFILMDDLSPK → WWCYQGEEIPALTRCVEHLQMNE | ||||||
| Note: Contains a phosphoserine at position 63. | ||||||
| Isoform 5 (identifier: Q7Z309-5) The sequence of this isoform differs from the canonical sequence as follows: 1-53: Missing. 146-146: S → SS 200-247: CSDILDGSSSSSGLSSDPLAKGSATAESPVACSNSCSSFILMDDLSPK → WWCYQGEEIPALTRCVEHLQMNE | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 247 | 247 | Protein FAM122B | PRO_0000254545 | |||||
Regions | |||||||||
| Compositional bias | 195 – 237 | 43 | Ser-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 25 | 1 | Phosphoserine Ref.10 | ||||||
| Modified residue | 33 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 50 | 1 | Phosphoserine Ref.11 Ref.12 | ||||||
| Modified residue | 58 | 1 | Phosphoserine Ref.11 | ||||||
| Modified residue | 112 | 1 | Phosphothreonine Ref.9 | ||||||
| Modified residue | 115 | 1 | Phosphoserine Ref.7 Ref.8 Ref.9 Ref.10 Ref.11 Ref.12 | ||||||
| Modified residue | 119 | 1 | Phosphoserine Ref.7 Ref.9 Ref.10 Ref.12 | ||||||
| Modified residue | 137 | 1 | Phosphoserine Ref.9 Ref.10 Ref.11 | ||||||
| Modified residue | 141 | 1 | Phosphoserine Ref.9 Ref.10 Ref.11 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 53 | 53 | Missing in isoform 5. | VSP_021215 | |||||
| Alternative sequence | 59 | 1 | L → LLLSSSPNRIPSSRLHQIKR in isoform 3 and isoform 4. | VSP_021216 | |||||
| Alternative sequence | 146 | 1 | S → SS in isoform 2 and isoform 5. | VSP_021217 | |||||
| Alternative sequence | 200 – 247 | 48 | CSDIL…DLSPK → WWCYQGEEIPALTRCVEHLQ MNE in isoform 4 and isoform 5. | VSP_021218 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 4 AND 5). Tissue: Testis. |
| [2] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Fetal kidney. |
| [3] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Pancreas, Placenta and Skin. |
| [6] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [7] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-115 AND SER-119, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-33 AND SER-115, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-112; SER-115; SER-119; SER-137 AND SER-141, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-25; SER-115; SER-119; SER-137 AND SER-141, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [11] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-50; SER-58; SER-115; SER-137 AND SER-141, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-63 (ISOFORMS 3 AND 4), MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-50; SER-115 AND SER-119, MASS SPECTROMETRY. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK124650 mRNA. Translation: BAC85918.1. AK124940 mRNA. Translation: BAC85999.1. AK125991 mRNA. Translation: BAC86380.1. AK292517 mRNA. Translation: BAF85206.1. BX538218 mRNA. Translation: CAD98073.1. AL672032, AL691477 Genomic DNA. Translation: CAI40040.1. AL691477, AL672032 Genomic DNA. Translation: CAI42398.1. CH471107 Genomic DNA. Translation: EAX11751.1. BC019221 mRNA. Translation: AAH19221.1. BC032419 mRNA. Translation: AAH32419.1. Different initiation. BC110846 mRNA. Translation: AAI10847.1. |
| IPI | IPI00152151. IPI00446175. IPI00749302. IPI00792682. IPI00794590. |
| RefSeq | NP_001160071.1. NM_001166599.2. NP_001160072.1. NM_001166600.2. NP_001164227.1. NM_001170756.1. NP_001164228.1. NM_001170757.1. NP_660327.2. NM_145284.5. |
| UniGene | Hs.404706. |
3D structure databases | |
| ProteinModelPortal | Q7Z309. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q7Z309. 4 interactions. |
| STRING | 9606.ENSP00000298090. |
PTM databases | |
| PhosphoSite | Q7Z309. |
Proteomic databases | |
| PaxDb | Q7Z309. |
| PRIDE | Q7Z309. |
Protocols and materials databases | |
| DNASU | 159090. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000298090; ENSP00000298090; ENSG00000156504. ENST00000343004; ENSP00000339207; ENSG00000156504. ENST00000370790; ENSP00000359826; ENSG00000156504. ENST00000486347; ENSP00000419592; ENSG00000156504. |
| GeneID | 159090. |
| KEGG | hsa:159090. |
| UCSC | uc004exq.3. human. uc004exr.3. human. uc004ext.3. human. uc004exv.3. human. uc022cek.1. human. |
Organism-specific databases | |
| CTD | 159090. |
| GeneCards | GC0XM133903. |
| HGNC | HGNC:30490. FAM122B. |
| HPA | HPA000266. |
| neXtProt | NX_Q7Z309. |
| PharmGKB | PA128394763. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG304862. |
| HOVERGEN | HBG073694. |
| OMA | EEGMDMM. |
| OrthoDB | EOG4BK552. |
Gene expression databases | |
| ArrayExpress | Q7Z309. |
| Bgee | Q7Z309. |
| CleanEx | HS_FAM122B. |
| Genevestigator | Q7Z309. |
| GermOnline | ENSG00000156504. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR026716. FAM122. [Graphical view] |
| PANTHER | PTHR22227. PTHR22227. 1 hit. |
| ProtoNet | Search... |
Other | |
| ChiTaRS | FAM122B. human. |
| GenomeRNAi | 159090. |
| NextBio | 87868. |
Entry information
| Entry name | F122B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q7Z309 Secondary accession number(s): A8K902 Q8TB75 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with
