SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q7Z309

- F122B_HUMAN

UniProt

Q7Z309 - F122B_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protein FAM122B

Gene
FAM122B
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Protein FAM122B
Gene namesi
Name:FAM122B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome X

Organism-specific databases

HGNCiHGNC:30490. FAM122B.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA128394763.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed1 Publication
Chaini2 – 247246Protein FAM122BPRO_0000254545Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanine1 Publication
Modified residuei25 – 251Phosphoserine1 Publication
Modified residuei33 – 331Phosphoserine1 Publication
Modified residuei50 – 501Phosphoserine2 Publications
Modified residuei58 – 581Phosphoserine1 Publication
Modified residuei112 – 1121Phosphothreonine1 Publication
Modified residuei115 – 1151Phosphoserine6 Publications
Modified residuei119 – 1191Phosphoserine4 Publications
Modified residuei137 – 1371Phosphoserine3 Publications
Modified residuei141 – 1411Phosphoserine3 Publications

Post-translational modificationi

Isoform 3 and isoform 4 are phosphorylated on Ser-62 and Ser-64.

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ7Z309.
PaxDbiQ7Z309.
PRIDEiQ7Z309.

PTM databases

PhosphoSiteiQ7Z309.

Expressioni

Gene expression databases

ArrayExpressiQ7Z309.
BgeeiQ7Z309.
CleanExiHS_FAM122B.
GenevestigatoriQ7Z309.

Organism-specific databases

HPAiHPA000266.

Interactioni

Protein-protein interaction databases

BioGridi127730. 4 interactions.
IntActiQ7Z309. 4 interactions.
MINTiMINT-4719965.
STRINGi9606.ENSP00000298090.

Structurei

3D structure databases

ProteinModelPortaliQ7Z309.

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi195 – 23743Ser-richAdd
BLAST

Sequence similaritiesi

Belongs to the FAM122 family.

Phylogenomic databases

eggNOGiNOG304862.
HOVERGENiHBG073694.
OMAiQPYTFRT.
OrthoDBiEOG7F24TT.
PhylomeDBiQ7Z309.
TreeFamiTF330808.

Family and domain databases

InterProiIPR026716. FAM122.
[Graphical view]
PANTHERiPTHR22227. PTHR22227. 1 hit.

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q7Z309-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAQEKMELDL EPDTSYGGTL RRSSSAPLIH GLSDLSQVFQ PYTLRTRRNS    50
TTIMSRHSLE EGLDMVNRET AHEREMQTAM QISQSWDESL SLSDSDFDKP 100
EKLYSPKRID FTPVSPAPSP TRGFGKMFVS SSGLPPSPVP SPRRFSRRSQ 150
SPVKCIRPSV LGPLKRKGEM ETESQPKRLF QGTTNMLSPD AAQLSDLSSC 200
SDILDGSSSS SGLSSDPLAK GSATAESPVA CSNSCSSFIL MDDLSPK 247
Length:247
Mass (Da):26,928
Last modified:October 31, 2006 - v2
Checksum:iDB1B5C725E619EA2
GO
Isoform 2 (identifier: Q7Z309-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     146-146: S → SS

Show »
Length:248
Mass (Da):27,015
Checksum:i8FF98300C767DD42
GO
Isoform 3 (identifier: Q7Z309-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     59-59: L → LLLSSSPNRIPSSRLHQIKR

Note: Contains a phosphoserine at position 63.

Show »
Length:266
Mass (Da):29,100
Checksum:i82C27D3CE84CB16C
GO
Isoform 4 (identifier: Q7Z309-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     59-59: L → LLLSSSPNRIPSSRLHQIKR
     200-247: CSDILDGSSSSSGLSSDPLAKGSATAESPVACSNSCSSFILMDDLSPK → WWCYQGEEIPALTRCVEHLQMNE

Note: Contains a phosphoserine at position 63.

Show »
Length:241
Mass (Da):27,210
Checksum:i9EBC46BA19CC0FA5
GO
Isoform 5 (identifier: Q7Z309-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: Missing.
     146-146: S → SS
     200-247: CSDILDGSSSSSGLSSDPLAKGSATAESPVACSNSCSSFILMDDLSPK → WWCYQGEEIPALTRCVEHLQMNE

Note: No experimental confirmation available.

Show »
Length:170
Mass (Da):19,174
Checksum:i4771FC7887AC30C2
GO

Sequence cautioni

The sequence AAH32419.1 differs from that shown. Reason: Erroneous initiation.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5353Missing in isoform 5. VSP_021215Add
BLAST
Alternative sequencei59 – 591L → LLLSSSPNRIPSSRLHQIKR in isoform 3 and isoform 4. VSP_021216
Alternative sequencei146 – 1461S → SS in isoform 2 and isoform 5. VSP_021217
Alternative sequencei200 – 24748CSDIL…DLSPK → WWCYQGEEIPALTRCVEHLQ MNE in isoform 4 and isoform 5. VSP_021218Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK124650 mRNA. Translation: BAC85918.1.
AK124940 mRNA. Translation: BAC85999.1.
AK125991 mRNA. Translation: BAC86380.1.
AK292517 mRNA. Translation: BAF85206.1.
BX538218 mRNA. Translation: CAD98073.1.
AL672032, AL691477 Genomic DNA. Translation: CAI40040.1.
AL691477, AL672032 Genomic DNA. Translation: CAI42398.1.
CH471107 Genomic DNA. Translation: EAX11751.1.
BC019221 mRNA. Translation: AAH19221.1.
BC032419 mRNA. Translation: AAH32419.1. Different initiation.
BC110846 mRNA. Translation: AAI10847.1.
CCDSiCCDS14643.1. [Q7Z309-2]
CCDS55497.1. [Q7Z309-1]
CCDS55498.1. [Q7Z309-4]
CCDS55499.1. [Q7Z309-3]
RefSeqiNP_001160071.1. NM_001166599.2. [Q7Z309-1]
NP_001160072.1. NM_001166600.2. [Q7Z309-4]
NP_001164227.1. NM_001170756.1. [Q7Z309-3]
NP_001164228.1. NM_001170757.1.
NP_660327.2. NM_145284.5. [Q7Z309-2]
UniGeneiHs.404706.

Genome annotation databases

EnsembliENST00000298090; ENSP00000298090; ENSG00000156504. [Q7Z309-4]
ENST00000343004; ENSP00000339207; ENSG00000156504. [Q7Z309-3]
ENST00000370790; ENSP00000359826; ENSG00000156504. [Q7Z309-1]
ENST00000486347; ENSP00000419592; ENSG00000156504. [Q7Z309-2]
GeneIDi159090.
KEGGihsa:159090.
UCSCiuc004exq.3. human. [Q7Z309-3]
uc004exr.3. human. [Q7Z309-1]
uc004ext.3. human. [Q7Z309-5]
uc022cek.1. human. [Q7Z309-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK124650 mRNA. Translation: BAC85918.1 .
AK124940 mRNA. Translation: BAC85999.1 .
AK125991 mRNA. Translation: BAC86380.1 .
AK292517 mRNA. Translation: BAF85206.1 .
BX538218 mRNA. Translation: CAD98073.1 .
AL672032 , AL691477 Genomic DNA. Translation: CAI40040.1 .
AL691477 , AL672032 Genomic DNA. Translation: CAI42398.1 .
CH471107 Genomic DNA. Translation: EAX11751.1 .
BC019221 mRNA. Translation: AAH19221.1 .
BC032419 mRNA. Translation: AAH32419.1 . Different initiation.
BC110846 mRNA. Translation: AAI10847.1 .
CCDSi CCDS14643.1. [Q7Z309-2 ]
CCDS55497.1. [Q7Z309-1 ]
CCDS55498.1. [Q7Z309-4 ]
CCDS55499.1. [Q7Z309-3 ]
RefSeqi NP_001160071.1. NM_001166599.2. [Q7Z309-1 ]
NP_001160072.1. NM_001166600.2. [Q7Z309-4 ]
NP_001164227.1. NM_001170756.1. [Q7Z309-3 ]
NP_001164228.1. NM_001170757.1.
NP_660327.2. NM_145284.5. [Q7Z309-2 ]
UniGenei Hs.404706.

3D structure databases

ProteinModelPortali Q7Z309.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 127730. 4 interactions.
IntActi Q7Z309. 4 interactions.
MINTi MINT-4719965.
STRINGi 9606.ENSP00000298090.

PTM databases

PhosphoSitei Q7Z309.

Proteomic databases

MaxQBi Q7Z309.
PaxDbi Q7Z309.
PRIDEi Q7Z309.

Protocols and materials databases

DNASUi 159090.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000298090 ; ENSP00000298090 ; ENSG00000156504 . [Q7Z309-4 ]
ENST00000343004 ; ENSP00000339207 ; ENSG00000156504 . [Q7Z309-3 ]
ENST00000370790 ; ENSP00000359826 ; ENSG00000156504 . [Q7Z309-1 ]
ENST00000486347 ; ENSP00000419592 ; ENSG00000156504 . [Q7Z309-2 ]
GeneIDi 159090.
KEGGi hsa:159090.
UCSCi uc004exq.3. human. [Q7Z309-3 ]
uc004exr.3. human. [Q7Z309-1 ]
uc004ext.3. human. [Q7Z309-5 ]
uc022cek.1. human. [Q7Z309-2 ]

Organism-specific databases

CTDi 159090.
GeneCardsi GC0XM133903.
HGNCi HGNC:30490. FAM122B.
HPAi HPA000266.
neXtProti NX_Q7Z309.
PharmGKBi PA128394763.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG304862.
HOVERGENi HBG073694.
OMAi QPYTFRT.
OrthoDBi EOG7F24TT.
PhylomeDBi Q7Z309.
TreeFami TF330808.

Miscellaneous databases

ChiTaRSi FAM122B. human.
GeneWikii FAM122B.
GenomeRNAii 159090.
NextBioi 87868.
PROi Q7Z309.

Gene expression databases

ArrayExpressi Q7Z309.
Bgeei Q7Z309.
CleanExi HS_FAM122B.
Genevestigatori Q7Z309.

Family and domain databases

InterProi IPR026716. FAM122.
[Graphical view ]
PANTHERi PTHR22227. PTHR22227. 1 hit.
ProtoNeti Search...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 4 AND 5).
    Tissue: Testis.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Fetal kidney.
  3. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Pancreas, Placenta and Skin.
  6. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. "A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
    Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
    Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-115 AND SER-119, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
    Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
    J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-33 AND SER-115, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-112; SER-115; SER-119; SER-137 AND SER-141, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  11. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-25; SER-115; SER-119; SER-137 AND SER-141, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  12. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-50; SER-58; SER-115; SER-137 AND SER-141, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-63 (ISOFORMS 3 AND 4), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  13. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-50; SER-115 AND SER-119, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  14. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiF122B_HUMAN
AccessioniPrimary (citable) accession number: Q7Z309
Secondary accession number(s): A8K902
, Q6PIM2, Q6ZU47, Q6ZV64, Q6ZVE4, Q8TB75
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: October 31, 2006
Last modified: July 9, 2014
This is version 81 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi