Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q7Z309

- F122B_HUMAN

UniProt

Q7Z309 - F122B_HUMAN

Protein

Protein FAM122B

Gene

FAM122B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 82 (01 Oct 2014)
      Sequence version 2 (31 Oct 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein FAM122B
    Gene namesi
    Name:FAM122B
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome X

    Organism-specific databases

    HGNCiHGNC:30490. FAM122B.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA128394763.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11Removed1 Publication
    Chaini2 – 247246Protein FAM122BPRO_0000254545Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylalanine1 Publication
    Modified residuei25 – 251Phosphoserine1 Publication
    Modified residuei33 – 331Phosphoserine1 Publication
    Modified residuei50 – 501Phosphoserine2 Publications
    Modified residuei58 – 581Phosphoserine1 Publication
    Modified residuei112 – 1121Phosphothreonine1 Publication
    Modified residuei115 – 1151Phosphoserine6 Publications
    Modified residuei119 – 1191Phosphoserine4 Publications
    Modified residuei137 – 1371Phosphoserine3 Publications
    Modified residuei141 – 1411Phosphoserine3 Publications

    Post-translational modificationi

    Isoform 3 and isoform 4 are phosphorylated on Ser-62 and Ser-64.6 Publications

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiQ7Z309.
    PaxDbiQ7Z309.
    PRIDEiQ7Z309.

    PTM databases

    PhosphoSiteiQ7Z309.

    Expressioni

    Gene expression databases

    ArrayExpressiQ7Z309.
    BgeeiQ7Z309.
    CleanExiHS_FAM122B.
    GenevestigatoriQ7Z309.

    Organism-specific databases

    HPAiHPA000266.

    Interactioni

    Protein-protein interaction databases

    BioGridi127730. 5 interactions.
    IntActiQ7Z309. 4 interactions.
    MINTiMINT-4719965.
    STRINGi9606.ENSP00000298090.

    Structurei

    3D structure databases

    ProteinModelPortaliQ7Z309.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi195 – 23743Ser-richAdd
    BLAST

    Sequence similaritiesi

    Belongs to the FAM122 family.Curated

    Phylogenomic databases

    eggNOGiNOG304862.
    HOVERGENiHBG073694.
    OMAiQPYTFRT.
    OrthoDBiEOG7F24TT.
    PhylomeDBiQ7Z309.
    TreeFamiTF330808.

    Family and domain databases

    InterProiIPR026716. FAM122.
    [Graphical view]
    PANTHERiPTHR22227. PTHR22227. 1 hit.

    Sequences (5)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q7Z309-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAQEKMELDL EPDTSYGGTL RRSSSAPLIH GLSDLSQVFQ PYTLRTRRNS    50
    TTIMSRHSLE EGLDMVNRET AHEREMQTAM QISQSWDESL SLSDSDFDKP 100
    EKLYSPKRID FTPVSPAPSP TRGFGKMFVS SSGLPPSPVP SPRRFSRRSQ 150
    SPVKCIRPSV LGPLKRKGEM ETESQPKRLF QGTTNMLSPD AAQLSDLSSC 200
    SDILDGSSSS SGLSSDPLAK GSATAESPVA CSNSCSSFIL MDDLSPK 247
    Length:247
    Mass (Da):26,928
    Last modified:October 31, 2006 - v2
    Checksum:iDB1B5C725E619EA2
    GO
    Isoform 2 (identifier: Q7Z309-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         146-146: S → SS

    Show »
    Length:248
    Mass (Da):27,015
    Checksum:i8FF98300C767DD42
    GO
    Isoform 3 (identifier: Q7Z309-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         59-59: L → LLLSSSPNRIPSSRLHQIKR

    Note: Contains a phosphoserine at position 63.

    Show »
    Length:266
    Mass (Da):29,100
    Checksum:i82C27D3CE84CB16C
    GO
    Isoform 4 (identifier: Q7Z309-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         59-59: L → LLLSSSPNRIPSSRLHQIKR
         200-247: CSDILDGSSSSSGLSSDPLAKGSATAESPVACSNSCSSFILMDDLSPK → WWCYQGEEIPALTRCVEHLQMNE

    Note: Contains a phosphoserine at position 63.

    Show »
    Length:241
    Mass (Da):27,210
    Checksum:i9EBC46BA19CC0FA5
    GO
    Isoform 5 (identifier: Q7Z309-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-53: Missing.
         146-146: S → SS
         200-247: CSDILDGSSSSSGLSSDPLAKGSATAESPVACSNSCSSFILMDDLSPK → WWCYQGEEIPALTRCVEHLQMNE

    Note: No experimental confirmation available.

    Show »
    Length:170
    Mass (Da):19,174
    Checksum:i4771FC7887AC30C2
    GO

    Sequence cautioni

    The sequence AAH32419.1 differs from that shown. Reason: Erroneous initiation.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5353Missing in isoform 5. 1 PublicationVSP_021215Add
    BLAST
    Alternative sequencei59 – 591L → LLLSSSPNRIPSSRLHQIKR in isoform 3 and isoform 4. 1 PublicationVSP_021216
    Alternative sequencei146 – 1461S → SS in isoform 2 and isoform 5. 2 PublicationsVSP_021217
    Alternative sequencei200 – 24748CSDIL…DLSPK → WWCYQGEEIPALTRCVEHLQ MNE in isoform 4 and isoform 5. 1 PublicationVSP_021218Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK124650 mRNA. Translation: BAC85918.1.
    AK124940 mRNA. Translation: BAC85999.1.
    AK125991 mRNA. Translation: BAC86380.1.
    AK292517 mRNA. Translation: BAF85206.1.
    BX538218 mRNA. Translation: CAD98073.1.
    AL672032, AL691477 Genomic DNA. Translation: CAI40040.1.
    AL691477, AL672032 Genomic DNA. Translation: CAI42398.1.
    CH471107 Genomic DNA. Translation: EAX11751.1.
    BC019221 mRNA. Translation: AAH19221.1.
    BC032419 mRNA. Translation: AAH32419.1. Different initiation.
    BC110846 mRNA. Translation: AAI10847.1.
    CCDSiCCDS14643.1. [Q7Z309-2]
    CCDS55497.1. [Q7Z309-1]
    CCDS55498.1. [Q7Z309-4]
    CCDS55499.1. [Q7Z309-3]
    RefSeqiNP_001160071.1. NM_001166599.2. [Q7Z309-1]
    NP_001160072.1. NM_001166600.2. [Q7Z309-4]
    NP_001164227.1. NM_001170756.1. [Q7Z309-3]
    NP_001164228.1. NM_001170757.1.
    NP_660327.2. NM_145284.5. [Q7Z309-2]
    UniGeneiHs.404706.

    Genome annotation databases

    EnsembliENST00000298090; ENSP00000298090; ENSG00000156504. [Q7Z309-4]
    ENST00000343004; ENSP00000339207; ENSG00000156504. [Q7Z309-3]
    ENST00000370790; ENSP00000359826; ENSG00000156504. [Q7Z309-1]
    ENST00000486347; ENSP00000419592; ENSG00000156504. [Q7Z309-2]
    GeneIDi159090.
    KEGGihsa:159090.
    UCSCiuc004exq.3. human. [Q7Z309-3]
    uc004exr.3. human. [Q7Z309-1]
    uc004ext.3. human. [Q7Z309-5]
    uc022cek.1. human. [Q7Z309-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK124650 mRNA. Translation: BAC85918.1 .
    AK124940 mRNA. Translation: BAC85999.1 .
    AK125991 mRNA. Translation: BAC86380.1 .
    AK292517 mRNA. Translation: BAF85206.1 .
    BX538218 mRNA. Translation: CAD98073.1 .
    AL672032 , AL691477 Genomic DNA. Translation: CAI40040.1 .
    AL691477 , AL672032 Genomic DNA. Translation: CAI42398.1 .
    CH471107 Genomic DNA. Translation: EAX11751.1 .
    BC019221 mRNA. Translation: AAH19221.1 .
    BC032419 mRNA. Translation: AAH32419.1 . Different initiation.
    BC110846 mRNA. Translation: AAI10847.1 .
    CCDSi CCDS14643.1. [Q7Z309-2 ]
    CCDS55497.1. [Q7Z309-1 ]
    CCDS55498.1. [Q7Z309-4 ]
    CCDS55499.1. [Q7Z309-3 ]
    RefSeqi NP_001160071.1. NM_001166599.2. [Q7Z309-1 ]
    NP_001160072.1. NM_001166600.2. [Q7Z309-4 ]
    NP_001164227.1. NM_001170756.1. [Q7Z309-3 ]
    NP_001164228.1. NM_001170757.1.
    NP_660327.2. NM_145284.5. [Q7Z309-2 ]
    UniGenei Hs.404706.

    3D structure databases

    ProteinModelPortali Q7Z309.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 127730. 5 interactions.
    IntActi Q7Z309. 4 interactions.
    MINTi MINT-4719965.
    STRINGi 9606.ENSP00000298090.

    PTM databases

    PhosphoSitei Q7Z309.

    Proteomic databases

    MaxQBi Q7Z309.
    PaxDbi Q7Z309.
    PRIDEi Q7Z309.

    Protocols and materials databases

    DNASUi 159090.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000298090 ; ENSP00000298090 ; ENSG00000156504 . [Q7Z309-4 ]
    ENST00000343004 ; ENSP00000339207 ; ENSG00000156504 . [Q7Z309-3 ]
    ENST00000370790 ; ENSP00000359826 ; ENSG00000156504 . [Q7Z309-1 ]
    ENST00000486347 ; ENSP00000419592 ; ENSG00000156504 . [Q7Z309-2 ]
    GeneIDi 159090.
    KEGGi hsa:159090.
    UCSCi uc004exq.3. human. [Q7Z309-3 ]
    uc004exr.3. human. [Q7Z309-1 ]
    uc004ext.3. human. [Q7Z309-5 ]
    uc022cek.1. human. [Q7Z309-2 ]

    Organism-specific databases

    CTDi 159090.
    GeneCardsi GC0XM133903.
    HGNCi HGNC:30490. FAM122B.
    HPAi HPA000266.
    neXtProti NX_Q7Z309.
    PharmGKBi PA128394763.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG304862.
    HOVERGENi HBG073694.
    OMAi QPYTFRT.
    OrthoDBi EOG7F24TT.
    PhylomeDBi Q7Z309.
    TreeFami TF330808.

    Miscellaneous databases

    ChiTaRSi FAM122B. human.
    GeneWikii FAM122B.
    GenomeRNAii 159090.
    NextBioi 87868.
    PROi Q7Z309.

    Gene expression databases

    ArrayExpressi Q7Z309.
    Bgeei Q7Z309.
    CleanExi HS_FAM122B.
    Genevestigatori Q7Z309.

    Family and domain databases

    InterProi IPR026716. FAM122.
    [Graphical view ]
    PANTHERi PTHR22227. PTHR22227. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 4 AND 5).
      Tissue: Testis.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Fetal kidney.
    3. "The DNA sequence of the human X chromosome."
      Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
      , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
      Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Pancreas, Placenta and Skin.
    6. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
      Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
      Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    7. "A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
      Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
      Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-115 AND SER-119, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
      Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
      J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-33 AND SER-115, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-112; SER-115; SER-119; SER-137 AND SER-141, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    10. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    11. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-25; SER-115; SER-119; SER-137 AND SER-141, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    12. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-50; SER-58; SER-115; SER-137 AND SER-141, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-63 (ISOFORMS 3 AND 4), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    13. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-50; SER-115 AND SER-119, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    14. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiF122B_HUMAN
    AccessioniPrimary (citable) accession number: Q7Z309
    Secondary accession number(s): A8K902
    , Q6PIM2, Q6ZU47, Q6ZV64, Q6ZVE4, Q8TB75
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 31, 2006
    Last sequence update: October 31, 2006
    Last modified: October 1, 2014
    This is version 82 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome X
      Human chromosome X: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3