Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein FAM122B

Gene

FAM122B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Protein FAM122B
Gene namesi
Name:FAM122B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

HGNCiHGNC:30490. FAM122B.

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000156504.
PharmGKBiPA128394763.

Polymorphism and mutation databases

BioMutaiFAM122B.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00002545452 – 247Protein FAM122BAdd BLAST246

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1
Modified residuei25PhosphoserineCombined sources1
Modified residuei33PhosphoserineCombined sources1
Modified residuei50PhosphoserineCombined sources1
Modified residuei58PhosphoserineCombined sources1
Modified residuei112PhosphothreonineCombined sources1
Modified residuei115PhosphoserineCombined sources1
Modified residuei119PhosphoserineCombined sources1
Modified residuei122Omega-N-methylarginineCombined sources1
Modified residuei137PhosphoserineCombined sources1
Modified residuei141PhosphoserineCombined sources1
Isoform 3 (identifier: Q7Z309-3)
Modified residuei63PhosphoserineCombined sources1
Isoform 4 (identifier: Q7Z309-4)
Modified residuei63PhosphoserineCombined sources1

Post-translational modificationi

Isoform 3 and isoform 4 are phosphorylated on Ser-62 and Ser-64.

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

EPDiQ7Z309.
MaxQBiQ7Z309.
PeptideAtlasiQ7Z309.
PRIDEiQ7Z309.

PTM databases

iPTMnetiQ7Z309.
PhosphoSitePlusiQ7Z309.

Expressioni

Gene expression databases

BgeeiENSG00000156504.
CleanExiHS_FAM122B.
ExpressionAtlasiQ7Z309. baseline and differential.
GenevisibleiQ7Z309. HS.

Organism-specific databases

HPAiHPA000266.

Interactioni

Protein-protein interaction databases

BioGridi127730. 16 interactors.
IntActiQ7Z309. 7 interactors.
MINTiMINT-4719965.

Structurei

3D structure databases

ProteinModelPortaliQ7Z309.
SMRiQ7Z309.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi195 – 237Ser-richAdd BLAST43

Sequence similaritiesi

Belongs to the FAM122 family.Curated

Phylogenomic databases

GeneTreeiENSGT00390000015476.
HOVERGENiHBG073694.
InParanoidiQ7Z309.
PhylomeDBiQ7Z309.
TreeFamiTF330808.

Family and domain databases

InterProiIPR026716. FAM122.
[Graphical view]
PANTHERiPTHR22227. PTHR22227. 1 hit.

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7Z309-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAQEKMELDL EPDTSYGGTL RRSSSAPLIH GLSDLSQVFQ PYTLRTRRNS
60 70 80 90 100
TTIMSRHSLE EGLDMVNRET AHEREMQTAM QISQSWDESL SLSDSDFDKP
110 120 130 140 150
EKLYSPKRID FTPVSPAPSP TRGFGKMFVS SSGLPPSPVP SPRRFSRRSQ
160 170 180 190 200
SPVKCIRPSV LGPLKRKGEM ETESQPKRLF QGTTNMLSPD AAQLSDLSSC
210 220 230 240
SDILDGSSSS SGLSSDPLAK GSATAESPVA CSNSCSSFIL MDDLSPK
Length:247
Mass (Da):26,928
Last modified:October 31, 2006 - v2
Checksum:iDB1B5C725E619EA2
GO
Isoform 2 (identifier: Q7Z309-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     146-146: S → SS

Show »
Length:248
Mass (Da):27,015
Checksum:i8FF98300C767DD42
GO
Isoform 3 (identifier: Q7Z309-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     59-59: L → LLLSSSPNRIPSSRLHQIKR

Show »
Length:266
Mass (Da):29,100
Checksum:i82C27D3CE84CB16C
GO
Isoform 4 (identifier: Q7Z309-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     59-59: L → LLLSSSPNRIPSSRLHQIKR
     200-247: CSDILDGSSSSSGLSSDPLAKGSATAESPVACSNSCSSFILMDDLSPK → WWCYQGEEIPALTRCVEHLQMNE

Show »
Length:241
Mass (Da):27,210
Checksum:i9EBC46BA19CC0FA5
GO
Isoform 5 (identifier: Q7Z309-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: Missing.
     146-146: S → SS
     200-247: CSDILDGSSSSSGLSSDPLAKGSATAESPVACSNSCSSFILMDDLSPK → WWCYQGEEIPALTRCVEHLQMNE

Note: No experimental confirmation available.
Show »
Length:170
Mass (Da):19,174
Checksum:i4771FC7887AC30C2
GO

Sequence cautioni

The sequence AAH32419 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0212151 – 53Missing in isoform 5. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_02121659L → LLLSSSPNRIPSSRLHQIKR in isoform 3 and isoform 4. 1 Publication1
Alternative sequenceiVSP_021217146S → SS in isoform 2 and isoform 5. 2 Publications1
Alternative sequenceiVSP_021218200 – 247CSDIL…DLSPK → WWCYQGEEIPALTRCVEHLQ MNE in isoform 4 and isoform 5. 1 PublicationAdd BLAST48

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK124650 mRNA. Translation: BAC85918.1.
AK124940 mRNA. Translation: BAC85999.1.
AK125991 mRNA. Translation: BAC86380.1.
AK292517 mRNA. Translation: BAF85206.1.
BX538218 mRNA. Translation: CAD98073.1.
AL672032, AL691477 Genomic DNA. Translation: CAI40040.1.
AL691477, AL672032 Genomic DNA. Translation: CAI42398.1.
CH471107 Genomic DNA. Translation: EAX11751.1.
BC019221 mRNA. Translation: AAH19221.1.
BC032419 mRNA. Translation: AAH32419.1. Different initiation.
BC110846 mRNA. Translation: AAI10847.1.
CCDSiCCDS14643.1. [Q7Z309-2]
CCDS55497.1. [Q7Z309-1]
CCDS55498.1. [Q7Z309-4]
CCDS55499.1. [Q7Z309-3]
RefSeqiNP_001160071.1. NM_001166599.3. [Q7Z309-1]
NP_001160072.1. NM_001166600.2. [Q7Z309-4]
NP_001164227.1. NM_001170756.1. [Q7Z309-3]
NP_001164228.1. NM_001170757.1.
NP_660327.2. NM_145284.5. [Q7Z309-2]
XP_011529595.1. XM_011531293.1. [Q7Z309-4]
UniGeneiHs.404706.

Genome annotation databases

EnsembliENST00000298090; ENSP00000298090; ENSG00000156504. [Q7Z309-4]
ENST00000370790; ENSP00000359826; ENSG00000156504. [Q7Z309-1]
ENST00000486347; ENSP00000419592; ENSG00000156504. [Q7Z309-2]
ENST00000493333; ENSP00000487221; ENSG00000156504. [Q7Z309-3]
GeneIDi159090.
KEGGihsa:159090.
UCSCiuc004exr.4. human. [Q7Z309-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK124650 mRNA. Translation: BAC85918.1.
AK124940 mRNA. Translation: BAC85999.1.
AK125991 mRNA. Translation: BAC86380.1.
AK292517 mRNA. Translation: BAF85206.1.
BX538218 mRNA. Translation: CAD98073.1.
AL672032, AL691477 Genomic DNA. Translation: CAI40040.1.
AL691477, AL672032 Genomic DNA. Translation: CAI42398.1.
CH471107 Genomic DNA. Translation: EAX11751.1.
BC019221 mRNA. Translation: AAH19221.1.
BC032419 mRNA. Translation: AAH32419.1. Different initiation.
BC110846 mRNA. Translation: AAI10847.1.
CCDSiCCDS14643.1. [Q7Z309-2]
CCDS55497.1. [Q7Z309-1]
CCDS55498.1. [Q7Z309-4]
CCDS55499.1. [Q7Z309-3]
RefSeqiNP_001160071.1. NM_001166599.3. [Q7Z309-1]
NP_001160072.1. NM_001166600.2. [Q7Z309-4]
NP_001164227.1. NM_001170756.1. [Q7Z309-3]
NP_001164228.1. NM_001170757.1.
NP_660327.2. NM_145284.5. [Q7Z309-2]
XP_011529595.1. XM_011531293.1. [Q7Z309-4]
UniGeneiHs.404706.

3D structure databases

ProteinModelPortaliQ7Z309.
SMRiQ7Z309.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127730. 16 interactors.
IntActiQ7Z309. 7 interactors.
MINTiMINT-4719965.

PTM databases

iPTMnetiQ7Z309.
PhosphoSitePlusiQ7Z309.

Polymorphism and mutation databases

BioMutaiFAM122B.

Proteomic databases

EPDiQ7Z309.
MaxQBiQ7Z309.
PeptideAtlasiQ7Z309.
PRIDEiQ7Z309.

Protocols and materials databases

DNASUi159090.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000298090; ENSP00000298090; ENSG00000156504. [Q7Z309-4]
ENST00000370790; ENSP00000359826; ENSG00000156504. [Q7Z309-1]
ENST00000486347; ENSP00000419592; ENSG00000156504. [Q7Z309-2]
ENST00000493333; ENSP00000487221; ENSG00000156504. [Q7Z309-3]
GeneIDi159090.
KEGGihsa:159090.
UCSCiuc004exr.4. human. [Q7Z309-1]

Organism-specific databases

CTDi159090.
GeneCardsiFAM122B.
HGNCiHGNC:30490. FAM122B.
HPAiHPA000266.
neXtProtiNX_Q7Z309.
OpenTargetsiENSG00000156504.
PharmGKBiPA128394763.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00390000015476.
HOVERGENiHBG073694.
InParanoidiQ7Z309.
PhylomeDBiQ7Z309.
TreeFamiTF330808.

Miscellaneous databases

ChiTaRSiFAM122B. human.
GeneWikiiFAM122B.
GenomeRNAii159090.
PROiQ7Z309.

Gene expression databases

BgeeiENSG00000156504.
CleanExiHS_FAM122B.
ExpressionAtlasiQ7Z309. baseline and differential.
GenevisibleiQ7Z309. HS.

Family and domain databases

InterProiIPR026716. FAM122.
[Graphical view]
PANTHERiPTHR22227. PTHR22227. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiF122B_HUMAN
AccessioniPrimary (citable) accession number: Q7Z309
Secondary accession number(s): A8K902
, Q6PIM2, Q6ZU47, Q6ZV64, Q6ZVE4, Q8TB75
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: October 31, 2006
Last modified: November 30, 2016
This is version 103 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.