Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein FAM122B

Gene

FAM122B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Protein FAM122B
Gene namesi
Name:FAM122B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

EuPathDBiHostDB:ENSG00000156504.16
HGNCiHGNC:30490 FAM122B
neXtProtiNX_Q7Z309

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000156504
PharmGKBiPA128394763

Polymorphism and mutation databases

BioMutaiFAM122B

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00002545452 – 247Protein FAM122BAdd BLAST246

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1
Modified residuei25PhosphoserineCombined sources1
Modified residuei33PhosphoserineCombined sources1
Modified residuei50PhosphoserineCombined sources1
Modified residuei58PhosphoserineCombined sources1
Modified residuei112PhosphothreonineCombined sources1
Modified residuei115PhosphoserineCombined sources1
Modified residuei119PhosphoserineCombined sources1
Modified residuei122Omega-N-methylarginineCombined sources1
Modified residuei137PhosphoserineCombined sources1
Modified residuei141PhosphoserineCombined sources1
Isoform 3 (identifier: Q7Z309-3)
Modified residuei63PhosphoserineCombined sources1
Isoform 4 (identifier: Q7Z309-4)
Modified residuei63PhosphoserineCombined sources1

Post-translational modificationi

Isoform 3 and isoform 4 are phosphorylated on Ser-62 and Ser-64.

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

EPDiQ7Z309
MaxQBiQ7Z309
PeptideAtlasiQ7Z309
PRIDEiQ7Z309

PTM databases

iPTMnetiQ7Z309
PhosphoSitePlusiQ7Z309

Expressioni

Gene expression databases

BgeeiENSG00000156504
CleanExiHS_FAM122B
ExpressionAtlasiQ7Z309 baseline and differential
GenevisibleiQ7Z309 HS

Organism-specific databases

HPAiHPA000266

Interactioni

Protein-protein interaction databases

BioGridi127730, 21 interactors
IntActiQ7Z309, 7 interactors

Structurei

3D structure databases

ProteinModelPortaliQ7Z309
SMRiQ7Z309
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi195 – 237Ser-richAdd BLAST43

Sequence similaritiesi

Belongs to the FAM122 family.Curated

Phylogenomic databases

GeneTreeiENSGT00390000015476
HOVERGENiHBG073694
InParanoidiQ7Z309
PhylomeDBiQ7Z309
TreeFamiTF330808

Family and domain databases

InterProiView protein in InterPro
IPR026716 FAM122
PANTHERiPTHR22227 PTHR22227, 1 hit

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7Z309-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAQEKMELDL EPDTSYGGTL RRSSSAPLIH GLSDLSQVFQ PYTLRTRRNS
60 70 80 90 100
TTIMSRHSLE EGLDMVNRET AHEREMQTAM QISQSWDESL SLSDSDFDKP
110 120 130 140 150
EKLYSPKRID FTPVSPAPSP TRGFGKMFVS SSGLPPSPVP SPRRFSRRSQ
160 170 180 190 200
SPVKCIRPSV LGPLKRKGEM ETESQPKRLF QGTTNMLSPD AAQLSDLSSC
210 220 230 240
SDILDGSSSS SGLSSDPLAK GSATAESPVA CSNSCSSFIL MDDLSPK
Length:247
Mass (Da):26,928
Last modified:October 31, 2006 - v2
Checksum:iDB1B5C725E619EA2
GO
Isoform 2 (identifier: Q7Z309-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     146-146: S → SS

Show »
Length:248
Mass (Da):27,015
Checksum:i8FF98300C767DD42
GO
Isoform 3 (identifier: Q7Z309-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     59-59: L → LLLSSSPNRIPSSRLHQIKR

Show »
Length:266
Mass (Da):29,100
Checksum:i82C27D3CE84CB16C
GO
Isoform 4 (identifier: Q7Z309-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     59-59: L → LLLSSSPNRIPSSRLHQIKR
     200-247: CSDILDGSSSSSGLSSDPLAKGSATAESPVACSNSCSSFILMDDLSPK → WWCYQGEEIPALTRCVEHLQMNE

Show »
Length:241
Mass (Da):27,210
Checksum:i9EBC46BA19CC0FA5
GO
Isoform 5 (identifier: Q7Z309-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: Missing.
     146-146: S → SS
     200-247: CSDILDGSSSSSGLSSDPLAKGSATAESPVACSNSCSSFILMDDLSPK → WWCYQGEEIPALTRCVEHLQMNE

Note: No experimental confirmation available.
Show »
Length:170
Mass (Da):19,174
Checksum:i4771FC7887AC30C2
GO

Sequence cautioni

The sequence AAH32419 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0212151 – 53Missing in isoform 5. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_02121659L → LLLSSSPNRIPSSRLHQIKR in isoform 3 and isoform 4. 1 Publication1
Alternative sequenceiVSP_021217146S → SS in isoform 2 and isoform 5. 2 Publications1
Alternative sequenceiVSP_021218200 – 247CSDIL…DLSPK → WWCYQGEEIPALTRCVEHLQ MNE in isoform 4 and isoform 5. 1 PublicationAdd BLAST48

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK124650 mRNA Translation: BAC85918.1
AK124940 mRNA Translation: BAC85999.1
AK125991 mRNA Translation: BAC86380.1
AK292517 mRNA Translation: BAF85206.1
BX538218 mRNA Translation: CAD98073.1
AL672032 Genomic DNA No translation available.
AL691477 Genomic DNA No translation available.
CH471107 Genomic DNA Translation: EAX11751.1
BC019221 mRNA Translation: AAH19221.1
BC032419 mRNA Translation: AAH32419.1 Different initiation.
BC110846 mRNA Translation: AAI10847.1
CCDSiCCDS14643.1 [Q7Z309-2]
CCDS55497.1 [Q7Z309-1]
CCDS55498.1 [Q7Z309-4]
CCDS55499.1 [Q7Z309-3]
RefSeqiNP_001160071.1, NM_001166599.3 [Q7Z309-1]
NP_001160072.1, NM_001166600.2 [Q7Z309-4]
NP_001164227.1, NM_001170756.1 [Q7Z309-3]
NP_001164228.1, NM_001170757.1
NP_660327.2, NM_145284.5 [Q7Z309-2]
XP_011529595.1, XM_011531293.1 [Q7Z309-4]
UniGeneiHs.404706

Genome annotation databases

EnsembliENST00000298090; ENSP00000298090; ENSG00000156504 [Q7Z309-4]
ENST00000370790; ENSP00000359826; ENSG00000156504 [Q7Z309-1]
ENST00000486347; ENSP00000419592; ENSG00000156504 [Q7Z309-2]
ENST00000493333; ENSP00000487221; ENSG00000156504 [Q7Z309-3]
GeneIDi159090
KEGGihsa:159090
UCSCiuc004exr.4 human [Q7Z309-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiF122B_HUMAN
AccessioniPrimary (citable) accession number: Q7Z309
Secondary accession number(s): A8K902
, Q6PIM2, Q6ZU47, Q6ZV64, Q6ZVE4, Q8TB75
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: October 31, 2006
Last modified: May 23, 2018
This is version 109 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health