Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q7Z309 (F122B_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 81. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Protein FAM122B
Gene names
Name:FAM122B
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length247 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Post-translational modification

Isoform 3 and isoform 4 are phosphorylated on Ser-62 and Ser-64.

Sequence similarities

Belongs to the FAM122 family.

Sequence caution

The sequence AAH32419.1 differs from that shown. Reason: Erroneous initiation.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
   PTMAcetylation
Phosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
None. [Check GOA]

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q7Z309-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q7Z309-2)

The sequence of this isoform differs from the canonical sequence as follows:
     146-146: S → SS
Isoform 3 (identifier: Q7Z309-3)

The sequence of this isoform differs from the canonical sequence as follows:
     59-59: L → LLLSSSPNRIPSSRLHQIKR
Note: Contains a phosphoserine at position 63.
Isoform 4 (identifier: Q7Z309-4)

The sequence of this isoform differs from the canonical sequence as follows:
     59-59: L → LLLSSSPNRIPSSRLHQIKR
     200-247: CSDILDGSSSSSGLSSDPLAKGSATAESPVACSNSCSSFILMDDLSPK → WWCYQGEEIPALTRCVEHLQMNE
Note: Contains a phosphoserine at position 63.
Isoform 5 (identifier: Q7Z309-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: Missing.
     146-146: S → SS
     200-247: CSDILDGSSSSSGLSSDPLAKGSATAESPVACSNSCSSFILMDDLSPK → WWCYQGEEIPALTRCVEHLQMNE
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Initiator methionine11Removed Ref.14
Chain2 – 247246Protein FAM122B
PRO_0000254545

Regions

Compositional bias195 – 23743Ser-rich

Amino acid modifications

Modified residue21N-acetylalanine Ref.14
Modified residue251Phosphoserine Ref.11
Modified residue331Phosphoserine Ref.8
Modified residue501Phosphoserine Ref.12 Ref.13
Modified residue581Phosphoserine Ref.12
Modified residue1121Phosphothreonine Ref.9
Modified residue1151Phosphoserine Ref.7 Ref.8 Ref.9 Ref.11 Ref.12 Ref.13
Modified residue1191Phosphoserine Ref.7 Ref.9 Ref.11 Ref.13
Modified residue1371Phosphoserine Ref.9 Ref.11 Ref.12
Modified residue1411Phosphoserine Ref.9 Ref.11 Ref.12

Natural variations

Alternative sequence1 – 5353Missing in isoform 5.
VSP_021215
Alternative sequence591L → LLLSSSPNRIPSSRLHQIKR in isoform 3 and isoform 4.
VSP_021216
Alternative sequence1461S → SS in isoform 2 and isoform 5.
VSP_021217
Alternative sequence200 – 24748CSDIL…DLSPK → WWCYQGEEIPALTRCVEHLQ MNE in isoform 4 and isoform 5.
VSP_021218

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 31, 2006. Version 2.
Checksum: DB1B5C725E619EA2

FASTA24726,928
        10         20         30         40         50         60 
MAQEKMELDL EPDTSYGGTL RRSSSAPLIH GLSDLSQVFQ PYTLRTRRNS TTIMSRHSLE 

        70         80         90        100        110        120 
EGLDMVNRET AHEREMQTAM QISQSWDESL SLSDSDFDKP EKLYSPKRID FTPVSPAPSP 

       130        140        150        160        170        180 
TRGFGKMFVS SSGLPPSPVP SPRRFSRRSQ SPVKCIRPSV LGPLKRKGEM ETESQPKRLF 

       190        200        210        220        230        240 
QGTTNMLSPD AAQLSDLSSC SDILDGSSSS SGLSSDPLAK GSATAESPVA CSNSCSSFIL 


MDDLSPK 

« Hide

Isoform 2 [UniParc].

Checksum: 8FF98300C767DD42
Show »

FASTA24827,015
Isoform 3 [UniParc].

Checksum: 82C27D3CE84CB16C
Show »

FASTA26629,100
Isoform 4 [UniParc].

Checksum: 9EBC46BA19CC0FA5
Show »

FASTA24127,210
Isoform 5 [UniParc].

Checksum: 4771FC7887AC30C2
Show »

FASTA17019,174

References

[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 4 AND 5).
Tissue: Testis.
[2]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Fetal kidney.
[3]"The DNA sequence of the human X chromosome."
Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. expand/collapse author list , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Pancreas, Placenta and Skin.
[6]"Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[7]"A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-115 AND SER-119, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[8]"Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-33 AND SER-115, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[9]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-112; SER-115; SER-119; SER-137 AND SER-141, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[10]"Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[11]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-25; SER-115; SER-119; SER-137 AND SER-141, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[12]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-50; SER-58; SER-115; SER-137 AND SER-141, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-63 (ISOFORMS 3 AND 4), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[13]"System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-50; SER-115 AND SER-119, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[14]"N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB."
Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.
Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK124650 mRNA. Translation: BAC85918.1.
AK124940 mRNA. Translation: BAC85999.1.
AK125991 mRNA. Translation: BAC86380.1.
AK292517 mRNA. Translation: BAF85206.1.
BX538218 mRNA. Translation: CAD98073.1.
AL672032, AL691477 Genomic DNA. Translation: CAI40040.1.
AL691477, AL672032 Genomic DNA. Translation: CAI42398.1.
CH471107 Genomic DNA. Translation: EAX11751.1.
BC019221 mRNA. Translation: AAH19221.1.
BC032419 mRNA. Translation: AAH32419.1. Different initiation.
BC110846 mRNA. Translation: AAI10847.1.
CCDSCCDS14643.1. [Q7Z309-2]
CCDS55497.1. [Q7Z309-1]
CCDS55498.1. [Q7Z309-4]
CCDS55499.1. [Q7Z309-3]
RefSeqNP_001160071.1. NM_001166599.2. [Q7Z309-1]
NP_001160072.1. NM_001166600.2. [Q7Z309-4]
NP_001164227.1. NM_001170756.1. [Q7Z309-3]
NP_001164228.1. NM_001170757.1.
NP_660327.2. NM_145284.5. [Q7Z309-2]
UniGeneHs.404706.

3D structure databases

ProteinModelPortalQ7Z309.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid127730. 4 interactions.
IntActQ7Z309. 4 interactions.
MINTMINT-4719965.
STRING9606.ENSP00000298090.

PTM databases

PhosphoSiteQ7Z309.

Proteomic databases

MaxQBQ7Z309.
PaxDbQ7Z309.
PRIDEQ7Z309.

Protocols and materials databases

DNASU159090.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000298090; ENSP00000298090; ENSG00000156504. [Q7Z309-4]
ENST00000343004; ENSP00000339207; ENSG00000156504. [Q7Z309-3]
ENST00000370790; ENSP00000359826; ENSG00000156504. [Q7Z309-1]
ENST00000486347; ENSP00000419592; ENSG00000156504. [Q7Z309-2]
GeneID159090.
KEGGhsa:159090.
UCSCuc004exq.3. human. [Q7Z309-3]
uc004exr.3. human. [Q7Z309-1]
uc004ext.3. human. [Q7Z309-5]
uc022cek.1. human. [Q7Z309-2]

Organism-specific databases

CTD159090.
GeneCardsGC0XM133903.
HGNCHGNC:30490. FAM122B.
HPAHPA000266.
neXtProtNX_Q7Z309.
PharmGKBPA128394763.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG304862.
HOVERGENHBG073694.
OMAQPYTFRT.
OrthoDBEOG7F24TT.
PhylomeDBQ7Z309.
TreeFamTF330808.

Gene expression databases

ArrayExpressQ7Z309.
BgeeQ7Z309.
CleanExHS_FAM122B.
GenevestigatorQ7Z309.

Family and domain databases

InterProIPR026716. FAM122.
[Graphical view]
PANTHERPTHR22227. PTHR22227. 1 hit.
ProtoNetSearch...

Other

ChiTaRSFAM122B. human.
GeneWikiFAM122B.
GenomeRNAi159090.
NextBio87868.
PROQ7Z309.

Entry information

Entry nameF122B_HUMAN
AccessionPrimary (citable) accession number: Q7Z309
Secondary accession number(s): A8K902 expand/collapse secondary AC list , Q6PIM2, Q6ZU47, Q6ZV64, Q6ZVE4, Q8TB75
Entry history
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: October 31, 2006
Last modified: July 9, 2014
This is version 81 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human chromosome X

Human chromosome X: entries, gene names and cross-references to MIM