Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

PTB-containing, cubilin and LRP1-interacting protein

Gene

PID1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Increases proliferation of preadipocytes without affecting adipocytic differentiation.1 Publication

GO - Biological processi

  • cellular response to cytokine stimulus Source: BHF-UCL
  • cellular response to fatty acid Source: BHF-UCL
  • cellular response to interleukin-6 Source: BHF-UCL
  • cellular response to leptin stimulus Source: Ensembl
  • cellular response to tumor necrosis factor Source: BHF-UCL
  • energy reserve metabolic process Source: BHF-UCL
  • mitochondrion morphogenesis Source: BHF-UCL
  • negative regulation of ATP biosynthetic process Source: BHF-UCL
  • negative regulation of establishment of protein localization to plasma membrane Source: BHF-UCL
  • negative regulation of glucose import in response to insulin stimulus Source: BHF-UCL
  • negative regulation of insulin receptor signaling pathway Source: BHF-UCL
  • negative regulation of mitochondrial DNA replication Source: BHF-UCL
  • negative regulation of protein phosphorylation Source: BHF-UCL
  • positive regulation of ATP biosynthetic process Source: BHF-UCL
  • positive regulation of fat cell proliferation Source: BHF-UCL
  • positive regulation of gene expression Source: BHF-UCL
  • positive regulation of reactive oxygen species metabolic process Source: BHF-UCL
  • positive regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
  • regulation of G1/S transition of mitotic cell cycle Source: BHF-UCL
  • regulation of mitochondrial fusion Source: BHF-UCL
  • regulation of mitochondrial membrane potential Source: BHF-UCL
  • regulation of reactive oxygen species metabolic process Source: BHF-UCL
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
PTB-containing, cubilin and LRP1-interacting protein
Short name:
P-CLI1
Alternative name(s):
Phosphotyrosine interaction domain-containing protein 1
Protein NYGGF4
Gene namesi
Name:PID1
Synonyms:NYGGF4, PCLI1
ORF Names:HMFN2073
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:26084. PID1.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: BHF-UCL
  • nucleoplasm Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162399462.

Polymorphism and mutation databases

BioMutaiPID1.
DMDMi74713284.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 250250PTB-containing, cubilin and LRP1-interacting proteinPRO_0000274900Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei236 – 2361PhosphoserineBy similarity
Modified residuei247 – 2471PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ7Z2X4.
PeptideAtlasiQ7Z2X4.
PRIDEiQ7Z2X4.

PTM databases

PhosphoSiteiQ7Z2X4.

Expressioni

Tissue specificityi

Expressed in subcutaneous fat, heart, skeletal muscle, brain, colon, thymus, spleen, kidney, liver, small intestine, placenta, lung and peripheral blood leukocyte.1 Publication

Inductioni

Up-regulated in fat of obese subjects.1 Publication

Gene expression databases

BgeeiQ7Z2X4.
CleanExiHS_PID1.
ExpressionAtlasiQ7Z2X4. baseline and differential.
GenevisibleiQ7Z2X4. HS.

Organism-specific databases

HPAiHPA036103.

Interactioni

Subunit structurei

Found in a complex with PID1/PCLI1, LRP1 and CUBNI. Interacts with LRP1 and CUBN.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
ADAMTSL4Q6UY14-33EBI-10256685,EBI-10173507
BANPQ8N9N53EBI-10256685,EBI-744695
CRXO431863EBI-10256685,EBI-748171
GOLGA2Q083793EBI-10256685,EBI-618309
GOPCQ9HD263EBI-10256685,EBI-349832
MDFIQ997503EBI-10256685,EBI-724076
NME1P155313EBI-10256685,EBI-741141
NOTCH2NLQ7Z3S93EBI-10256685,EBI-945833
SPERTQ8NA613EBI-10256685,EBI-741724
THAP1Q9NVV93EBI-10256685,EBI-741515

Protein-protein interaction databases

BioGridi120352. 17 interactions.
IntActiQ7Z2X4. 10 interactions.
STRINGi9606.ENSP00000375907.

Structurei

3D structure databases

ProteinModelPortaliQ7Z2X4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini93 – 250158PIDPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 PID domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG260811.
GeneTreeiENSGT00510000048154.
HOGENOMiHOG000115472.
HOVERGENiHBG054924.
InParanoidiQ7Z2X4.
OMAiTVIFHEP.
OrthoDBiEOG7J4470.
PhylomeDBiQ7Z2X4.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR011993. PH-like_dom.
IPR006020. PTB/PI_dom.
[Graphical view]
PfamiPF14719. PID_2. 1 hit.
[Graphical view]
PROSITEiPS01179. PID. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7Z2X4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFSLPLSLPL CEDTAFLPSK CCSSHKTIKQ ARTLIMIFLA SGTHFQTMLK
60 70 80 90 100
SKLNVLTLKK EPLPAVIFHE PEAIELCTTT PLMKTRTHSG CKVTYLGKVS
110 120 130 140 150
TTGMQFLSGC TEKPVIELWK KHTLAREDVF PANALLEIRP FQVWLHHLDH
160 170 180 190 200
KGEATVHMDT FQVARIAYCT ADHNVSPNIF AWVYREINDD LSYQMDCHAV
210 220 230 240 250
ECESKLEAKK LAHAMMEAFR KTFHSMKSDG RIHSNSSSEE VSQELESDDG
Length:250
Mass (Da):28,272
Last modified:October 1, 2003 - v1
Checksum:i3C2F4AE5254D2885
GO
Isoform 2 (identifier: Q7Z2X4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MFSLPLSLPL...LIMIFLASGT → MPRIAGNHLM...LHFGLPASEM

Show »
Length:248
Mass (Da):28,121
Checksum:iD4D89783A12B71D3
GO
Isoform 3 (identifier: Q7Z2X4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-82: Missing.
     83-92: MKTRTHSGCK → MWQPATERLQ

Show »
Length:168
Mass (Da):19,285
Checksum:i5A8DBD3D2B54E512
GO
Isoform 4 (identifier: Q7Z2X4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MFSLPLSLPLCEDTAFLPSKCCSSHKTIKQARTLIMIFLASGT → MWQPATERLQ

Show »
Length:217
Mass (Da):24,829
Checksum:i247256CD547081F5
GO

Sequence cautioni

The sequence BAD38656.1 differs from that shown. Reason: Erroneous initiation. Curated

Polymorphismi

Some sequences seem to have a duplication of exon 2.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti43 – 431T → THFQTMLKSKLNVLTLKKEP LPAVIFHEPEAIELCTTTPL MKTRTHSGCK in variant with duplicated exon 2.
VAR_030361

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 8282Missing in isoform 3. 1 PublicationVSP_022909Add
BLAST
Alternative sequencei1 – 4343MFSLP…LASGT → MPRIAGNHLMLEESRTCSSP ELLDGVWPCQPLHFGLPASE M in isoform 2. 1 PublicationVSP_022910Add
BLAST
Alternative sequencei1 – 4343MFSLP…LASGT → MWQPATERLQ in isoform 4. 2 PublicationsVSP_022911Add
BLAST
Alternative sequencei83 – 9210MKTRTHSGCK → MWQPATERLQ in isoform 3. 1 PublicationVSP_022912

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB075874 mRNA. Translation: BAD38656.1. Different initiation.
AY317148 mRNA. Translation: AAP79437.1.
AK000708 mRNA. Translation: BAA91333.1.
AK096636 mRNA. Translation: BAG53344.1.
AK125359 mRNA. Translation: BAC86145.1.
CH471063 Genomic DNA. Translation: EAW70891.1.
BC040164 mRNA. Translation: AAH40164.1.
CCDSiCCDS2471.1. [Q7Z2X4-2]
CCDS42830.1. [Q7Z2X4-4]
RefSeqiNP_001094288.1. NM_001100818.1. [Q7Z2X4-4]
NP_060403.3. NM_017933.4. [Q7Z2X4-2]
XP_011509686.1. XM_011511384.1. [Q7Z2X4-1]
UniGeneiHs.745038.

Genome annotation databases

EnsembliENST00000354069; ENSP00000283937; ENSG00000153823.
ENST00000392054; ENSP00000375907; ENSG00000153823. [Q7Z2X4-2]
ENST00000392055; ENSP00000375908; ENSG00000153823. [Q7Z2X4-4]
ENST00000409462; ENSP00000386826; ENSG00000153823. [Q7Z2X4-3]
GeneIDi55022.
KEGGihsa:55022.
UCSCiuc002vpr.4. human. [Q7Z2X4-1]
uc002vps.4. human. [Q7Z2X4-2]
uc002vpt.4. human. [Q7Z2X4-4]
uc002vpu.4. human. [Q7Z2X4-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB075874 mRNA. Translation: BAD38656.1. Different initiation.
AY317148 mRNA. Translation: AAP79437.1.
AK000708 mRNA. Translation: BAA91333.1.
AK096636 mRNA. Translation: BAG53344.1.
AK125359 mRNA. Translation: BAC86145.1.
CH471063 Genomic DNA. Translation: EAW70891.1.
BC040164 mRNA. Translation: AAH40164.1.
CCDSiCCDS2471.1. [Q7Z2X4-2]
CCDS42830.1. [Q7Z2X4-4]
RefSeqiNP_001094288.1. NM_001100818.1. [Q7Z2X4-4]
NP_060403.3. NM_017933.4. [Q7Z2X4-2]
XP_011509686.1. XM_011511384.1. [Q7Z2X4-1]
UniGeneiHs.745038.

3D structure databases

ProteinModelPortaliQ7Z2X4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120352. 17 interactions.
IntActiQ7Z2X4. 10 interactions.
STRINGi9606.ENSP00000375907.

PTM databases

PhosphoSiteiQ7Z2X4.

Polymorphism and mutation databases

BioMutaiPID1.
DMDMi74713284.

Proteomic databases

PaxDbiQ7Z2X4.
PeptideAtlasiQ7Z2X4.
PRIDEiQ7Z2X4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000354069; ENSP00000283937; ENSG00000153823.
ENST00000392054; ENSP00000375907; ENSG00000153823. [Q7Z2X4-2]
ENST00000392055; ENSP00000375908; ENSG00000153823. [Q7Z2X4-4]
ENST00000409462; ENSP00000386826; ENSG00000153823. [Q7Z2X4-3]
GeneIDi55022.
KEGGihsa:55022.
UCSCiuc002vpr.4. human. [Q7Z2X4-1]
uc002vps.4. human. [Q7Z2X4-2]
uc002vpt.4. human. [Q7Z2X4-4]
uc002vpu.4. human. [Q7Z2X4-3]

Organism-specific databases

CTDi55022.
GeneCardsiGC02M229715.
HGNCiHGNC:26084. PID1.
HPAiHPA036103.
MIMi612930. gene.
neXtProtiNX_Q7Z2X4.
PharmGKBiPA162399462.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG260811.
GeneTreeiENSGT00510000048154.
HOGENOMiHOG000115472.
HOVERGENiHBG054924.
InParanoidiQ7Z2X4.
OMAiTVIFHEP.
OrthoDBiEOG7J4470.
PhylomeDBiQ7Z2X4.

Miscellaneous databases

ChiTaRSiPID1. human.
GenomeRNAii55022.
NextBioi58400.
PROiQ7Z2X4.
SOURCEiSearch...

Gene expression databases

BgeeiQ7Z2X4.
CleanExiHS_PID1.
ExpressionAtlasiQ7Z2X4. baseline and differential.
GenevisibleiQ7Z2X4. HS.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR011993. PH-like_dom.
IPR006020. PTB/PI_dom.
[Graphical view]
PfamiPF14719. PID_2. 1 hit.
[Graphical view]
PROSITEiPS01179. PID. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas."
    Yamada S., Ohira M., Horie H., Ando K., Takayasu H., Suzuki Y., Sugano S., Hirata T., Goto T., Matsunaga T., Hiyama E., Hayashi Y., Ando H., Suita S., Kaneko M., Sasaki F., Hashizume K., Ohnuma N., Nakagawara A.
    Oncogene 23:5901-5911(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
    Tissue: Liver.
  2. "Identification and characterization of NYGGF4, a novel gene containing a phosphotyrosine-binding (PTB) domain that stimulates 3T3-L1 preadipocytes proliferation."
    Wang B., Zhang M., Ni Y.-H., Liu F., Fan H.-Q., Fei L., Pan X.-Q., Guo M., Chen R.-H., Guo X.-R.
    Gene 379:132-140(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, INDUCTION, TISSUE SPECIFICITY.
    Tissue: Adipose tissue.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 4), VARIANT EXON-2 DUPLICATED.
    Tissue: Brain, Ileal mucosa and Tongue.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Ovary.
  6. "Identification of the ligands of protein interaction domains through a functional approach."
    Caratu G., Allegra D., Bimonte M., Schiattarella G.G., D'Ambrosio C., Scaloni A., Napolitano M., Russo T., Zambrano N.
    Mol. Cell. Proteomics 6:333-345(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN A COMPLEX WITH LRP1 AND CUBN, INTERACTION WITH LRP1 AND CUBN.

Entry informationi

Entry nameiPCLI1_HUMAN
AccessioniPrimary (citable) accession number: Q7Z2X4
Secondary accession number(s): B3KU82
, Q68CJ2, Q6ZUS3, Q8IXL0, Q9NWP6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: October 1, 2003
Last modified: July 22, 2015
This is version 90 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.