Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q7Z2X4 (PCLI1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 79. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
PTB-containing, cubilin and LRP1-interacting protein

Short name=P-CLI1
Alternative name(s):
Phosphotyrosine interaction domain-containing protein 1
Protein NYGGF4
Gene names
Name:PID1
Synonyms:NYGGF4, PCLI1
ORF Names:HMFN2073
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length250 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Increases proliferation of preadipocytes without affecting adipocytic differentiation. Ref.2

Subunit structure

Found in a complex with PID1/PCLI1, LRP1 and CUBNI. Interacts with LRP1 and CUBN. Ref.6

Subcellular location

Cytoplasm Ref.2.

Tissue specificity

Expressed in subcutaneous fat, heart, skeletal muscle, brain, colon, thymus, spleen, kidney, liver, small intestine, placenta, lung and peripheral blood leukocyte. Ref.2

Induction

Up-regulated in fat of obese subjects. Ref.2

Polymorphism

Some sequences seem to have a duplication of exon 2.

Sequence similarities

Contains 1 PID domain.

Sequence caution

The sequence BAD38656.1 differs from that shown. Reason: Erroneous initiation.

Ontologies

Keywords
   Cellular componentCytoplasm
   Coding sequence diversityAlternative splicing
Polymorphism
   PTMPhosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processcellular response to cytokine stimulus

Inferred from sequence or structural similarity. Source: BHF-UCL

cellular response to fatty acid

Inferred from sequence or structural similarity. Source: BHF-UCL

cellular response to interleukin-6

Inferred from sequence or structural similarity. Source: BHF-UCL

cellular response to leptin stimulus

Inferred from electronic annotation. Source: Ensembl

cellular response to tumor necrosis factor

Inferred from sequence or structural similarity. Source: BHF-UCL

energy reserve metabolic process

Inferred by curator PubMed 20165904. Source: BHF-UCL

mitochondrion morphogenesis

Inferred from mutant phenotype PubMed 20165904. Source: BHF-UCL

negative regulation of ATP biosynthetic process

Inferred from mutant phenotype PubMed 20165904. Source: BHF-UCL

negative regulation of establishment of protein localization to plasma membrane

Inferred from direct assay PubMed 19079291. Source: BHF-UCL

negative regulation of glucose import in response to insulin stimulus

Inferred from direct assay PubMed 19079291. Source: BHF-UCL

negative regulation of insulin receptor signaling pathway

Inferred from direct assay PubMed 19079291. Source: BHF-UCL

negative regulation of mitochondrial DNA replication

Inferred from mutant phenotype PubMed 20165904. Source: BHF-UCL

negative regulation of protein phosphorylation

Inferred from direct assay PubMed 19079291. Source: BHF-UCL

positive regulation of ATP biosynthetic process

Inferred from sequence or structural similarity. Source: BHF-UCL

positive regulation of fat cell proliferation

Inferred from direct assay Ref.2. Source: BHF-UCL

positive regulation of gene expression

Inferred from mutant phenotype PubMed 20165904. Source: BHF-UCL

positive regulation of reactive oxygen species metabolic process

Inferred from mutant phenotype PubMed 20165904. Source: BHF-UCL

positive regulation of transcription from RNA polymerase II promoter

Inferred from mutant phenotype PubMed 20165904. Source: BHF-UCL

regulation of G1/S transition of mitotic cell cycle

Inferred from direct assay Ref.2. Source: BHF-UCL

regulation of mitochondrial fusion

Inferred by curator PubMed 20165904. Source: BHF-UCL

regulation of mitochondrial membrane potential

Inferred from sequence or structural similarity. Source: BHF-UCL

regulation of reactive oxygen species metabolic process

Inferred from sequence or structural similarity. Source: BHF-UCL

   Cellular_componentcytoplasm

Inferred from direct assay Ref.2. Source: BHF-UCL

nucleus

Inferred from direct assay. Source: HPA

Complete GO annotation...

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q7Z2X4-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q7Z2X4-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MFSLPLSLPL...LIMIFLASGT → MPRIAGNHLM...LHFGLPASEM
Isoform 3 (identifier: Q7Z2X4-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-82: Missing.
     83-92: MKTRTHSGCK → MWQPATERLQ
Isoform 4 (identifier: Q7Z2X4-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MFSLPLSLPLCEDTAFLPSKCCSSHKTIKQARTLIMIFLASGT → MWQPATERLQ

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 250250PTB-containing, cubilin and LRP1-interacting protein
PRO_0000274900

Regions

Domain93 – 250158PID

Amino acid modifications

Modified residue2361Phosphoserine By similarity
Modified residue2471Phosphoserine By similarity

Natural variations

Alternative sequence1 – 8282Missing in isoform 3.
VSP_022909
Alternative sequence1 – 4343MFSLP…LASGT → MPRIAGNHLMLEESRTCSSP ELLDGVWPCQPLHFGLPASE M in isoform 2.
VSP_022910
Alternative sequence1 – 4343MFSLP…LASGT → MWQPATERLQ in isoform 4.
VSP_022911
Alternative sequence83 – 9210MKTRTHSGCK → MWQPATERLQ in isoform 3.
VSP_022912
Natural variant431T → THFQTMLKSKLNVLTLKKEP LPAVIFHEPEAIELCTTTPL MKTRTHSGCK in variant with duplicated exon 2.
VAR_030361

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 1, 2003. Version 1.
Checksum: 3C2F4AE5254D2885

FASTA25028,272
        10         20         30         40         50         60 
MFSLPLSLPL CEDTAFLPSK CCSSHKTIKQ ARTLIMIFLA SGTHFQTMLK SKLNVLTLKK 

        70         80         90        100        110        120 
EPLPAVIFHE PEAIELCTTT PLMKTRTHSG CKVTYLGKVS TTGMQFLSGC TEKPVIELWK 

       130        140        150        160        170        180 
KHTLAREDVF PANALLEIRP FQVWLHHLDH KGEATVHMDT FQVARIAYCT ADHNVSPNIF 

       190        200        210        220        230        240 
AWVYREINDD LSYQMDCHAV ECESKLEAKK LAHAMMEAFR KTFHSMKSDG RIHSNSSSEE 

       250 
VSQELESDDG 

« Hide

Isoform 2 [UniParc].

Checksum: D4D89783A12B71D3
Show »

FASTA24828,121
Isoform 3 [UniParc].

Checksum: 5A8DBD3D2B54E512
Show »

FASTA16819,285
Isoform 4 [UniParc].

Checksum: 247256CD547081F5
Show »

FASTA21724,829

References

« Hide 'large scale' references
[1]"Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas."
Yamada S., Ohira M., Horie H., Ando K., Takayasu H., Suzuki Y., Sugano S., Hirata T., Goto T., Matsunaga T., Hiyama E., Hayashi Y., Ando H., Suita S., Kaneko M., Sasaki F., Hashizume K., Ohnuma N., Nakagawara A.
Oncogene 23:5901-5911(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
Tissue: Liver.
[2]"Identification and characterization of NYGGF4, a novel gene containing a phosphotyrosine-binding (PTB) domain that stimulates 3T3-L1 preadipocytes proliferation."
Wang B., Zhang M., Ni Y.-H., Liu F., Fan H.-Q., Fei L., Pan X.-Q., Guo M., Chen R.-H., Guo X.-R.
Gene 379:132-140(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, INDUCTION, TISSUE SPECIFICITY.
Tissue: Adipose tissue.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 4), VARIANT EXON-2 DUPLICATED.
Tissue: Brain, Ileal mucosa and Tongue.
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Ovary.
[6]"Identification of the ligands of protein interaction domains through a functional approach."
Caratu G., Allegra D., Bimonte M., Schiattarella G.G., D'Ambrosio C., Scaloni A., Napolitano M., Russo T., Zambrano N.
Mol. Cell. Proteomics 6:333-345(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION IN A COMPLEX WITH LRP1 AND CUBN, INTERACTION WITH LRP1 AND CUBN.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB075874 mRNA. Translation: BAD38656.1. Different initiation.
AY317148 mRNA. Translation: AAP79437.1.
AK000708 mRNA. Translation: BAA91333.1.
AK096636 mRNA. Translation: BAG53344.1.
AK125359 mRNA. Translation: BAC86145.1.
CH471063 Genomic DNA. Translation: EAW70891.1.
BC040164 mRNA. Translation: AAH40164.1.
RefSeqNP_001094288.1. NM_001100818.1.
NP_060403.3. NM_017933.4.
UniGeneHs.745038.

3D structure databases

ProteinModelPortalQ7Z2X4.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid120352. 5 interactions.
STRING9606.ENSP00000375907.

PTM databases

PhosphoSiteQ7Z2X4.

Polymorphism databases

DMDM74713284.

Proteomic databases

PaxDbQ7Z2X4.
PeptideAtlasQ7Z2X4.
PRIDEQ7Z2X4.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000354069; ENSP00000283937; ENSG00000153823. [Q7Z2X4-1]
ENST00000392054; ENSP00000375907; ENSG00000153823. [Q7Z2X4-2]
ENST00000392055; ENSP00000375908; ENSG00000153823. [Q7Z2X4-4]
ENST00000409462; ENSP00000386826; ENSG00000153823. [Q7Z2X4-3]
GeneID55022.
KEGGhsa:55022.
UCSCuc002vpr.4. human. [Q7Z2X4-1]
uc002vps.4. human. [Q7Z2X4-2]
uc002vpt.4. human. [Q7Z2X4-4]
uc002vpu.4. human. [Q7Z2X4-3]

Organism-specific databases

CTD55022.
GeneCardsGC02M229715.
HGNCHGNC:26084. PID1.
HPAHPA036103.
MIM612930. gene.
neXtProtNX_Q7Z2X4.
PharmGKBPA162399462.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG260811.
HOGENOMHOG000115472.
HOVERGENHBG054924.
OMATVIFHEP.
OrthoDBEOG7J4470.
PhylomeDBQ7Z2X4.

Gene expression databases

ArrayExpressQ7Z2X4.
BgeeQ7Z2X4.
CleanExHS_PID1.
GenevestigatorQ7Z2X4.

Family and domain databases

Gene3D2.30.29.30. 1 hit.
InterProIPR011993. PH_like_dom.
IPR006020. PTB/PI_dom.
[Graphical view]
PROSITEPS01179. PID. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSPID1. human.
GenomeRNAi55022.
NextBio58400.
PROQ7Z2X4.
SOURCESearch...

Entry information

Entry namePCLI1_HUMAN
AccessionPrimary (citable) accession number: Q7Z2X4
Secondary accession number(s): B3KU82 expand/collapse secondary AC list , Q68CJ2, Q6ZUS3, Q8IXL0, Q9NWP6
Entry history
Integrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: October 1, 2003
Last modified: April 16, 2014
This is version 79 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 2

Human chromosome 2: entries, gene names and cross-references to MIM