Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q7Z2X4

- PCLI1_HUMAN

UniProt

Q7Z2X4 - PCLI1_HUMAN

Protein

PTB-containing, cubilin and LRP1-interacting protein

Gene

PID1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 83 (01 Oct 2014)
      Sequence version 1 (01 Oct 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Increases proliferation of preadipocytes without affecting adipocytic differentiation.1 Publication

    GO - Biological processi

    1. cellular response to cytokine stimulus Source: BHF-UCL
    2. cellular response to fatty acid Source: BHF-UCL
    3. cellular response to interleukin-6 Source: BHF-UCL
    4. cellular response to leptin stimulus Source: Ensembl
    5. cellular response to tumor necrosis factor Source: BHF-UCL
    6. energy reserve metabolic process Source: BHF-UCL
    7. mitochondrion morphogenesis Source: BHF-UCL
    8. negative regulation of ATP biosynthetic process Source: BHF-UCL
    9. negative regulation of establishment of protein localization to plasma membrane Source: BHF-UCL
    10. negative regulation of glucose import in response to insulin stimulus Source: BHF-UCL
    11. negative regulation of insulin receptor signaling pathway Source: BHF-UCL
    12. negative regulation of mitochondrial DNA replication Source: BHF-UCL
    13. negative regulation of protein phosphorylation Source: BHF-UCL
    14. positive regulation of ATP biosynthetic process Source: BHF-UCL
    15. positive regulation of fat cell proliferation Source: BHF-UCL
    16. positive regulation of gene expression Source: BHF-UCL
    17. positive regulation of reactive oxygen species metabolic process Source: BHF-UCL
    18. positive regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
    19. regulation of G1/S transition of mitotic cell cycle Source: BHF-UCL
    20. regulation of mitochondrial fusion Source: BHF-UCL
    21. regulation of mitochondrial membrane potential Source: BHF-UCL
    22. regulation of reactive oxygen species metabolic process Source: BHF-UCL

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    PTB-containing, cubilin and LRP1-interacting protein
    Short name:
    P-CLI1
    Alternative name(s):
    Phosphotyrosine interaction domain-containing protein 1
    Protein NYGGF4
    Gene namesi
    Name:PID1
    Synonyms:NYGGF4, PCLI1
    ORF Names:HMFN2073
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:26084. PID1.

    Subcellular locationi

    Cytoplasm 1 Publication

    GO - Cellular componenti

    1. cytoplasm Source: BHF-UCL
    2. nucleus Source: HPA

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA162399462.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 250250PTB-containing, cubilin and LRP1-interacting proteinPRO_0000274900Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei236 – 2361PhosphoserineBy similarity
    Modified residuei247 – 2471PhosphoserineBy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    PaxDbiQ7Z2X4.
    PeptideAtlasiQ7Z2X4.
    PRIDEiQ7Z2X4.

    PTM databases

    PhosphoSiteiQ7Z2X4.

    Expressioni

    Tissue specificityi

    Expressed in subcutaneous fat, heart, skeletal muscle, brain, colon, thymus, spleen, kidney, liver, small intestine, placenta, lung and peripheral blood leukocyte.1 Publication

    Inductioni

    Up-regulated in fat of obese subjects.1 Publication

    Gene expression databases

    ArrayExpressiQ7Z2X4.
    BgeeiQ7Z2X4.
    CleanExiHS_PID1.
    GenevestigatoriQ7Z2X4.

    Organism-specific databases

    HPAiHPA036103.

    Interactioni

    Subunit structurei

    Found in a complex with PID1/PCLI1, LRP1 and CUBNI. Interacts with LRP1 and CUBN.1 Publication

    Protein-protein interaction databases

    BioGridi120352. 5 interactions.
    STRINGi9606.ENSP00000375907.

    Structurei

    3D structure databases

    ProteinModelPortaliQ7Z2X4.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini93 – 250158PIDPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 PID domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG260811.
    HOGENOMiHOG000115472.
    HOVERGENiHBG054924.
    OMAiLEESRTC.
    OrthoDBiEOG7J4470.
    PhylomeDBiQ7Z2X4.

    Family and domain databases

    Gene3Di2.30.29.30. 1 hit.
    InterProiIPR011993. PH_like_dom.
    IPR006020. PTB/PI_dom.
    [Graphical view]
    PfamiPF14719. PID_2. 1 hit.
    [Graphical view]
    PROSITEiPS01179. PID. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q7Z2X4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MFSLPLSLPL CEDTAFLPSK CCSSHKTIKQ ARTLIMIFLA SGTHFQTMLK    50
    SKLNVLTLKK EPLPAVIFHE PEAIELCTTT PLMKTRTHSG CKVTYLGKVS 100
    TTGMQFLSGC TEKPVIELWK KHTLAREDVF PANALLEIRP FQVWLHHLDH 150
    KGEATVHMDT FQVARIAYCT ADHNVSPNIF AWVYREINDD LSYQMDCHAV 200
    ECESKLEAKK LAHAMMEAFR KTFHSMKSDG RIHSNSSSEE VSQELESDDG 250
    Length:250
    Mass (Da):28,272
    Last modified:October 1, 2003 - v1
    Checksum:i3C2F4AE5254D2885
    GO
    Isoform 2 (identifier: Q7Z2X4-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-43: MFSLPLSLPL...LIMIFLASGT → MPRIAGNHLM...LHFGLPASEM

    Show »
    Length:248
    Mass (Da):28,121
    Checksum:iD4D89783A12B71D3
    GO
    Isoform 3 (identifier: Q7Z2X4-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-82: Missing.
         83-92: MKTRTHSGCK → MWQPATERLQ

    Show »
    Length:168
    Mass (Da):19,285
    Checksum:i5A8DBD3D2B54E512
    GO
    Isoform 4 (identifier: Q7Z2X4-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-43: MFSLPLSLPLCEDTAFLPSKCCSSHKTIKQARTLIMIFLASGT → MWQPATERLQ

    Show »
    Length:217
    Mass (Da):24,829
    Checksum:i247256CD547081F5
    GO

    Sequence cautioni

    The sequence BAD38656.1 differs from that shown. Reason: Erroneous initiation.

    Polymorphismi

    Some sequences seem to have a duplication of exon 2.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti43 – 431T → THFQTMLKSKLNVLTLKKEP LPAVIFHEPEAIELCTTTPL MKTRTHSGCK in variant with duplicated exon 2.
    VAR_030361

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 8282Missing in isoform 3. 1 PublicationVSP_022909Add
    BLAST
    Alternative sequencei1 – 4343MFSLP…LASGT → MPRIAGNHLMLEESRTCSSP ELLDGVWPCQPLHFGLPASE M in isoform 2. 1 PublicationVSP_022910Add
    BLAST
    Alternative sequencei1 – 4343MFSLP…LASGT → MWQPATERLQ in isoform 4. 2 PublicationsVSP_022911Add
    BLAST
    Alternative sequencei83 – 9210MKTRTHSGCK → MWQPATERLQ in isoform 3. 1 PublicationVSP_022912

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB075874 mRNA. Translation: BAD38656.1. Different initiation.
    AY317148 mRNA. Translation: AAP79437.1.
    AK000708 mRNA. Translation: BAA91333.1.
    AK096636 mRNA. Translation: BAG53344.1.
    AK125359 mRNA. Translation: BAC86145.1.
    CH471063 Genomic DNA. Translation: EAW70891.1.
    BC040164 mRNA. Translation: AAH40164.1.
    CCDSiCCDS2471.1. [Q7Z2X4-2]
    CCDS42830.1. [Q7Z2X4-4]
    RefSeqiNP_001094288.1. NM_001100818.1. [Q7Z2X4-4]
    NP_060403.3. NM_017933.4. [Q7Z2X4-2]
    UniGeneiHs.745038.

    Genome annotation databases

    EnsembliENST00000354069; ENSP00000283937; ENSG00000153823. [Q7Z2X4-1]
    ENST00000392054; ENSP00000375907; ENSG00000153823. [Q7Z2X4-2]
    ENST00000392055; ENSP00000375908; ENSG00000153823. [Q7Z2X4-4]
    ENST00000409462; ENSP00000386826; ENSG00000153823. [Q7Z2X4-3]
    GeneIDi55022.
    KEGGihsa:55022.
    UCSCiuc002vpr.4. human. [Q7Z2X4-1]
    uc002vps.4. human. [Q7Z2X4-2]
    uc002vpt.4. human. [Q7Z2X4-4]
    uc002vpu.4. human. [Q7Z2X4-3]

    Polymorphism databases

    DMDMi74713284.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB075874 mRNA. Translation: BAD38656.1 . Different initiation.
    AY317148 mRNA. Translation: AAP79437.1 .
    AK000708 mRNA. Translation: BAA91333.1 .
    AK096636 mRNA. Translation: BAG53344.1 .
    AK125359 mRNA. Translation: BAC86145.1 .
    CH471063 Genomic DNA. Translation: EAW70891.1 .
    BC040164 mRNA. Translation: AAH40164.1 .
    CCDSi CCDS2471.1. [Q7Z2X4-2 ]
    CCDS42830.1. [Q7Z2X4-4 ]
    RefSeqi NP_001094288.1. NM_001100818.1. [Q7Z2X4-4 ]
    NP_060403.3. NM_017933.4. [Q7Z2X4-2 ]
    UniGenei Hs.745038.

    3D structure databases

    ProteinModelPortali Q7Z2X4.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120352. 5 interactions.
    STRINGi 9606.ENSP00000375907.

    PTM databases

    PhosphoSitei Q7Z2X4.

    Polymorphism databases

    DMDMi 74713284.

    Proteomic databases

    PaxDbi Q7Z2X4.
    PeptideAtlasi Q7Z2X4.
    PRIDEi Q7Z2X4.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000354069 ; ENSP00000283937 ; ENSG00000153823 . [Q7Z2X4-1 ]
    ENST00000392054 ; ENSP00000375907 ; ENSG00000153823 . [Q7Z2X4-2 ]
    ENST00000392055 ; ENSP00000375908 ; ENSG00000153823 . [Q7Z2X4-4 ]
    ENST00000409462 ; ENSP00000386826 ; ENSG00000153823 . [Q7Z2X4-3 ]
    GeneIDi 55022.
    KEGGi hsa:55022.
    UCSCi uc002vpr.4. human. [Q7Z2X4-1 ]
    uc002vps.4. human. [Q7Z2X4-2 ]
    uc002vpt.4. human. [Q7Z2X4-4 ]
    uc002vpu.4. human. [Q7Z2X4-3 ]

    Organism-specific databases

    CTDi 55022.
    GeneCardsi GC02M229715.
    HGNCi HGNC:26084. PID1.
    HPAi HPA036103.
    MIMi 612930. gene.
    neXtProti NX_Q7Z2X4.
    PharmGKBi PA162399462.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG260811.
    HOGENOMi HOG000115472.
    HOVERGENi HBG054924.
    OMAi LEESRTC.
    OrthoDBi EOG7J4470.
    PhylomeDBi Q7Z2X4.

    Miscellaneous databases

    ChiTaRSi PID1. human.
    GenomeRNAii 55022.
    NextBioi 58400.
    PROi Q7Z2X4.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q7Z2X4.
    Bgeei Q7Z2X4.
    CleanExi HS_PID1.
    Genevestigatori Q7Z2X4.

    Family and domain databases

    Gene3Di 2.30.29.30. 1 hit.
    InterProi IPR011993. PH_like_dom.
    IPR006020. PTB/PI_dom.
    [Graphical view ]
    Pfami PF14719. PID_2. 1 hit.
    [Graphical view ]
    PROSITEi PS01179. PID. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas."
      Yamada S., Ohira M., Horie H., Ando K., Takayasu H., Suzuki Y., Sugano S., Hirata T., Goto T., Matsunaga T., Hiyama E., Hayashi Y., Ando H., Suita S., Kaneko M., Sasaki F., Hashizume K., Ohnuma N., Nakagawara A.
      Oncogene 23:5901-5911(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
      Tissue: Liver.
    2. "Identification and characterization of NYGGF4, a novel gene containing a phosphotyrosine-binding (PTB) domain that stimulates 3T3-L1 preadipocytes proliferation."
      Wang B., Zhang M., Ni Y.-H., Liu F., Fan H.-Q., Fei L., Pan X.-Q., Guo M., Chen R.-H., Guo X.-R.
      Gene 379:132-140(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, INDUCTION, TISSUE SPECIFICITY.
      Tissue: Adipose tissue.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 4), VARIANT EXON-2 DUPLICATED.
      Tissue: Brain, Ileal mucosa and Tongue.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Ovary.
    6. "Identification of the ligands of protein interaction domains through a functional approach."
      Caratu G., Allegra D., Bimonte M., Schiattarella G.G., D'Ambrosio C., Scaloni A., Napolitano M., Russo T., Zambrano N.
      Mol. Cell. Proteomics 6:333-345(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION IN A COMPLEX WITH LRP1 AND CUBN, INTERACTION WITH LRP1 AND CUBN.

    Entry informationi

    Entry nameiPCLI1_HUMAN
    AccessioniPrimary (citable) accession number: Q7Z2X4
    Secondary accession number(s): B3KU82
    , Q68CJ2, Q6ZUS3, Q8IXL0, Q9NWP6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 6, 2007
    Last sequence update: October 1, 2003
    Last modified: October 1, 2014
    This is version 83 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3