Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q7Z2X4

- PCLI1_HUMAN

UniProt

Q7Z2X4 - PCLI1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

PTB-containing, cubilin and LRP1-interacting protein

Gene

PID1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Increases proliferation of preadipocytes without affecting adipocytic differentiation.1 Publication

GO - Biological processi

  1. cellular response to cytokine stimulus Source: BHF-UCL
  2. cellular response to fatty acid Source: BHF-UCL
  3. cellular response to interleukin-6 Source: BHF-UCL
  4. cellular response to leptin stimulus Source: Ensembl
  5. cellular response to tumor necrosis factor Source: BHF-UCL
  6. energy reserve metabolic process Source: BHF-UCL
  7. mitochondrion morphogenesis Source: BHF-UCL
  8. negative regulation of ATP biosynthetic process Source: BHF-UCL
  9. negative regulation of establishment of protein localization to plasma membrane Source: BHF-UCL
  10. negative regulation of glucose import in response to insulin stimulus Source: BHF-UCL
  11. negative regulation of insulin receptor signaling pathway Source: BHF-UCL
  12. negative regulation of mitochondrial DNA replication Source: BHF-UCL
  13. negative regulation of protein phosphorylation Source: BHF-UCL
  14. positive regulation of ATP biosynthetic process Source: BHF-UCL
  15. positive regulation of fat cell proliferation Source: BHF-UCL
  16. positive regulation of gene expression Source: BHF-UCL
  17. positive regulation of reactive oxygen species metabolic process Source: BHF-UCL
  18. positive regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
  19. regulation of G1/S transition of mitotic cell cycle Source: BHF-UCL
  20. regulation of mitochondrial fusion Source: BHF-UCL
  21. regulation of mitochondrial membrane potential Source: BHF-UCL
  22. regulation of reactive oxygen species metabolic process Source: BHF-UCL
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
PTB-containing, cubilin and LRP1-interacting protein
Short name:
P-CLI1
Alternative name(s):
Phosphotyrosine interaction domain-containing protein 1
Protein NYGGF4
Gene namesi
Name:PID1
Synonyms:NYGGF4, PCLI1
ORF Names:HMFN2073
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:26084. PID1.

Subcellular locationi

Cytoplasm 1 Publication

GO - Cellular componenti

  1. cytoplasm Source: BHF-UCL
  2. nucleus Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162399462.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 250250PTB-containing, cubilin and LRP1-interacting proteinPRO_0000274900Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei236 – 2361PhosphoserineBy similarity
Modified residuei247 – 2471PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ7Z2X4.
PeptideAtlasiQ7Z2X4.
PRIDEiQ7Z2X4.

PTM databases

PhosphoSiteiQ7Z2X4.

Expressioni

Tissue specificityi

Expressed in subcutaneous fat, heart, skeletal muscle, brain, colon, thymus, spleen, kidney, liver, small intestine, placenta, lung and peripheral blood leukocyte.1 Publication

Inductioni

Up-regulated in fat of obese subjects.1 Publication

Gene expression databases

BgeeiQ7Z2X4.
CleanExiHS_PID1.
ExpressionAtlasiQ7Z2X4. baseline and differential.
GenevestigatoriQ7Z2X4.

Organism-specific databases

HPAiHPA036103.

Interactioni

Subunit structurei

Found in a complex with PID1/PCLI1, LRP1 and CUBNI. Interacts with LRP1 and CUBN.1 Publication

Protein-protein interaction databases

BioGridi120352. 5 interactions.
STRINGi9606.ENSP00000375907.

Structurei

3D structure databases

ProteinModelPortaliQ7Z2X4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini93 – 250158PIDPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 PID domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG260811.
GeneTreeiENSGT00510000048154.
HOGENOMiHOG000115472.
HOVERGENiHBG054924.
InParanoidiQ7Z2X4.
OMAiLEESRTC.
OrthoDBiEOG7J4470.
PhylomeDBiQ7Z2X4.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR011993. PH_like_dom.
IPR006020. PTB/PI_dom.
[Graphical view]
PfamiPF14719. PID_2. 1 hit.
[Graphical view]
PROSITEiPS01179. PID. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q7Z2X4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFSLPLSLPL CEDTAFLPSK CCSSHKTIKQ ARTLIMIFLA SGTHFQTMLK
60 70 80 90 100
SKLNVLTLKK EPLPAVIFHE PEAIELCTTT PLMKTRTHSG CKVTYLGKVS
110 120 130 140 150
TTGMQFLSGC TEKPVIELWK KHTLAREDVF PANALLEIRP FQVWLHHLDH
160 170 180 190 200
KGEATVHMDT FQVARIAYCT ADHNVSPNIF AWVYREINDD LSYQMDCHAV
210 220 230 240 250
ECESKLEAKK LAHAMMEAFR KTFHSMKSDG RIHSNSSSEE VSQELESDDG
Length:250
Mass (Da):28,272
Last modified:October 1, 2003 - v1
Checksum:i3C2F4AE5254D2885
GO
Isoform 2 (identifier: Q7Z2X4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MFSLPLSLPL...LIMIFLASGT → MPRIAGNHLM...LHFGLPASEM

Show »
Length:248
Mass (Da):28,121
Checksum:iD4D89783A12B71D3
GO
Isoform 3 (identifier: Q7Z2X4-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-82: Missing.
     83-92: MKTRTHSGCK → MWQPATERLQ

Show »
Length:168
Mass (Da):19,285
Checksum:i5A8DBD3D2B54E512
GO
Isoform 4 (identifier: Q7Z2X4-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MFSLPLSLPLCEDTAFLPSKCCSSHKTIKQARTLIMIFLASGT → MWQPATERLQ

Show »
Length:217
Mass (Da):24,829
Checksum:i247256CD547081F5
GO

Sequence cautioni

The sequence BAD38656.1 differs from that shown. Reason: Erroneous initiation.

Polymorphismi

Some sequences seem to have a duplication of exon 2.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti43 – 431T → THFQTMLKSKLNVLTLKKEP LPAVIFHEPEAIELCTTTPL MKTRTHSGCK in variant with duplicated exon 2.
VAR_030361

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 8282Missing in isoform 3. 1 PublicationVSP_022909Add
BLAST
Alternative sequencei1 – 4343MFSLP…LASGT → MPRIAGNHLMLEESRTCSSP ELLDGVWPCQPLHFGLPASE M in isoform 2. 1 PublicationVSP_022910Add
BLAST
Alternative sequencei1 – 4343MFSLP…LASGT → MWQPATERLQ in isoform 4. 2 PublicationsVSP_022911Add
BLAST
Alternative sequencei83 – 9210MKTRTHSGCK → MWQPATERLQ in isoform 3. 1 PublicationVSP_022912

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB075874 mRNA. Translation: BAD38656.1. Different initiation.
AY317148 mRNA. Translation: AAP79437.1.
AK000708 mRNA. Translation: BAA91333.1.
AK096636 mRNA. Translation: BAG53344.1.
AK125359 mRNA. Translation: BAC86145.1.
CH471063 Genomic DNA. Translation: EAW70891.1.
BC040164 mRNA. Translation: AAH40164.1.
CCDSiCCDS2471.1. [Q7Z2X4-2]
CCDS42830.1. [Q7Z2X4-4]
RefSeqiNP_001094288.1. NM_001100818.1. [Q7Z2X4-4]
NP_060403.3. NM_017933.4. [Q7Z2X4-2]
UniGeneiHs.745038.

Genome annotation databases

EnsembliENST00000354069; ENSP00000283937; ENSG00000153823. [Q7Z2X4-1]
ENST00000392054; ENSP00000375907; ENSG00000153823. [Q7Z2X4-2]
ENST00000392055; ENSP00000375908; ENSG00000153823. [Q7Z2X4-4]
ENST00000409462; ENSP00000386826; ENSG00000153823. [Q7Z2X4-3]
GeneIDi55022.
KEGGihsa:55022.
UCSCiuc002vpr.4. human. [Q7Z2X4-1]
uc002vps.4. human. [Q7Z2X4-2]
uc002vpt.4. human. [Q7Z2X4-4]
uc002vpu.4. human. [Q7Z2X4-3]

Polymorphism databases

DMDMi74713284.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB075874 mRNA. Translation: BAD38656.1 . Different initiation.
AY317148 mRNA. Translation: AAP79437.1 .
AK000708 mRNA. Translation: BAA91333.1 .
AK096636 mRNA. Translation: BAG53344.1 .
AK125359 mRNA. Translation: BAC86145.1 .
CH471063 Genomic DNA. Translation: EAW70891.1 .
BC040164 mRNA. Translation: AAH40164.1 .
CCDSi CCDS2471.1. [Q7Z2X4-2 ]
CCDS42830.1. [Q7Z2X4-4 ]
RefSeqi NP_001094288.1. NM_001100818.1. [Q7Z2X4-4 ]
NP_060403.3. NM_017933.4. [Q7Z2X4-2 ]
UniGenei Hs.745038.

3D structure databases

ProteinModelPortali Q7Z2X4.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120352. 5 interactions.
STRINGi 9606.ENSP00000375907.

PTM databases

PhosphoSitei Q7Z2X4.

Polymorphism databases

DMDMi 74713284.

Proteomic databases

PaxDbi Q7Z2X4.
PeptideAtlasi Q7Z2X4.
PRIDEi Q7Z2X4.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000354069 ; ENSP00000283937 ; ENSG00000153823 . [Q7Z2X4-1 ]
ENST00000392054 ; ENSP00000375907 ; ENSG00000153823 . [Q7Z2X4-2 ]
ENST00000392055 ; ENSP00000375908 ; ENSG00000153823 . [Q7Z2X4-4 ]
ENST00000409462 ; ENSP00000386826 ; ENSG00000153823 . [Q7Z2X4-3 ]
GeneIDi 55022.
KEGGi hsa:55022.
UCSCi uc002vpr.4. human. [Q7Z2X4-1 ]
uc002vps.4. human. [Q7Z2X4-2 ]
uc002vpt.4. human. [Q7Z2X4-4 ]
uc002vpu.4. human. [Q7Z2X4-3 ]

Organism-specific databases

CTDi 55022.
GeneCardsi GC02M229715.
HGNCi HGNC:26084. PID1.
HPAi HPA036103.
MIMi 612930. gene.
neXtProti NX_Q7Z2X4.
PharmGKBi PA162399462.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG260811.
GeneTreei ENSGT00510000048154.
HOGENOMi HOG000115472.
HOVERGENi HBG054924.
InParanoidi Q7Z2X4.
OMAi LEESRTC.
OrthoDBi EOG7J4470.
PhylomeDBi Q7Z2X4.

Miscellaneous databases

ChiTaRSi PID1. human.
GenomeRNAii 55022.
NextBioi 58400.
PROi Q7Z2X4.
SOURCEi Search...

Gene expression databases

Bgeei Q7Z2X4.
CleanExi HS_PID1.
ExpressionAtlasi Q7Z2X4. baseline and differential.
Genevestigatori Q7Z2X4.

Family and domain databases

Gene3Di 2.30.29.30. 1 hit.
InterProi IPR011993. PH_like_dom.
IPR006020. PTB/PI_dom.
[Graphical view ]
Pfami PF14719. PID_2. 1 hit.
[Graphical view ]
PROSITEi PS01179. PID. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas."
    Yamada S., Ohira M., Horie H., Ando K., Takayasu H., Suzuki Y., Sugano S., Hirata T., Goto T., Matsunaga T., Hiyama E., Hayashi Y., Ando H., Suita S., Kaneko M., Sasaki F., Hashizume K., Ohnuma N., Nakagawara A.
    Oncogene 23:5901-5911(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
    Tissue: Liver.
  2. "Identification and characterization of NYGGF4, a novel gene containing a phosphotyrosine-binding (PTB) domain that stimulates 3T3-L1 preadipocytes proliferation."
    Wang B., Zhang M., Ni Y.-H., Liu F., Fan H.-Q., Fei L., Pan X.-Q., Guo M., Chen R.-H., Guo X.-R.
    Gene 379:132-140(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, INDUCTION, TISSUE SPECIFICITY.
    Tissue: Adipose tissue.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 4), VARIANT EXON-2 DUPLICATED.
    Tissue: Brain, Ileal mucosa and Tongue.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Ovary.
  6. "Identification of the ligands of protein interaction domains through a functional approach."
    Caratu G., Allegra D., Bimonte M., Schiattarella G.G., D'Ambrosio C., Scaloni A., Napolitano M., Russo T., Zambrano N.
    Mol. Cell. Proteomics 6:333-345(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN A COMPLEX WITH LRP1 AND CUBN, INTERACTION WITH LRP1 AND CUBN.

Entry informationi

Entry nameiPCLI1_HUMAN
AccessioniPrimary (citable) accession number: Q7Z2X4
Secondary accession number(s): B3KU82
, Q68CJ2, Q6ZUS3, Q8IXL0, Q9NWP6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: October 1, 2003
Last modified: October 29, 2014
This is version 84 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3