Q7Z2X4 (PCLI1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 71.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: PTB-containing, cubilin and LRP1-interacting protein Short name=P-CLI1 Alternative name(s): Phosphotyrosine interaction domain-containing protein 1 Protein NYGGF4 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 250 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Increases proliferation of preadipocytes without affecting adipocytic differentiation. Ref.2 |
| Subunit structure | Found in a complex with PID1/PCLI1, LRP1 and CUBNI. Interacts with LRP1 and CUBN. Ref.6 |
| Subcellular location | |
| Tissue specificity | Expressed in subcutaneous fat, heart, skeletal muscle, brain, colon, thymus, spleen, kidney, liver, small intestine, placenta, lung and peripheral blood leukocyte. Ref.2 |
| Induction | Up-regulated in fat of obese subjects. Ref.2 |
| Polymorphism | Some sequences seem to have a duplication of exon 2. |
| Sequence similarities | Contains 1 PID domain. |
| Sequence caution | The sequence BAD38656.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q7Z2X4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q7Z2X4-2) The sequence of this isoform differs from the canonical sequence as follows: 1-43: MFSLPLSLPL...LIMIFLASGT → MPRIAGNHLM...LHFGLPASEM | ||||||
| Isoform 3 (identifier: Q7Z2X4-3) The sequence of this isoform differs from the canonical sequence as follows: 1-82: Missing. 83-92: MKTRTHSGCK → MWQPATERLQ | ||||||
| Isoform 4 (identifier: Q7Z2X4-4) The sequence of this isoform differs from the canonical sequence as follows: 1-43: MFSLPLSLPLCEDTAFLPSKCCSSHKTIKQARTLIMIFLASGT → MWQPATERLQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 250 | 250 | PTB-containing, cubilin and LRP1-interacting protein | PRO_0000274900 | |||||
Regions | |||||||||
| Domain | 93 – 250 | 158 | PID | ||||||
Amino acid modifications | |||||||||
| Modified residue | 236 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 247 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 82 | 82 | Missing in isoform 3. | VSP_022909 | |||||
| Alternative sequence | 1 – 43 | 43 | MFSLP…LASGT → MPRIAGNHLMLEESRTCSSP ELLDGVWPCQPLHFGLPASE M in isoform 2. | VSP_022910 | |||||
| Alternative sequence | 1 – 43 | 43 | MFSLP…LASGT → MWQPATERLQ in isoform 4. | VSP_022911 | |||||
| Alternative sequence | 83 – 92 | 10 | MKTRTHSGCK → MWQPATERLQ in isoform 3. | VSP_022912 | |||||
| Natural variant | 43 | 1 | T → THFQTMLKSKLNVLTLKKEP LPAVIFHEPEAIELCTTTPL MKTRTHSGCK in variant with duplicated exon 2. | VAR_030361 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas." Yamada S., Ohira M., Horie H., Ando K., Takayasu H., Suzuki Y., Sugano S., Hirata T., Goto T., Matsunaga T., Hiyama E., Hayashi Y., Ando H., Suita S., Kaneko M., Sasaki F., Hashizume K., Ohnuma N., Nakagawara A. Oncogene 23:5901-5911(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). Tissue: Liver. |
| [2] | "Identification and characterization of NYGGF4, a novel gene containing a phosphotyrosine-binding (PTB) domain that stimulates 3T3-L1 preadipocytes proliferation." Wang B., Zhang M., Ni Y.-H., Liu F., Fan H.-Q., Fei L., Pan X.-Q., Guo M., Chen R.-H., Guo X.-R. Gene 379:132-140(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, INDUCTION, TISSUE SPECIFICITY. Tissue: Adipose tissue. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 4), VARIANT EXON-2 DUPLICATED. Tissue: Brain, Ileal mucosa and Tongue. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Ovary. |
| [6] | "Identification of the ligands of protein interaction domains through a functional approach." Caratu G., Allegra D., Bimonte M., Schiattarella G.G., D'Ambrosio C., Scaloni A., Napolitano M., Russo T., Zambrano N. Mol. Cell. Proteomics 6:333-345(2007) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN A COMPLEX WITH LRP1 AND CUBN, INTERACTION WITH LRP1 AND CUBN. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB075874 mRNA. Translation: BAD38656.1. Different initiation. AY317148 mRNA. Translation: AAP79437.1. AK000708 mRNA. Translation: BAA91333.1. AK096636 mRNA. Translation: BAG53344.1. AK125359 mRNA. Translation: BAC86145.1. CH471063 Genomic DNA. Translation: EAW70891.1. BC040164 mRNA. Translation: AAH40164.1. |
| IPI | IPI00384947. IPI00744724. IPI00792193. IPI00827514. |
| RefSeq | NP_001094288.1. NM_001100818.1. NP_060403.3. NM_017933.4. |
| UniGene | Hs.409352. |
3D structure databases | |
| ProteinModelPortal | Q7Z2X4. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000375907. |
PTM databases | |
| PhosphoSite | Q7Z2X4. |
Polymorphism databases | |
| DMDM | 74713284. |
Proteomic databases | |
| PaxDb | Q7Z2X4. |
| PeptideAtlas | Q7Z2X4. |
| PRIDE | Q7Z2X4. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000354069; ENSP00000283937; ENSG00000153823. ENST00000392054; ENSP00000375907; ENSG00000153823. ENST00000392055; ENSP00000375908; ENSG00000153823. ENST00000409462; ENSP00000386826; ENSG00000153823. |
| GeneID | 55022. |
| KEGG | hsa:55022. |
| UCSC | uc002vpr.4. human. uc002vps.4. human. uc002vpt.4. human. uc002vpu.4. human. |
Organism-specific databases | |
| CTD | 55022. |
| GeneCards | GC02M229715. |
| HGNC | HGNC:26084. PID1. |
| HPA | HPA036103. |
| MIM | 612930. gene. |
| neXtProt | NX_Q7Z2X4. |
| PharmGKB | PA162399462. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG260811. |
| HOGENOM | HOG000115472. |
| HOVERGEN | HBG054924. |
| OMA | TVIFHEP. |
| PhylomeDB | Q7Z2X4. |
Gene expression databases | |
| ArrayExpress | Q7Z2X4. |
| Bgee | Q7Z2X4. |
| CleanEx | HS_PID1. |
| Genevestigator | Q7Z2X4. |
Family and domain databases | |
| Gene3D | 2.30.29.30. 1 hit. |
| InterPro | IPR011993. PH_like_dom. IPR006020. PTyr_interaction_dom. [Graphical view] |
| Pfam | PF00640. PID. 1 hit. [Graphical view] |
| PROSITE | PS01179. PID. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | PID1. human. |
| GenomeRNAi | 55022. |
| NextBio | 58400. |
| SOURCE | Search... |
Entry information
| Entry name | PCLI1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q7Z2X4 Secondary accession number(s): B3KU82 Q9NWP6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
