Q7Z2E3 (APTX_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
December 14, 2011.
Version 92.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Aprataxin EC=3.-.-.- Alternative name(s): Forkhead-associated domain histidine triad-like protein Short name=FHA-HIT | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 356 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | DNA-binding protein involved in single-strand DNA break repair, double-strand DNA break repair and base excision repair. Resolves abortive DNA ligation intermediates formed either at base excision sites, or when DNA ligases attempt to repair non-ligatable breaks induced by reactive oxygen species. Catalyzes the release of adenylate groups covalently linked to 5'-phosphate termini, resulting in the production of 5'-phosphate termini that can be efficiently rejoined. Also able to hydrolyze adenosine 5'-monophosphoramidate (AMP-NH2) and diadenosine tetraphosphate (AppppA), but with lower catalytic activity. Ref.11 Ref.13 Ref.15 Ref.16 Ref.17 |
| Subunit structure | Interacts with single-strand break repair proteins XRCC1, XRCC4, ADPRT and p53/TP53. Interacts with NCL. Interacts (via FHA-like domain) with MDC1 (phosphorylated). Ref.11 Ref.12 Ref.13 Ref.14 Ref.18 |
| Subcellular location | Nucleus › nucleoplasm. Nucleus › nucleolus. Note: Upon genotoxic stress, colocalizes with XRCC1 at sites of DNA damage. Colocalizes with MDC1 at sites of DNA double-strand breaks. Interaction with NCL is required for nucleolar localization. Ref.11 Ref.12 Ref.13 Ref.14 Ref.18 |
| Tissue specificity | Widely expressed. In brain, it is expressed in the posterior cortex, cerebellum, hippocampus and olfactory bulb. Isoform 1 is highly expressed in the cerebral cortex and cerebellum, compared to isoform 2. Ref.9 Ref.10 Ref.11 |
| Domain | The histidine triad, also called HIT motif, forms part of the binding loop for the alpha-phosphate of purine mononucleotide By similarity. The FHA-like domain mediates interaction with NCL; XRCC1 and XRCC4. The HIT domain is required for enzymatic activity. The C2H2-type zinc finger mediates DNA-binding. |
| Involvement in disease | Defects in APTX are the cause of ataxia-oculomotor apraxia syndrome (AOA) [MIM:208920]. AOA is an autosomal recessive syndrome characterized by early-onset cerebellar ataxia, oculomotor apraxia, early areflexia and late peripheral neuropathy. Ref.9 Ref.10 Ref.19 Ref.20 Ref.21 Ref.22 Defects in APTX are a cause of coenzyme Q10 deficiency (COQ10D) [MIM:607426]. Coenzyme Q10 deficiency is an autosomal recessive disorder with variable manifestations. It can be associated with three main clinical phenotypes: a predominantly myopathic form with central nervous system involvement, an infantile encephalomyopathy with renal dysfunction and an ataxic form with cerebellar atrophy. |
| Sequence similarities | Contains 1 C2H2-type zinc finger. Contains 1 FHA-like domain. Contains 1 HIT domain. |
| Biophysicochemical properties | Kinetic parameters: KM=18 µM for AppppA KM=837.5 µM for AMP-NH2 |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| PARP1 | P09874 | 7 | EBI-847814,EBI-355676 | |
| XRCC1 | P18887 | 8 | EBI-847814,EBI-947466 |
Alternative products
| This entry describes 10 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q7Z2E3-1) Also known as: Long; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Major form. | ||||||
| Isoform 2 (identifier: Q7Z2E3-2) Also known as: Short; The sequence of this isoform differs from the canonical sequence as follows: 1-188: Missing. | ||||||
| Note: Minor form. | ||||||
| Isoform 3 (identifier: Q7Z2E3-3) The sequence of this isoform differs from the canonical sequence as follows: 104-175: Missing. | ||||||
| Note: May be an aberrant isoform present in cancer cell lines. | ||||||
| Isoform 4 (identifier: Q7Z2E3-4) The sequence of this isoform differs from the canonical sequence as follows: 1-102: Missing. | ||||||
| Note: May be an aberrant isoform present in cancer cell lines. | ||||||
| Isoform 5 (identifier: Q7Z2E3-5) The sequence of this isoform differs from the canonical sequence as follows: 1-14: Missing. 59-112: Missing. | ||||||
| Note: May be an aberrant isoform present in cancer cell lines. | ||||||
| Isoform 6 (identifier: Q7Z2E3-6) The sequence of this isoform differs from the canonical sequence as follows: 1-193: Missing. 306-356: AVIEMVQEAGRVTVRDGMPELLKLPLRCHECQQLLPSIPQLKEHLRKHWTQ → E | ||||||
| Note: May be an aberrant isoform present in cancer cell lines. | ||||||
| Isoform 7 (identifier: Q7Z2E3-7) The sequence of this isoform differs from the canonical sequence as follows: 1-14: Missing. | ||||||
| Isoform 8 (identifier: Q7Z2E3-8) The sequence of this isoform differs from the canonical sequence as follows: 175-193: Missing. | ||||||
| Note: May be an aberrant isoform present in cancer cell lines. | ||||||
| Isoform 9 (identifier: Q7Z2E3-9) The sequence of this isoform differs from the canonical sequence as follows: 1-14: Missing. 306-356: AVIEMVQEAGRVTVRDGMPELLKLPLRCHECQQLLPSIPQLKEHLRKHWTQ → E | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 10 (identifier: Q7Z2E3-10) The sequence of this isoform differs from the canonical sequence as follows: 59-112: Missing. | ||||||
| Note: May be an aberrant isoform present in cancer cell lines. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 356 | 356 | Aprataxin | PRO_0000109838 | |||||||||||||||||||||
Regions | |||||||||||||||||||||||||
| Domain | 38 – 87 | 50 | FHA-like | ||||||||||||||||||||||
| Domain | 182 – 287 | 106 | HIT | ||||||||||||||||||||||
| Zinc finger | 331 – 353 | 23 | C2H2-type | ||||||||||||||||||||||
| Region | 1 – 110 | 110 | Interactions with ADPRT and NCL | ||||||||||||||||||||||
| Motif | 126 – 131 | 6 | Nuclear localization signal Probable | ||||||||||||||||||||||
| Motif | 272 – 276 | 5 | Histidine triad motif | ||||||||||||||||||||||
Sites | |||||||||||||||||||||||||
| Active site | 274 | 1 | Tele-AMP-histidine intermediate Probable | ||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||
| Alternative sequence | 1 – 193 | 193 | Missing in isoform 6. | VSP_010534 | |||||||||||||||||||||
| Alternative sequence | 1 – 188 | 188 | Missing in isoform 2. | VSP_010535 | |||||||||||||||||||||
| Alternative sequence | 1 – 102 | 102 | Missing in isoform 4. | VSP_010536 | |||||||||||||||||||||
| Alternative sequence | 1 – 14 | 14 | Missing in isoform 5, isoform 7 and isoform 9. | VSP_010537 | |||||||||||||||||||||
| Alternative sequence | 59 – 112 | 54 | Missing in isoform 5 and isoform 10. | VSP_010538 | |||||||||||||||||||||
| Alternative sequence | 104 – 175 | 72 | Missing in isoform 3. | VSP_010539 | |||||||||||||||||||||
| Alternative sequence | 175 – 193 | 19 | Missing in isoform 8. | VSP_010540 | |||||||||||||||||||||
| Alternative sequence | 306 – 356 | 51 | AVIEM…KHWTQ → E in isoform 6 and isoform 9. | VSP_010541 | |||||||||||||||||||||
| Natural variant | 211 | 1 | K → Q in AOA; it probably does not greatly affect the protein; heterozygous. Ref.20 | VAR_018794 | |||||||||||||||||||||
| Natural variant | 212 | 1 | A → V in AOA; heterozygous. Ref.21 | VAR_018795 | |||||||||||||||||||||
| Natural variant | 213 | 1 | R → H in AOA. Ref.10 | VAR_018796 | |||||||||||||||||||||
| Natural variant | 215 | 1 | H → R in AOA. Ref.19 | VAR_018797 | |||||||||||||||||||||
| Natural variant | 220 | 1 | P → L in AOA. Ref.9 Ref.10 | VAR_018798 | |||||||||||||||||||||
| Natural variant | 237 | 1 | L → P in AOA. Ref.22 | VAR_025365 | |||||||||||||||||||||
| Natural variant | 277 | 1 | V → G in AOA; abolishes DNA-binding and enzymatic activity towards Ap(4)A. Ref.9 Ref.15 Ref.21 | VAR_018799 | |||||||||||||||||||||
| Natural variant | 281 | 1 | D → G in AOA; heterozygous. | VAR_018800 | |||||||||||||||||||||
| Natural variant | 293 | 1 | W → R in AOA; heterozygous. Ref.21 | VAR_018801 | |||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||
| Mutagenesis | 43 | 1 | R → A: Impairs interaction with XRCC1 and XRCC4. Abolishes localization at sites of DNA double-strand breaks. Loss of interaction with MDC1. Ref.12 Ref.18 | ||||||||||||||||||||||
| Mutagenesis | 52 | 1 | K → A: Impairs interaction with MDC1 and localization at sites of DNA double-strand breaks. Ref.18 | ||||||||||||||||||||||
| Mutagenesis | 274 | 1 | H → A: Abolishes enzyme activity. Ref.16 Ref.17 | ||||||||||||||||||||||
| Mutagenesis | 333 | 1 | C → A: Abolishes DNA-binding and enzyme activity; when associated with A-336. Ref.17 | ||||||||||||||||||||||
| Mutagenesis | 336 | 1 | C → A: Abolishes DNA-binding and enzyme activity; when associated with A-333. Ref.17 | ||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||
| Beta strand | 18 – 23 | 6 | |||||||||||||||||||||||
| Beta strand | 30 – 32 | 3 | |||||||||||||||||||||||
| Beta strand | 38 – 41 | 4 | |||||||||||||||||||||||
| Beta strand | 59 – 63 | 5 | |||||||||||||||||||||||
| Beta strand | 70 – 74 | 5 | |||||||||||||||||||||||
| Beta strand | 92 – 95 | 4 | |||||||||||||||||||||||
| Beta strand | 101 – 104 | 4 | |||||||||||||||||||||||
| Beta strand | 107 – 115 | 9 | |||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of FHA-HIT as a novel nuclear protein involved in cell-cycle regulation." Huang C.-H. Submitted (JUN-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | Chen Y., Huang C.-H. Submitted (DEC-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8 AND 10). Tissue: Hypothalamus, Kidney, Lung adenocarcinoma, Lymphoma, Melanoma, Muscle, Retinoblastoma, Skin and Testis. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Colon. |
| [4] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 9). Tissue: Endometrium. |
| [5] | "DNA sequence and analysis of human chromosome 9." Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. Dunham I.Nature 429:369-374(2004) [PubMed: 15164053] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4). Tissue: Lung and Lymph. |
| [8] | "Mutations in the APTX gene." Hellenbroich Y., Habeck M. Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-261 (ISOFORMS 2; 4; 5 AND 7). Tissue: Brain. |
| [9] | "Early-onset ataxia with ocular motor apraxia and hypoalbuminemia is caused by mutations in a new HIT superfamily gene." Date H., Onodera O., Tanaka H., Iwabuchi K., Uekawa K., Igarashi S., Koike R., Hiroi T., Yuasa T., Awaya Y., Sakai T., Takahashi T., Nagatomo H., Sekijima Y., Kawachi I., Takiyama Y., Nishizawa M., Fukuhara N. Tsuji S.Nat. Genet. 29:184-188(2001) [PubMed: 11586299] [Abstract] Cited for: TISSUE SPECIFICITY, VARIANTS AOA LEU-220 AND GLY-277. |
| [10] | "The gene mutated in ataxia-ocular apraxia 1 encodes the new HIT/Zn-finger protein aprataxin." Moreira M.-C., Barbot C., Tachi N., Kozuka N., Uchida E., Gibson T., Mendonca P., Costa M., Barros J., Yanagisawa T., Watanabe M., Ikeda Y., Aoki M., Nagata T., Coutinho P., Sequeiros J., Koenig M. Nat. Genet. 29:189-193(2001) [PubMed: 11586300] [Abstract] Cited for: ALTERNATIVE SPLICING, TISSUE SPECIFICITY, VARIANTS AOA HIS-213 AND LEU-220. |
| [11] | "Aprataxin, the causative protein for EAOH is a nuclear protein with a potential role as a DNA repair protein." Sano Y., Date H., Igarashi S., Onodera O., Oyake M., Takahashi T., Hayashi S., Morimatsu M., Takahashi H., Makifuchi T., Fukuhara N., Tsuji S. Ann. Neurol. 55:241-249(2004) [PubMed: 14755728] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INTERACTION WITH XRCC1. |
| [12] | "The ataxia-oculomotor apraxia 1 gene product has a role distinct from ATM and interacts with the DNA strand break repair proteins XRCC1 and XRCC4." Clements P.M., Breslin C., Deeks E.D., Byrd P.J., Ju L., Bieganowski P., Brenner C., Moreira M.-C., Taylor A.M.R., Caldecott K.W. DNA Repair 3:1493-1502(2004) [PubMed: 15380105] [Abstract] Cited for: INTERACTION WITH XRCC1 AND XRCC4, SUBCELLULAR LOCATION, MUTAGENESIS OF ARG-43. |
| [13] | "Aprataxin, a novel protein that protects against genotoxic stress." Gueven N., Becherel O.J., Kijas A.W., Chen P., Howe O., Rudolph J.H., Gatti R., Date H., Onodera O., Taucher-Scholz G., Lavin M.F. Hum. Mol. Genet. 13:1081-1093(2004) [PubMed: 15044383] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH XRCC1; ADPRT; TP53 AND NCL. |
| [14] | "Nucleolar localization of aprataxin is dependent on interaction with nucleolin and on active ribosomal DNA transcription." Becherel O.J., Gueven N., Birrell G.W., Schreiber V., Suraweera A., Jakob B., Taucher-Scholz G., Lavin M.F. Hum. Mol. Genet. 15:2239-2249(2006) [PubMed: 16777843] [Abstract] Cited for: SUBCELLULAR LOCATION, INTERACTION WITH XRCC1 AND NCL. |
| [15] | "Aprataxin forms a discrete branch in the HIT (histidine triad) superfamily of proteins with both DNA/RNA binding and nucleotide hydrolase activities." Kijas A.W., Harris J.L., Harris J.M., Lavin M.F. J. Biol. Chem. 281:13939-13948(2006) [PubMed: 16547001] [Abstract] Cited for: FUNCTION, DNA-BINDING, CHARACTERIZATION OF VARIANT GLY-277. |
| [16] | "The neurodegenerative disease protein aprataxin resolves abortive DNA ligation intermediates." Ahel I., Rass U., El-Khamisy S.F., Katyal S., Clements P.M., McKinnon P.J., Caldecott K.W., West S.C. Nature 443:713-716(2006) [PubMed: 16964241] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF HIS-274. |
| [17] | "Actions of aprataxin in multiple DNA repair pathways." Rass U., Ahel I., West S.C. J. Biol. Chem. 282:9469-9474(2007) [PubMed: 17276982] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF HIS-274; CYS-333 AND CYS-336. |
| [18] | "CK2 phosphorylation-dependent interaction between aprataxin and MDC1 in the DNA damage response." Becherel O.J., Jakob B., Cherry A.L., Gueven N., Fusser M., Kijas A.W., Peng C., Katyal S., McKinnon P.J., Chen J., Epe B., Smerdon S.J., Taucher-Scholz G., Lavin M.F. Nucleic Acids Res. 38:1489-1503(2010) [PubMed: 20008512] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.65 ANGSTROMS) OF 15-116, SUBCELLULAR LOCATION, INTERACTION WITH MDC1, MUTAGENESIS OF ARG-43 AND LYS-52. |
| [19] | "Early-onset ataxia with ocular motor apraxia and hypoalbuminemia: the aprataxin gene mutations." Shimazaki H., Takiyama Y., Sakoe K., Ikeguchi K., Niijima K., Kaneko J., Namekawa M., Ogawa T., Date H., Tsuji S., Nakano I., Nishizawa M. Neurology 59:590-595(2002) [PubMed: 12196655] [Abstract] Cited for: VARIANT AOA ARG-215. |
| [20] | "Phenotypic variability of aprataxin gene mutations." Tranchant C., Fleury M., Moreira M.-C., Koenig M., Warter J.-M. Neurology 60:868-870(2003) [PubMed: 12629250] [Abstract] Cited for: VARIANT AOA GLN-211. |
| [21] | "Cerebellar ataxia with oculomotor apRAxia type 1: clinical and genetic studies." Le Ber I., Moreira M.-C., Rivaud-Pechoux S., Chamayou C., Ochsner F., Kuntzer T., Tardieu M., Saied G., Habert M.-O., Demarquay G., Tannier C., Beis J.-M., Brice A., Koenig M., Duerr A. Brain 126:2761-2772(2003) [PubMed: 14506070] [Abstract] Cited for: VARIANTS AOA VAL-212; GLY-277 AND ARG-293. |
| [22] | "Very late onset in ataxia oculomotor apraxia type I." Criscuolo C., Mancini P., Menchise V., Sacca F., De Michele G., Banfi S., Filla A. Ann. Neurol. 57:777-777(2005) [PubMed: 15852392] [Abstract] Cited for: VARIANT AOA PRO-237. |
| [23] | "Coenzyme Q deficiency and cerebellar ataxia associated with an aprataxin mutation." Quinzii C.M., Kattah A.G., Naini A., Akman H.O., Mootha V.K., DiMauro S., Hirano M. Neurology 64:539-541(2005) [PubMed: 15699391] [Abstract] Cited for: INVOLVEMENT IN COENZYME Q10 DEFICIENCY. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AY040777 mRNA. Translation: AAK91768.1. AY208829 mRNA. Translation: AAP86319.1. AY208830 mRNA. Translation: AAP86320.1. AY208831 mRNA. Translation: AAP86321.1. AY208832 mRNA. Translation: AAP86322.1. AY208833 mRNA. Translation: AAP86323.1. AY208834 mRNA. Translation: AAP86324.1. AY208835 mRNA. Translation: AAP86325.1. AY208836 mRNA. Translation: AAP86326.1. AY208837 mRNA. Translation: AAP86327.1. AY208838 mRNA. Translation: AAP86328.1. AY208839 mRNA. Translation: AAP86329.1. AY208840 mRNA. Translation: AAP86330.1. AY208841 mRNA. Translation: AAP86331.1. AY208842 mRNA. Translation: AAP86332.1. AK000164 mRNA. Translation: BAA90985.1. BX538161 mRNA. Translation: CAD98041.1. AL162590, AL353717 Genomic DNA. Translation: CAI15549.1. AL353717, AL162590 Genomic DNA. Translation: CAI15728.1. AL353717 Genomic DNA. Translation: CAI15734.1. CH471071 Genomic DNA. Translation: EAW58530.1. CH471071 Genomic DNA. Translation: EAW58529.1. CH471071 Genomic DNA. Translation: EAW58531.1. CH471071 Genomic DNA. Translation: EAW58534.1. CH471071 Genomic DNA. Translation: EAW58535.1. BC001628 mRNA. Translation: AAH01628.1. BC032650 mRNA. Translation: AAH32650.1. AJ565850 mRNA. Translation: CAD92454.1. AJ565851 mRNA. Translation: CAD92455.1. AJ565852 mRNA. Translation: CAD92456.1. AJ565853 mRNA. Translation: CAD92457.1. AJ565854 mRNA. Translation: CAD92458.1. AJ565855 mRNA. Translation: CAD92459.1. AJ575566 mRNA. Translation: CAE01427.1. | ||||||||||||
| IPI | IPI00180685. IPI00375305. IPI00411460. IPI00414767. IPI00420029. IPI00420030. IPI00420031. IPI00420033. IPI00554783. IPI00979014. | ||||||||||||
| RefSeq | NP_001182177.1. NM_001195248.1. NP_001182178.1. NM_001195249.1. NP_001182179.1. NM_001195250.1. NP_001182180.1. NM_001195251.1. NP_001182181.1. NM_001195252.1. NP_001182183.1. NM_001195254.1. NP_778239.1. NM_175069.2. NP_778243.1. NM_175073.2. | ||||||||||||
| UniGene | Hs.20158. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q7Z2E3. | ||||||||||||
| SMR | Q7Z2E3. Positions 15-116, 187-280. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q7Z2E3. 16 interactions. | ||||||||||||
| MINT | MINT-1205251. | ||||||||||||
| STRING | Q7Z2E3. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q7Z2E3. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 48428038. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q7Z2E3. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000379819; ENSP00000369147; ENSG00000137074. | ||||||||||||
| GeneID | 54840. | ||||||||||||
| KEGG | hsa:54840. | ||||||||||||
| UCSC | uc003zrj.1. human. uc003zrm.1. human. uc003zrv.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 54840. | ||||||||||||
| GeneCards | GC09M032962. | ||||||||||||
| HGNC | HGNC:15984. APTX. | ||||||||||||
| MIM | 208920. phenotype. 606350. gene. 607426. phenotype. | ||||||||||||
| neXtProt | NX_Q7Z2E3. | ||||||||||||
| Orphanet | 1168. Ataxia - oculomotor apraxia type 1. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| GeneTree | ENSGT00570000079163. | ||||||||||||
| HOVERGEN | HBG050555. | ||||||||||||
| InParanoid | Q7Z2E3. | ||||||||||||
| OMA | MSHVHLH. | ||||||||||||
| PhylomeDB | Q7Z2E3. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q7Z2E3. | ||||||||||||
| Bgee | Q7Z2E3. | ||||||||||||
| CleanEx | HS_APTX. | ||||||||||||
| Genevestigator | Q7Z2E3. | ||||||||||||
| GermOnline | ENSG00000137074. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR000253. FHA_dom. IPR011146. His_triad-like_motif. IPR011151. His_triad_motif. IPR019808. Histidine_triad_CS. IPR001310. Histidine_triad_HIT. IPR008984. SMAD_FHA_domain. IPR007087. Znf_C2H2. IPR015880. Znf_C2H2-like. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:2.60.200.20. FHA. 1 hit. G3DSA:3.30.428.10. His_triad_motif. 1 hit. | ||||||||||||
| KO | K10863. | ||||||||||||
| SMART | SM00355. ZnF_C2H2. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF54197. His_triad-like_motif. 1 hit. SSF49879. SMAD_FHA. 1 hit. | ||||||||||||
| PROSITE | PS00892. HIT_1. 1 hit. PS51084. HIT_2. 1 hit. PS00028. ZINC_FINGER_C2H2_1. 1 hit. PS50157. ZINC_FINGER_C2H2_2. False negative. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 57644. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | APTX_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q7Z2E3 Secondary accession number(s): A8MTN4 Q9NXM5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with