Q7Z020 (TRPA1_DROME) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 67.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Transient receptor potential cation channel subfamily A member 1 Short name=dTRPA1 Alternative name(s): Ankyrin-like with transmembrane domains protein 1 Short name=dANKTM1 | ||||||
| Gene names |
| ||||||
| Organism | Drosophila melanogaster (Fruit fly) | ||||||
| Taxonomic identifier | 7227 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Endopterygota › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora |
Protein attributes
| Sequence length | 1296 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Essential for thermotaxis by sensing environmental temperature. Receptor-activated non-selective cation channel involved in detection of sensations such as temperature. Involved in heat nociception by being activated by warm temperature of about 24-29 degrees Celsius. Ref.3 Ref.4 |
| Subcellular location | Membrane; Multi-pass membrane protein Probable. |
| Disruption phenotype | Eliminates avoidance of elevated temperatures along a thermal gradient. Ref.4 |
| Sequence similarities | Belongs to the transient receptor (TC 1.A.4) family. [View classification] Contains 14 ANK repeats. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ion transport Sensory transduction Transport |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | ANK repeat Repeat Transmembrane Transmembrane helix |
| Molecular function | Ionic channel |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | cellular response to heat Inferred from direct assay. Source: FlyBase circadian sleep/wake cycleInferred from mutant phenotype. Source: FlyBase detection of chemical stimulus involved in sensory perception of bitter tasteInferred from mutant phenotype. Source: FlyBase memoryInferred from mutant phenotype. Source: FlyBase thermotaxisInferred from direct assay. Source: FlyBase |
| Cellular component | integral to membrane Inferred by curator Ref.3. Source: UniProtKB |
| Molecular function | cation channel activity Inferred from direct assay Ref.3. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform E (identifier: Q7Z020-3) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform F (identifier: Q7Z020-2) The sequence of this isoform differs from the canonical sequence as follows: 789-819: AFLQCPFMFAKIDEKTGESITTASPIPLPAL → WPYQKTPEQIEAKRKEFNDPKWRPAPLAVV | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1296 | 1296 | Transient receptor potential cation channel subfamily A member 1 | PRO_0000215373 | |||||
Regions | |||||||||
| Topological domain | 1 – 852 | 852 | Cytoplasmic Potential | ||||||
| Transmembrane | 853 – 873 | 21 | Helical; Name=1; Potential | ||||||
| Topological domain | 874 – 926 | 53 | Extracellular Potential | ||||||
| Transmembrane | 927 – 947 | 21 | Helical; Name=2; Potential | ||||||
| Topological domain | 948 – 955 | 8 | Cytoplasmic Potential | ||||||
| Transmembrane | 956 – 976 | 21 | Helical; Name=3; Potential | ||||||
| Topological domain | 977 – 988 | 12 | Extracellular Potential | ||||||
| Transmembrane | 989 – 1009 | 21 | Helical; Name=4; Potential | ||||||
| Topological domain | 1010 – 1031 | 22 | Cytoplasmic Potential | ||||||
| Transmembrane | 1032 – 1052 | 21 | Helical; Name=5; Potential | ||||||
| Topological domain | 1053 – 1070 | 18 | Extracellular Potential | ||||||
| Transmembrane | 1071 – 1093 | 23 | Helical; Name=6; Potential | ||||||
| Topological domain | 1094 – 1103 | 10 | Cytoplasmic Potential | ||||||
| Transmembrane | 1104 – 1124 | 21 | Helical; Name=7; Potential | ||||||
| Topological domain | 1125 – 1296 | 172 | Extracellular Potential | ||||||
| Repeat | 188 – 217 | 30 | ANK 1 | ||||||
| Repeat | 221 – 250 | 30 | ANK 2 | ||||||
| Repeat | 254 – 283 | 30 | ANK 3 | ||||||
| Repeat | 289 – 318 | 30 | ANK 4 | ||||||
| Repeat | 323 – 352 | 30 | ANK 5 | ||||||
| Repeat | 364 – 393 | 30 | ANK 6 | ||||||
| Repeat | 397 – 426 | 30 | ANK 7 | ||||||
| Repeat | 435 – 464 | 30 | ANK 8 | ||||||
| Repeat | 468 – 497 | 30 | ANK 9 | ||||||
| Repeat | 542 – 571 | 30 | ANK 10 | ||||||
| Repeat | 575 – 604 | 30 | ANK 11 | ||||||
| Repeat | 611 – 640 | 30 | ANK 12 | ||||||
| Repeat | 643 – 673 | 31 | ANK 13 | ||||||
| Repeat | 677 – 706 | 30 | ANK 14 | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 884 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 901 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 922 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 1174 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 1293 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 789 – 819 | 31 | AFLQC…PLPAL → WPYQKTPEQIEAKRKEFNDP KWRPAPLAVV in isoform F. | VSP_030263 | |||||
Sequences
| ||||||||||||||||||||||||
References
Web resources
| Protein Spotlight The power behind pain - Issue 82 of May 2007 |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AE014296 Genomic DNA. Translation: AAF50356.4. AE014296 Genomic DNA. Translation: ABW08500.3. AY302598 mRNA. Translation: AAP76197.1. |
| RefSeq | NP_001097554.3. NM_001104084.3. NP_648263.4. NM_140006.4. |
| UniGene | Dm.15461. |
3D structure databases | |
| ProteinModelPortal | Q7Z020. |
| SMR | Q7Z020. Positions 48-768. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q7Z020. |
Protein family/group databases | |
| TCDB | 1.A.4.6.2. transient receptor potential Ca2+ channel (TRP-CC) family. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| EnsemblMetazoa | FBtr0300208; FBpp0289445; FBgn0035934. |
| GeneID | 39015. |
| KEGG | dme:Dmel_CG5751. |
Organism-specific databases | |
| CTD | 8989. |
| FlyBase | FBgn0035934. TrpA1. |
Phylogenomic databases | |
| eggNOG | inNOG08973. |
| GeneTree | EMGT00070000025711. |
| InParanoid | Q7Z020. |
| OrthoDB | EOG415DV7. |
| PhylomeDB | Q7Z020. |
Gene expression databases | |
| Bgee | Q7Z020. |
Family and domain databases | |
| InterPro | IPR002110. Ankyrin_rpt. IPR020683. Ankyrin_rpt-contain_dom. IPR005821. Ion_trans. [Graphical view] |
| Gene3D | G3DSA:1.25.40.20. ANK. 4 hits. |
| KO | K04984. |
| Pfam | PF12796. Ank_2. 5 hits. PF00520. Ion_trans. 1 hit. [Graphical view] |
| PRINTS | PR01415. ANKYRIN. |
| SMART | SM00248. ANK. 15 hits. [Graphical view] |
| SUPFAM | SSF48403. ANK. 3 hits. |
| PROSITE | PS50297. ANK_REP_REGION. 1 hit. PS50088. ANK_REPEAT. 10 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 811470. |
Entry information
| Entry name | TRPA1_DROME | ||||||||
| Accession | Primary (citable) accession number: Q7Z020 Secondary accession number(s): A8JNP0, Q9VSQ9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Drosophila annotation project | ||||||||
Relevant documents
| Drosophila Drosophila: entries, gene names and cross-references to FlyBase |
| SIMILARITY comments Index of protein domains and families |
| Protein Spotlight Protein Spotlight articles and cited UniProtKB/Swiss-Prot entries |

Clusters with