Reviewed,
UniProtKB/Swiss-Prot Q7Z020 (TRPA1_DROME)
Last modified
November 24, 2009.
Version 48.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Transient receptor potential cation channel subfamily A member 1 Short name=dTRPA1 Alternative name(s): Ankyrin-like with transmembrane domains protein 1 Short name=dANKTM1 | ||||||
| Gene names |
| ||||||
| Organism | Drosophila melanogaster (Fruit fly) [Complete proteome] | ||||||
| Taxonomic identifier | 7227 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Endopterygota › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora |
Protein attributes
| Sequence length | 1296 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Essential for thermotaxis by sensing environmental temperature. Receptor-activated non-selective cation channel involved in detection of sensations such as temperature. Involved in heat nociception by being activated by warm temperature of about 24-29 degrees Celsius. Ref.3 Ref.4 |
| Subcellular location | Membrane; Multi-pass membrane protein Probable. |
| Disruption phenotype | Eliminates avoidance of elevated temperatures along a thermal gradient. Ref.4 |
| Sequence similarities | Belongs to the transient receptor family. Contains 14 ANK repeats. |
| Sequence caution | The sequence AAF50356.3 differs from that shown. Reason: Erroneous gene model prediction. The sequence ABW08500.2 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ion transport Sensory transduction Transport |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | ANK repeat Repeat Transmembrane |
| Molecular function | Ionic channel |
| PTM | Glycoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | cation transport Ref.3 Inferred from direct assay. Source: UniProtKB cellular response to heatInferred from direct assay. Source: FlyBase thermotaxis Ref.4Inferred from mutant phenotype. Source: FlyBase transmembrane transportInferred from electronic annotation. Source: InterPro |
| Cellular component | integral to membrane Ref.3 Inferred by curator. Source: UniProtKB |
| Molecular function | cation channel activity Ref.3 Inferred from direct assay. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform E (identifier: Q7Z020-3) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform F (identifier: Q7Z020-2) The sequence of this isoform differs from the canonical sequence as follows: 789-819: AFLQCPFMFAKIDEKTGESITTASPIPLPAL → WPYQKTPEQIEAKRKEFNDPKWRPAPLAVV | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1296 | 1296 | Transient receptor potential cation channel subfamily A member 1 | PRO_0000215373 | |||||
Regions | |||||||||
| Topological domain | 1 – 852 | 852 | Cytoplasmic Potential | ||||||
| Transmembrane | 853 – 873 | 21 | 1 Potential | ||||||
| Topological domain | 874 – 926 | 53 | Extracellular Potential | ||||||
| Transmembrane | 927 – 947 | 21 | 2 Potential | ||||||
| Topological domain | 948 – 955 | 8 | Cytoplasmic Potential | ||||||
| Transmembrane | 956 – 976 | 21 | 3 Potential | ||||||
| Topological domain | 977 – 988 | 12 | Extracellular Potential | ||||||
| Transmembrane | 989 – 1009 | 21 | 4 Potential | ||||||
| Topological domain | 1010 – 1031 | 22 | Cytoplasmic Potential | ||||||
| Transmembrane | 1032 – 1052 | 21 | 5 Potential | ||||||
| Topological domain | 1053 – 1070 | 18 | Extracellular Potential | ||||||
| Transmembrane | 1071 – 1093 | 23 | 6 Potential | ||||||
| Topological domain | 1094 – 1103 | 10 | Cytoplasmic Potential | ||||||
| Transmembrane | 1104 – 1124 | 21 | 7 Potential | ||||||
| Topological domain | 1125 – 1296 | 172 | Extracellular Potential | ||||||
| Repeat | 188 – 217 | 30 | ANK 1 | ||||||
| Repeat | 221 – 250 | 30 | ANK 2 | ||||||
| Repeat | 254 – 283 | 30 | ANK 3 | ||||||
| Repeat | 289 – 318 | 30 | ANK 4 | ||||||
| Repeat | 323 – 352 | 30 | ANK 5 | ||||||
| Repeat | 364 – 393 | 30 | ANK 6 | ||||||
| Repeat | 397 – 426 | 30 | ANK 7 | ||||||
| Repeat | 435 – 464 | 30 | ANK 8 | ||||||
| Repeat | 468 – 497 | 30 | ANK 9 | ||||||
| Repeat | 542 – 571 | 30 | ANK 10 | ||||||
| Repeat | 575 – 604 | 30 | ANK 11 | ||||||
| Repeat | 611 – 640 | 30 | ANK 12 | ||||||
| Repeat | 643 – 673 | 31 | ANK 13 | ||||||
| Repeat | 677 – 706 | 30 | ANK 14 | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 884 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 901 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 922 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 1174 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 1293 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 789 – 819 | 31 | AFLQC…PLPAL → WPYQKTPEQIEAKRKEFNDP KWRPAPLAVV in isoform F. | VSP_030263 | |||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| AE014296 Genomic DNA. Translation: AAF50356.3. Sequence problems. AE014296 Genomic DNA. Translation: ABW08500.2. Sequence problems. AY302598 mRNA. Translation: AAP76197.1. | |
| RefSeq | NP_001097554.2. NP_648263.3. |
| UniGene | Dm.15461 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q7Z020. |
Protein family/group databases | |
| TCDB | 1.A.4.6.2. transient receptor potential Ca2+ channel (TRP-CC) family. |
Genome annotation databases | |
| Ensembl | FBtr0300208; FBpp0289445; FBgn0035934; Drosophila melanogaster. [Genome view] FBtr0300209; FBpp0289446; FBgn0035934; Drosophila melanogaster. [Genome view] |
| GeneID | 39015. |
| KEGG | dme:Dmel_CG5751. |
Organism-specific databases | |
| CTD | 39015. |
| FlyBase | FBgn0035934. TrpA1. |
Phylogenomic databases | |
| OrthoDB | EOG9RXZ62 |
Gene expression databases | |
| Bgee | Q7Z020. |
Family and domain databases | |
| InterPro | IPR002110. Ankyrin_rpt. IPR020683. Ankyrin_rpt-contain_dom. IPR005821. Ion_trans. [Graphical view] |
| Gene3D | G3DSA:1.25.40.20. ANK. 3 hits. |
| Pfam | PF00023. Ank. 13 hits. PF00520. Ion_trans. 1 hit. [Graphical view] |
| SMART | SM00248. ANK. 15 hits. [Graphical view] |
| PROSITE | PS50297. ANK_REP_REGION. 1 hit. PS50088. ANK_REPEAT. 10 hits. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 811470. |
Entry information
| Entry name | TRPA1_DROME | ||||||||
| Accession | Primary (citable) accession number: Q7Z020 Secondary accession number(s): A8JNP0, Q9VSQ9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | Drosophila annotation project | ||||||||
Relevant documents
| Drosophila Drosophila: entries, gene names and cross-references to FlyBase |
| Protein Spotlight Protein Spotlight articles and cited UniProtKB/Swiss-Prot entries |
| SIMILARITY comments Index of protein domains and families |

Clusters with


