Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transient receptor potential cation channel subfamily A member 1

Gene

TrpA1

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Essential for thermotaxis by sensing environmental temperature. Receptor-activated non-selective cation channel involved in detection of sensations such as temperature. Involved in heat nociception by being activated by warm temperature of about 24-29 degrees Celsius.2 Publications

GO - Molecular functioni

  • cation channel activity Source: UniProtKB
  • ligand-gated ion channel activity Source: FlyBase
  • temperature-gated cation channel activity Source: FlyBase

GO - Biological processi

  • calcium ion transport Source: FlyBase
  • cation transmembrane transport Source: GOC
  • cation transport Source: UniProtKB
  • cellular response to heat Source: FlyBase
  • detection of chemical stimulus involved in sensory perception of bitter taste Source: FlyBase
  • detection of chemical stimulus involved in sensory perception of pain Source: FlyBase
  • detection of temperature stimulus involved in sensory perception of pain Source: FlyBase
  • detection of temperature stimulus involved in thermoception Source: FlyBase
  • ion transmembrane transport Source: GOC
  • mechanosensory behavior Source: FlyBase
  • negative phototaxis Source: FlyBase
  • neuronal signal transduction Source: FlyBase
  • phototransduction Source: FlyBase
  • positive regulation of calcium-mediated signaling Source: FlyBase
  • response to heat Source: UniProtKB
  • response to light stimulus Source: FlyBase
  • sensory perception of pain Source: FlyBase
  • temperature compensation of the circadian clock Source: FlyBase
  • thermosensory behavior Source: FlyBase
  • thermotaxis Source: FlyBase
Complete GO annotation...

Keywords - Molecular functioni

Ion channel

Keywords - Biological processi

Ion transport, Sensory transduction, Transport

Enzyme and pathway databases

ReactomeiR-DME-3295583. TRP channels.
SignaLinkiQ7Z020.

Protein family/group databases

TCDBi1.A.4.6.2. the transient receptor potential ca(2+) channel (trp-cc) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Transient receptor potential cation channel subfamily A member 1
Short name:
dTRPA1
Alternative name(s):
Ankyrin-like with transmembrane domains protein 1
Short name:
dANKTM1
Gene namesi
Name:TrpA1
Synonyms:Anktm1
ORF Names:CG5751
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome 3L

Organism-specific databases

FlyBaseiFBgn0035934. TrpA1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 753753CytoplasmicSequence analysisAdd
BLAST
Transmembranei754 – 77421Helical; Name=1Sequence analysisAdd
BLAST
Topological domaini775 – 82753ExtracellularSequence analysisAdd
BLAST
Transmembranei828 – 84821Helical; Name=2Sequence analysisAdd
BLAST
Topological domaini849 – 8568CytoplasmicSequence analysis
Transmembranei857 – 87721Helical; Name=3Sequence analysisAdd
BLAST
Topological domaini878 – 88912ExtracellularSequence analysisAdd
BLAST
Transmembranei890 – 91021Helical; Name=4Sequence analysisAdd
BLAST
Topological domaini911 – 93222CytoplasmicSequence analysisAdd
BLAST
Transmembranei933 – 95321Helical; Name=5Sequence analysisAdd
BLAST
Topological domaini954 – 96815ExtracellularSequence analysisAdd
BLAST
Intramembranei969 – 98921Pore-formingBy similarityAdd
BLAST
Topological domaini990 – 100415ExtracellularSequence analysisAdd
BLAST
Transmembranei1005 – 102521Helical; Name=6Sequence analysisAdd
BLAST
Topological domaini1026 – 1197172CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

  • cation channel complex Source: FlyBase
  • integral component of membrane Source: UniProtKB
  • plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Disruption phenotypei

Eliminates avoidance of elevated temperatures along a thermal gradient.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 11971197Transient receptor potential cation channel subfamily A member 1PRO_0000215373Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi785 – 7851N-linked (GlcNAc...)Sequence analysis
Glycosylationi802 – 8021N-linked (GlcNAc...)Sequence analysis
Glycosylationi823 – 8231N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ7Z020.

Expressioni

Gene expression databases

BgeeiQ7Z020.
ExpressionAtlasiQ7Z020. differential.
GenevisibleiQ7Z020. DM.

Interactioni

Subunit structurei

Homotetramer.By similarity

Protein-protein interaction databases

IntActiQ7Z020. 5 interactions.
STRINGi7227.FBpp0304207.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati89 – 11830ANK 1Add
BLAST
Repeati122 – 15130ANK 2Add
BLAST
Repeati155 – 18430ANK 3Add
BLAST
Repeati190 – 21930ANK 4Add
BLAST
Repeati224 – 25330ANK 5Add
BLAST
Repeati265 – 29430ANK 6Add
BLAST
Repeati298 – 32730ANK 7Add
BLAST
Repeati336 – 36530ANK 8Add
BLAST
Repeati369 – 39830ANK 9Add
BLAST
Repeati443 – 47230ANK 10Add
BLAST
Repeati476 – 50530ANK 11Add
BLAST
Repeati512 – 54130ANK 12Add
BLAST
Repeati544 – 57431ANK 13Add
BLAST
Repeati578 – 60730ANK 14Add
BLAST

Sequence similaritiesi

Contains 14 ANK repeats.PROSITE-ProRule annotation

Keywords - Domaini

ANK repeat, Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0510. Eukaryota.
KOG1326. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00840000129770.
InParanoidiQ7Z020.
KOiK04984.
OrthoDBiEOG7P02H2.

Family and domain databases

Gene3Di1.25.40.20. 3 hits.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR005821. Ion_trans_dom.
[Graphical view]
PfamiPF00023. Ank. 1 hit.
PF12796. Ank_2. 3 hits.
PF00520. Ion_trans. 1 hit.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 15 hits.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 3 hits.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 10 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform I (identifier: Q7Z020-4) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTSGDKETPK REDFASALRF LMGGCAREPE MTAMAPLNLP KKWARILRMS
60 70 80 90 100
STPKIPIVDY LEAAESGNLD DFKRLFMADN SRIALKDAKG RTAAHQAAAR
110 120 130 140 150
NRVNILRYIR DQNGDFNAKD NAGNTPLHIA VESDAYDALD YLLSIPVDTG
160 170 180 190 200
VLNEKKQAPV HLATELNKVK SLRVMGQYRN VIDIQQGGEH GRTALHLAAI
210 220 230 240 250
YDHEECARIL ITEFDACPRK PCNNGYYPIH EAAKNASSKT MEVFFQWGEQ
260 270 280 290 300
RGCTREEMIS FYDSEGNVPL HSAVHGGDIK AVELCLKSGA KISTQQHDLS
310 320 330 340 350
TPVHLACAQG AIDIVKLMFE MQPMEKRLCL SCTDVQKMTP LHCASMFDHP
360 370 380 390 400
DIVSYLVAEG ADINALDKEH RSPLLLAASR SGWKTVHLLI RLGACISVKD
410 420 430 440 450
AAARNVLHFV IMNGGRLTDF AEQVANCQTQ AQLKLLLNEK DSMGCSPLHY
460 470 480 490 500
ASRDGHIRSL ENLIRLGACI NLKNNNNESP LHFAARYGRY NTVRQLLDSE
510 520 530 540 550
KGSFIINESD GAGMTPLHIS SQQGHTRVVQ LLLNRGALLH RDHTGRNPLQ
560 570 580 590 600
LAAMSGYTET IELLHSVHSH LLDQVDKDGN TALHLATMEN KPHAISVLMS
610 620 630 640 650
MGCKLVYNVL DMSAIDYAIY YKYPEAALAM VTHEERANEV MALRSDKHPC
660 670 680 690 700
VTLALIASMP KVFEAVQDKC ITKANCKKDS KSFYIKYSFA FLQCPFMFAK
710 720 730 740 750
IDEKTGESIT TASPIPLPAL NTMVTHGRVE LLAHPLSQKY LQMKWNSYGK
760 770 780 790 800
YFHLANLLIY SIFLVFVTIY SSLMMNNIEL KAGDNKTMSQ YCNMGWEQLT
810 820 830 840 850
MNLSQNPSVA SQIRLDSCEE RINRTTAILF CAVVIVVYIL LNSMRELIQI
860 870 880 890 900
YQQKLHYILE TVNLISWVLY ISALVMVTPA FQPDGGINTI HYSAASIAVF
910 920 930 940 950
LSWFRLLLFL QRFDQVGIYV VMFLEILQTL IKVLMVFSIL IIAFGLAFYI
960 970 980 990 1000
LLSKIIDPQP NHLSFSNIPM SLLRTFSMML GELDFVGTYV NTYYRDQLKV
1010 1020 1030 1040 1050
PMTSFLILSV FMILMPILLM NLLIGLAVGD IESVRRNAQL KRLAMQVVLH
1060 1070 1080 1090 1100
TELERKLPHV WLQRVDKMEL IEYPNETKCK LGFCDFILRK WFSNPFTEDS
1110 1120 1130 1140 1150
SMDVISFDNN DDYINAELER QRRKLRDISR MLEQQHHLVR LIVQKMEIKT
1160 1170 1180 1190
EADDVDEGIS PNELRSVVGL RSAGGNRWNS PRVRNKLRAA LSFNKSM
Length:1,197
Mass (Da):135,158
Last modified:June 11, 2014 - v4
Checksum:i0A0866232733B69B
GO
Isoform J (identifier: Q7Z020-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     690-720: AFLQCPFMFAKIDEKTGESITTASPIPLPAL → WPYQKTPEQIEAKRKEFNDPKWRPAPLAVV

Note: No experimental confirmation available.
Show »
Length:1,196
Mass (Da):135,443
Checksum:i8B46AECC1B32A7A8
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei690 – 72031AFLQC…PLPAL → WPYQKTPEQIEAKRKEFNDP KWRPAPLAVV in isoform J. CuratedVSP_030263Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY302598 mRNA. Translation: AAP76197.1.
AE014296 Genomic DNA. Translation: AAF50356.5.
AE014296 Genomic DNA. Translation: ABW08500.4.
RefSeqiNP_001097554.4. NM_001104084.4. [Q7Z020-5]
NP_648263.5. NM_140006.5. [Q7Z020-4]
UniGeneiDm.15461.

Genome annotation databases

EnsemblMetazoaiFBtr0331825; FBpp0304209; FBgn0035934. [Q7Z020-4]
GeneIDi39015.
KEGGidme:Dmel_CG5751.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

Protein Spotlight

The power behind pain - Issue 82 of May 2007

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY302598 mRNA. Translation: AAP76197.1.
AE014296 Genomic DNA. Translation: AAF50356.5.
AE014296 Genomic DNA. Translation: ABW08500.4.
RefSeqiNP_001097554.4. NM_001104084.4. [Q7Z020-5]
NP_648263.5. NM_140006.5. [Q7Z020-4]
UniGeneiDm.15461.

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ7Z020. 5 interactions.
STRINGi7227.FBpp0304207.

Protein family/group databases

TCDBi1.A.4.6.2. the transient receptor potential ca(2+) channel (trp-cc) family.

Proteomic databases

PaxDbiQ7Z020.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiFBtr0331825; FBpp0304209; FBgn0035934. [Q7Z020-4]
GeneIDi39015.
KEGGidme:Dmel_CG5751.

Organism-specific databases

CTDi8989.
FlyBaseiFBgn0035934. TrpA1.

Phylogenomic databases

eggNOGiKOG0510. Eukaryota.
KOG1326. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00840000129770.
InParanoidiQ7Z020.
KOiK04984.
OrthoDBiEOG7P02H2.

Enzyme and pathway databases

ReactomeiR-DME-3295583. TRP channels.
SignaLinkiQ7Z020.

Miscellaneous databases

GenomeRNAii39015.
NextBioi811470.
PROiQ7Z020.

Gene expression databases

BgeeiQ7Z020.
ExpressionAtlasiQ7Z020. differential.
GenevisibleiQ7Z020. DM.

Family and domain databases

Gene3Di1.25.40.20. 3 hits.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR005821. Ion_trans_dom.
[Graphical view]
PfamiPF00023. Ank. 1 hit.
PF12796. Ank_2. 3 hits.
PF00520. Ion_trans. 1 hit.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 15 hits.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 3 hits.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 10 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM I), FUNCTION, SUBCELLULAR LOCATION.
  2. "The genome sequence of Drosophila melanogaster."
    Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D.
    , Zhang Q., Chen L.X., Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M., Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J., Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.
    Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: Berkeley.
  3. Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING.
    Strain: Berkeley.
  4. "The Drosophila ortholog of vertebrate TRPA1 regulates thermotaxis."
    Rosenzweig M., Brennan K.M., Tayler T.D., Phelps P.O., Patapoutian A., Garrity P.A.
    Genes Dev. 19:419-424(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, DISRUPTION PHENOTYPE.

Entry informationi

Entry nameiTRPA1_DROME
AccessioniPrimary (citable) accession number: Q7Z020
Secondary accession number(s): A8JNP0, Q9VSQ9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 21, 2004
Last sequence update: June 11, 2014
Last modified: May 11, 2016
This is version 106 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. Protein Spotlight
    Protein Spotlight articles and cited UniProtKB/Swiss-Prot entries
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.