Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

tRNA (cytosine-5-)-methyltransferase

Gene

TRDMT1

Organism
Bos taurus (Bovine)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Specifically methylates cytosine 38 in the anticodon loop of tRNA(Asp).By similarity

Catalytic activityi

S-adenosyl-L-methionine + cytosine(38) in tRNA = S-adenosyl-L-homocysteine + 5-methylcytosine(38) in tRNA.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei79PROSITE-ProRule annotation1

GO - Molecular functioni

Keywordsi

Molecular functionMethyltransferase, RNA-binding, Transferase
Biological processtRNA processing
LigandS-adenosyl-L-methionine

Names & Taxonomyi

Protein namesi
Recommended name:
tRNA (cytosine-5-)-methyltransferase (EC:2.1.1.204)
Alternative name(s):
DNA (cytosine-5)-methyltransferase-like protein 2
Short name:
Dnmt2
Gene namesi
Name:TRDMT1
Synonyms:DNMT2
OrganismiBos taurus (Bovine)
Taxonomic identifieri9913 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeBovinaeBos
Proteomesi

Organism-specific databases

VGNCiVGNC:36296 TRDMT1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002475601 – 391tRNA (cytosine-5-)-methyltransferaseAdd BLAST391

Proteomic databases

PaxDbiQ7YS61
PRIDEiQ7YS61

Expressioni

Gene expression databases

BgeeiENSBTAG00000020546

Interactioni

Protein-protein interaction databases

STRINGi9913.ENSBTAP00000027378

Structurei

3D structure databases

ProteinModelPortaliQ7YS61
SMRiQ7YS61
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini4 – 391SAM-dependent MTase C5-typePROSITE-ProRule annotationAdd BLAST388

Sequence similaritiesi

Belongs to the class I-like SAM-binding methyltransferase superfamily. C5-methyltransferase family.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0919 Eukaryota
COG0270 LUCA
GeneTreeiENSGT00390000016416
HOGENOMiHOG000265038
HOVERGENiHBG051385
InParanoidiQ7YS61
KOiK15336
OMAiLRYFTPK
OrthoDBiEOG091G0FXV
TreeFamiTF300024

Family and domain databases

InterProiView protein in InterPro
IPR001525 C5_MeTfrase
IPR031303 C5_meth_CS
IPR029063 SAM-dependent_MTases
PfamiView protein in Pfam
PF00145 DNA_methylase, 1 hit
PRINTSiPR00105 C5METTRFRASE
SUPFAMiSSF53335 SSF53335, 2 hits
TIGRFAMsiTIGR00675 dcm, 1 hit
PROSITEiView protein in PROSITE
PS00095 C5_MTASE_2, 1 hit
PS51679 SAM_MT_C5, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7YS61-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEPLRALELY SGIGGMHQAL RESCIPAQVV AAVDVNTVAN EVYKYNFPHT
60 70 80 90 100
QLLAKTIEGI TLEEFDRLSF NMILMSPPCQ PFTRIGLQGD VTDPRTNSFL
110 120 130 140 150
HILDILPRLQ KLPKYILLEN VKGFEMSSTR DLLIQTIENC GFQYQEFLLS
160 170 180 190 200
PTSLGIPNSR LRYFLIAKLQ PEPFPFQAPG QVLMEFPKTE SEHPPKYAIN
210 220 230 240 250
AEKKTEEKKT GPKICFDSST QCSGKEAILF KLETAGEIDR KHQQDSDLSV
260 270 280 290 300
RMLKDFLEDD IDKHSFFLPP KSLLRYALLL DIVKPTSRRS MCFTKGYGRY
310 320 330 340 350
IEGTGSVLQT TEDVQIENIY KSLTSLSQEE KIMRLSMLQL RFFTPKEIAN
360 370 380 390
LLGFPPEFGF PEMTTVKQRY RLLGNSLNVH VVAKLIKILC D
Length:391
Mass (Da):44,570
Last modified:October 1, 2003 - v1
Checksum:iFDB6EE432C98265C
GO
Isoform 2 (identifier: Q7YS61-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-391: FPEMTTVKQRYRLLGNSLNVHVVAKLIKILCD → MWDTRGPQLSFINGLRT

Show »
Length:376
Mass (Da):42,862
Checksum:iD19F839DDFE14C53
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_020573360 – 391FPEMT…KILCD → MWDTRGPQLSFINGLRT in isoform 2. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY244708 mRNA Translation: AAP20550.1
BT021768 mRNA Translation: AAX46615.1
RefSeqiNP_861528.1, NM_181812.2 [Q7YS61-1]
UniGeneiBt.22960

Genome annotation databases

EnsembliENSBTAT00000027378; ENSBTAP00000027378; ENSBTAG00000020546 [Q7YS61-1]
GeneIDi353353
KEGGibta:353353

Keywords - Coding sequence diversityi

Alternative splicing

Entry informationi

Entry nameiTRDMT_BOVIN
AccessioniPrimary (citable) accession number: Q7YS61
Secondary accession number(s): Q58D29
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: October 1, 2003
Last modified: March 28, 2018
This is version 86 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health