Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q7YS61

- TRDMT_BOVIN

UniProt

Q7YS61 - TRDMT_BOVIN

Protein

tRNA (cytosine-5-)-methyltransferase

Gene

TRDMT1

Organism
Bos taurus (Bovine)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 69 (01 Oct 2014)
      Sequence version 1 (01 Oct 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Specifically methylates cytosine 38 in the anticodon loop of tRNA(Asp).By similarity

    Catalytic activityi

    S-adenosyl-L-methionine + cytosine(38) in tRNA = S-adenosyl-L-homocysteine + 5-methylcytosine(38) in tRNA.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei79 – 791PROSITE-ProRule annotation

    GO - Molecular functioni

    1. DNA binding Source: InterPro
    2. methyltransferase activity Source: UniProtKB-KW
    3. RNA binding Source: UniProtKB-KW

    GO - Biological processi

    1. DNA methylation Source: InterPro
    2. tRNA processing Source: UniProtKB-KW

    Keywords - Molecular functioni

    Methyltransferase, Transferase

    Keywords - Biological processi

    tRNA processing

    Keywords - Ligandi

    RNA-binding, S-adenosyl-L-methionine

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    tRNA (cytosine-5-)-methyltransferase (EC:2.1.1.204)
    Alternative name(s):
    DNA (cytosine-5)-methyltransferase-like protein 2
    Short name:
    Dnmt2
    Gene namesi
    Name:TRDMT1
    Synonyms:DNMT2
    OrganismiBos taurus (Bovine)
    Taxonomic identifieri9913 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeBovinaeBos
    ProteomesiUP000009136: Chromosome 13

    Subcellular locationi

    Nucleus Curated

    GO - Cellular componenti

    1. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 391391tRNA (cytosine-5-)-methyltransferasePRO_0000247560Add
    BLAST

    Proteomic databases

    PRIDEiQ7YS61.

    Structurei

    3D structure databases

    ProteinModelPortaliQ7YS61.
    SMRiQ7YS61. Positions 2-390.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini4 – 391388SAM-dependent MTase C5-typePROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the class I-like SAM-binding methyltransferase superfamily. C5-methyltransferase family.PROSITE-ProRule annotation
    Contains 1 SAM-dependent MTase C5-type domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiCOG0270.
    GeneTreeiENSGT00390000016416.
    HOGENOMiHOG000265038.
    HOVERGENiHBG051385.
    InParanoidiQ7YS61.
    KOiK15336.
    OMAiQSFDINT.
    OrthoDBiEOG7PZRZ4.
    TreeFamiTF300024.

    Family and domain databases

    Gene3Di3.40.50.150. 1 hit.
    InterProiIPR018117. C5_DNA_meth_AS.
    IPR001525. C5_MeTfrase.
    IPR025813. DNA/tRNA_C5-MeTrfase.
    IPR029063. SAM-dependent_MTases-like.
    [Graphical view]
    PANTHERiPTHR10629. PTHR10629. 1 hit.
    PfamiPF00145. DNA_methylase. 1 hit.
    [Graphical view]
    PRINTSiPR00105. C5METTRFRASE.
    SUPFAMiSSF53335. SSF53335. 2 hits.
    TIGRFAMsiTIGR00675. dcm. 1 hit.
    PROSITEiPS00095. C5_MTASE_2. 1 hit.
    PS51679. SAM_MT_C5. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q7YS61-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEPLRALELY SGIGGMHQAL RESCIPAQVV AAVDVNTVAN EVYKYNFPHT    50
    QLLAKTIEGI TLEEFDRLSF NMILMSPPCQ PFTRIGLQGD VTDPRTNSFL 100
    HILDILPRLQ KLPKYILLEN VKGFEMSSTR DLLIQTIENC GFQYQEFLLS 150
    PTSLGIPNSR LRYFLIAKLQ PEPFPFQAPG QVLMEFPKTE SEHPPKYAIN 200
    AEKKTEEKKT GPKICFDSST QCSGKEAILF KLETAGEIDR KHQQDSDLSV 250
    RMLKDFLEDD IDKHSFFLPP KSLLRYALLL DIVKPTSRRS MCFTKGYGRY 300
    IEGTGSVLQT TEDVQIENIY KSLTSLSQEE KIMRLSMLQL RFFTPKEIAN 350
    LLGFPPEFGF PEMTTVKQRY RLLGNSLNVH VVAKLIKILC D 391
    Length:391
    Mass (Da):44,570
    Last modified:October 1, 2003 - v1
    Checksum:iFDB6EE432C98265C
    GO
    Isoform 2 (identifier: Q7YS61-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         360-391: FPEMTTVKQRYRLLGNSLNVHVVAKLIKILCD → MWDTRGPQLSFINGLRT

    Show »
    Length:376
    Mass (Da):42,862
    Checksum:iD19F839DDFE14C53
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei360 – 39132FPEMT…KILCD → MWDTRGPQLSFINGLRT in isoform 2. 1 PublicationVSP_020573Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY244708 mRNA. Translation: AAP20550.1.
    BT021768 mRNA. Translation: AAX46615.1.
    RefSeqiNP_861528.1. NM_181812.2. [Q7YS61-1]
    UniGeneiBt.22960.

    Genome annotation databases

    EnsembliENSBTAT00000027378; ENSBTAP00000027378; ENSBTAG00000020546. [Q7YS61-1]
    GeneIDi353353.
    KEGGibta:353353.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY244708 mRNA. Translation: AAP20550.1 .
    BT021768 mRNA. Translation: AAX46615.1 .
    RefSeqi NP_861528.1. NM_181812.2. [Q7YS61-1 ]
    UniGenei Bt.22960.

    3D structure databases

    ProteinModelPortali Q7YS61.
    SMRi Q7YS61. Positions 2-390.
    ModBasei Search...
    MobiDBi Search...

    Proteomic databases

    PRIDEi Q7YS61.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSBTAT00000027378 ; ENSBTAP00000027378 ; ENSBTAG00000020546 . [Q7YS61-1 ]
    GeneIDi 353353.
    KEGGi bta:353353.

    Organism-specific databases

    CTDi 1787.

    Phylogenomic databases

    eggNOGi COG0270.
    GeneTreei ENSGT00390000016416.
    HOGENOMi HOG000265038.
    HOVERGENi HBG051385.
    InParanoidi Q7YS61.
    KOi K15336.
    OMAi QSFDINT.
    OrthoDBi EOG7PZRZ4.
    TreeFami TF300024.

    Miscellaneous databases

    NextBioi 20812736.

    Family and domain databases

    Gene3Di 3.40.50.150. 1 hit.
    InterProi IPR018117. C5_DNA_meth_AS.
    IPR001525. C5_MeTfrase.
    IPR025813. DNA/tRNA_C5-MeTrfase.
    IPR029063. SAM-dependent_MTases-like.
    [Graphical view ]
    PANTHERi PTHR10629. PTHR10629. 1 hit.
    Pfami PF00145. DNA_methylase. 1 hit.
    [Graphical view ]
    PRINTSi PR00105. C5METTRFRASE.
    SUPFAMi SSF53335. SSF53335. 2 hits.
    TIGRFAMsi TIGR00675. dcm. 1 hit.
    PROSITEi PS00095. C5_MTASE_2. 1 hit.
    PS51679. SAM_MT_C5. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Analysis of DNA (cytosine 5) methyltransferase mRNA sequence and expression in bovine preimplantation embryos, fetal and adult tissues."
      Golding M.C., Westhusin M.E.
      Gene Expr. Patterns 3:551-558(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).

    Entry informationi

    Entry nameiTRDMT_BOVIN
    AccessioniPrimary (citable) accession number: Q7YS61
    Secondary accession number(s): Q58D29
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 25, 2006
    Last sequence update: October 1, 2003
    Last modified: October 1, 2014
    This is version 69 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3