Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q7YS61

- TRDMT_BOVIN

UniProt

Q7YS61 - TRDMT_BOVIN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

tRNA (cytosine-5-)-methyltransferase

Gene

TRDMT1

Organism
Bos taurus (Bovine)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli

Functioni

Specifically methylates cytosine 38 in the anticodon loop of tRNA(Asp).By similarity

Catalytic activityi

S-adenosyl-L-methionine + cytosine(38) in tRNA = S-adenosyl-L-homocysteine + 5-methylcytosine(38) in tRNA.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei79 – 791PROSITE-ProRule annotation

GO - Molecular functioni

  1. DNA binding Source: InterPro
  2. RNA binding Source: UniProtKB-KW
  3. tRNA methyltransferase activity Source: Ensembl

GO - Biological processi

  1. DNA methylation Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Methyltransferase, Transferase

Keywords - Biological processi

tRNA processing

Keywords - Ligandi

RNA-binding, S-adenosyl-L-methionine

Names & Taxonomyi

Protein namesi
Recommended name:
tRNA (cytosine-5-)-methyltransferase (EC:2.1.1.204)
Alternative name(s):
DNA (cytosine-5)-methyltransferase-like protein 2
Short name:
Dnmt2
Gene namesi
Name:TRDMT1
Synonyms:DNMT2
OrganismiBos taurus (Bovine)
Taxonomic identifieri9913 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeBovinaeBos
ProteomesiUP000009136: Chromosome 13

Subcellular locationi

Nucleus Curated

GO - Cellular componenti

  1. cytoplasm Source: Ensembl
  2. nucleus Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 391391tRNA (cytosine-5-)-methyltransferasePRO_0000247560Add
BLAST

Proteomic databases

PRIDEiQ7YS61.

Structurei

3D structure databases

ProteinModelPortaliQ7YS61.
SMRiQ7YS61. Positions 2-390.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini4 – 391388SAM-dependent MTase C5-typePROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the class I-like SAM-binding methyltransferase superfamily. C5-methyltransferase family.PROSITE-ProRule annotation
Contains 1 SAM-dependent MTase C5-type domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiCOG0270.
GeneTreeiENSGT00390000016416.
HOGENOMiHOG000265038.
HOVERGENiHBG051385.
InParanoidiQ7YS61.
KOiK15336.
OMAiQSFDINT.
OrthoDBiEOG7PZRZ4.
TreeFamiTF300024.

Family and domain databases

Gene3Di3.40.50.150. 1 hit.
InterProiIPR018117. C5_DNA_meth_AS.
IPR001525. C5_MeTfrase.
IPR025813. DNA/tRNA_C5-MeTrfase.
IPR029063. SAM-dependent_MTases-like.
[Graphical view]
PANTHERiPTHR10629. PTHR10629. 1 hit.
PfamiPF00145. DNA_methylase. 1 hit.
[Graphical view]
PRINTSiPR00105. C5METTRFRASE.
SUPFAMiSSF53335. SSF53335. 2 hits.
TIGRFAMsiTIGR00675. dcm. 1 hit.
PROSITEiPS00095. C5_MTASE_2. 1 hit.
PS51679. SAM_MT_C5. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q7YS61-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEPLRALELY SGIGGMHQAL RESCIPAQVV AAVDVNTVAN EVYKYNFPHT
60 70 80 90 100
QLLAKTIEGI TLEEFDRLSF NMILMSPPCQ PFTRIGLQGD VTDPRTNSFL
110 120 130 140 150
HILDILPRLQ KLPKYILLEN VKGFEMSSTR DLLIQTIENC GFQYQEFLLS
160 170 180 190 200
PTSLGIPNSR LRYFLIAKLQ PEPFPFQAPG QVLMEFPKTE SEHPPKYAIN
210 220 230 240 250
AEKKTEEKKT GPKICFDSST QCSGKEAILF KLETAGEIDR KHQQDSDLSV
260 270 280 290 300
RMLKDFLEDD IDKHSFFLPP KSLLRYALLL DIVKPTSRRS MCFTKGYGRY
310 320 330 340 350
IEGTGSVLQT TEDVQIENIY KSLTSLSQEE KIMRLSMLQL RFFTPKEIAN
360 370 380 390
LLGFPPEFGF PEMTTVKQRY RLLGNSLNVH VVAKLIKILC D
Length:391
Mass (Da):44,570
Last modified:October 1, 2003 - v1
Checksum:iFDB6EE432C98265C
GO
Isoform 2 (identifier: Q7YS61-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-391: FPEMTTVKQRYRLLGNSLNVHVVAKLIKILCD → MWDTRGPQLSFINGLRT

Show »
Length:376
Mass (Da):42,862
Checksum:iD19F839DDFE14C53
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei360 – 39132FPEMT…KILCD → MWDTRGPQLSFINGLRT in isoform 2. 1 PublicationVSP_020573Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY244708 mRNA. Translation: AAP20550.1.
BT021768 mRNA. Translation: AAX46615.1.
RefSeqiNP_861528.1. NM_181812.2. [Q7YS61-1]
UniGeneiBt.22960.

Genome annotation databases

EnsembliENSBTAT00000027378; ENSBTAP00000027378; ENSBTAG00000020546. [Q7YS61-1]
GeneIDi353353.
KEGGibta:353353.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY244708 mRNA. Translation: AAP20550.1 .
BT021768 mRNA. Translation: AAX46615.1 .
RefSeqi NP_861528.1. NM_181812.2. [Q7YS61-1 ]
UniGenei Bt.22960.

3D structure databases

ProteinModelPortali Q7YS61.
SMRi Q7YS61. Positions 2-390.
ModBasei Search...
MobiDBi Search...

Proteomic databases

PRIDEi Q7YS61.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSBTAT00000027378 ; ENSBTAP00000027378 ; ENSBTAG00000020546 . [Q7YS61-1 ]
GeneIDi 353353.
KEGGi bta:353353.

Organism-specific databases

CTDi 1787.

Phylogenomic databases

eggNOGi COG0270.
GeneTreei ENSGT00390000016416.
HOGENOMi HOG000265038.
HOVERGENi HBG051385.
InParanoidi Q7YS61.
KOi K15336.
OMAi QSFDINT.
OrthoDBi EOG7PZRZ4.
TreeFami TF300024.

Miscellaneous databases

NextBioi 20812736.

Family and domain databases

Gene3Di 3.40.50.150. 1 hit.
InterProi IPR018117. C5_DNA_meth_AS.
IPR001525. C5_MeTfrase.
IPR025813. DNA/tRNA_C5-MeTrfase.
IPR029063. SAM-dependent_MTases-like.
[Graphical view ]
PANTHERi PTHR10629. PTHR10629. 1 hit.
Pfami PF00145. DNA_methylase. 1 hit.
[Graphical view ]
PRINTSi PR00105. C5METTRFRASE.
SUPFAMi SSF53335. SSF53335. 2 hits.
TIGRFAMsi TIGR00675. dcm. 1 hit.
PROSITEi PS00095. C5_MTASE_2. 1 hit.
PS51679. SAM_MT_C5. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Analysis of DNA (cytosine 5) methyltransferase mRNA sequence and expression in bovine preimplantation embryos, fetal and adult tissues."
    Golding M.C., Westhusin M.E.
    Gene Expr. Patterns 3:551-558(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).

Entry informationi

Entry nameiTRDMT_BOVIN
AccessioniPrimary (citable) accession number: Q7YS61
Secondary accession number(s): Q58D29
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: October 1, 2003
Last modified: October 29, 2014
This is version 70 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3