Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q7YS61 (TRDMT_BOVIN) Reviewed, UniProtKB/Swiss-Prot

Last modified June 11, 2014. Version 68. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (1) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
tRNA (cytosine-5-)-methyltransferase

EC=2.1.1.204
Alternative name(s):
DNA (cytosine-5)-methyltransferase-like protein 2
Short name=Dnmt2
Gene names
Name:TRDMT1
Synonyms:DNMT2
OrganismBos taurus (Bovine) [Reference proteome]
Taxonomic identifier9913 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeBovinaeBos

Protein attributes

Sequence length391 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Specifically methylates cytosine 38 in the anticodon loop of tRNA(Asp) By similarity.

Catalytic activity

S-adenosyl-L-methionine + cytosine38 in tRNA = S-adenosyl-L-homocysteine + 5-methylcytosine38 in tRNA.

Subcellular location

Nucleus Probable.

Sequence similarities

Belongs to the class I-like SAM-binding methyltransferase superfamily. C5-methyltransferase family.

Contains 1 SAM-dependent MTase C5-type domain.

Ontologies

Keywords
   Biological processtRNA processing
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
   LigandRNA-binding
S-adenosyl-L-methionine
   Molecular functionMethyltransferase
Transferase
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processDNA methylation

Inferred from electronic annotation. Source: InterPro

tRNA processing

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentnucleus

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionDNA binding

Inferred from electronic annotation. Source: InterPro

RNA binding

Inferred from electronic annotation. Source: UniProtKB-KW

methyltransferase activity

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q7YS61-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q7YS61-2)

The sequence of this isoform differs from the canonical sequence as follows:
     360-391: FPEMTTVKQRYRLLGNSLNVHVVAKLIKILCD → MWDTRGPQLSFINGLRT

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 391391tRNA (cytosine-5-)-methyltransferase
PRO_0000247560

Regions

Domain4 – 391388SAM-dependent MTase C5-type

Sites

Active site791 By similarity

Natural variations

Alternative sequence360 – 39132FPEMT…KILCD → MWDTRGPQLSFINGLRT in isoform 2.
VSP_020573

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 1, 2003. Version 1.
Checksum: FDB6EE432C98265C

FASTA39144,570
        10         20         30         40         50         60 
MEPLRALELY SGIGGMHQAL RESCIPAQVV AAVDVNTVAN EVYKYNFPHT QLLAKTIEGI 

        70         80         90        100        110        120 
TLEEFDRLSF NMILMSPPCQ PFTRIGLQGD VTDPRTNSFL HILDILPRLQ KLPKYILLEN 

       130        140        150        160        170        180 
VKGFEMSSTR DLLIQTIENC GFQYQEFLLS PTSLGIPNSR LRYFLIAKLQ PEPFPFQAPG 

       190        200        210        220        230        240 
QVLMEFPKTE SEHPPKYAIN AEKKTEEKKT GPKICFDSST QCSGKEAILF KLETAGEIDR 

       250        260        270        280        290        300 
KHQQDSDLSV RMLKDFLEDD IDKHSFFLPP KSLLRYALLL DIVKPTSRRS MCFTKGYGRY 

       310        320        330        340        350        360 
IEGTGSVLQT TEDVQIENIY KSLTSLSQEE KIMRLSMLQL RFFTPKEIAN LLGFPPEFGF 

       370        380        390 
PEMTTVKQRY RLLGNSLNVH VVAKLIKILC D 

« Hide

Isoform 2 [UniParc].

Checksum: D19F839DDFE14C53
Show »

FASTA37642,862

References

« Hide 'large scale' references
[1]"Analysis of DNA (cytosine 5) methyltransferase mRNA sequence and expression in bovine preimplantation embryos, fetal and adult tissues."
Golding M.C., Westhusin M.E.
Gene Expr. Patterns 3:551-558(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[2]"Characterization of 954 bovine full-CDS cDNA sequences."
Harhay G.P., Sonstegard T.S., Keele J.W., Heaton M.P., Clawson M.L., Snelling W.M., Wiedmann R.T., Van Tassell C.P., Smith T.P.L.
BMC Genomics 6:166-166(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY244708 mRNA. Translation: AAP20550.1.
BT021768 mRNA. Translation: AAX46615.1.
RefSeqNP_861528.1. NM_181812.2. [Q7YS61-1]
UniGeneBt.22960.

3D structure databases

ProteinModelPortalQ7YS61.
SMRQ7YS61. Positions 2-390.
ModBaseSearch...
MobiDBSearch...

Proteomic databases

PRIDEQ7YS61.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSBTAT00000027378; ENSBTAP00000027378; ENSBTAG00000020546. [Q7YS61-1]
GeneID353353.
KEGGbta:353353.

Organism-specific databases

CTD1787.

Phylogenomic databases

eggNOGCOG0270.
GeneTreeENSGT00390000016416.
HOGENOMHOG000265038.
HOVERGENHBG051385.
InParanoidQ7YS61.
KOK15336.
OMAQSFDINT.
OrthoDBEOG7PZRZ4.
TreeFamTF300024.

Family and domain databases

Gene3D3.40.50.150. 1 hit.
InterProIPR018117. C5_DNA_meth_AS.
IPR001525. C5_MeTfrase.
IPR025813. DNA/tRNA_C5-MeTrfase.
IPR029063. SAM-dependent_MTases-like.
[Graphical view]
PANTHERPTHR10629. PTHR10629. 1 hit.
PfamPF00145. DNA_methylase. 1 hit.
[Graphical view]
PRINTSPR00105. C5METTRFRASE.
SUPFAMSSF53335. SSF53335. 2 hits.
TIGRFAMsTIGR00675. dcm. 1 hit.
PROSITEPS00095. C5_MTASE_2. 1 hit.
PS51679. SAM_MT_C5. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio20812736.

Entry information

Entry nameTRDMT_BOVIN
AccessionPrimary (citable) accession number: Q7YS61
Secondary accession number(s): Q58D29
Entry history
Integrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: October 1, 2003
Last modified: June 11, 2014
This is version 68 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families