Reviewed,
UniProtKB/Swiss-Prot Q7YS61 (TRDMT_BOVIN)
Last modified
February 9, 2010.
Version 39.
History...
Clusters with 100%,
90%,
50% identity |
Documents (1) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: tRNA (cytosine-5-)-methyltransferase EC=2.1.1.29 Alternative name(s): DNA (cytosine-5)-methyltransferase-like protein 2 Short name=Dnmt2 | ||||
| Gene names |
| ||||
| Organism | Bos taurus (Bovine) | ||||
| Taxonomic identifier | 9913 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Laurasiatheria › Cetartiodactyla › Ruminantia › Pecora › Bovidae › Bovinae › Bos |
Protein attributes
| Sequence length | 391 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Specifically methylates cytosine 38 in the anticodon loop of tRNA(Asp) By similarity. |
| Catalytic activity | S-adenosyl-L-methionine + tRNA = S-adenosyl-L-homocysteine + tRNA containing 5-methylcytosine. |
| Subcellular location | Nucleus Probable. |
| Sequence similarities | Belongs to the C5-methyltransferase family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | tRNA processing |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Ligand | RNA-binding S-adenosyl-L-methionine |
| Molecular function | Methyltransferase Transferase |
| Gene Ontology (GO) | |
| Biological process | DNA methylation Inferred from electronic annotation. Source: InterPro tRNA processingInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | nucleus Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | DNA binding Inferred from electronic annotation. Source: InterPro RNA bindingInferred from electronic annotation. Source: UniProtKB-KW tRNA (cytosine-5-)-methyltransferase activityInferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q7YS61-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q7YS61-2) The sequence of this isoform differs from the canonical sequence as follows: 360-391: FPEMTTVKQRYRLLGNSLNVHVVAKLIKILCD → MWDTRGPQLSFINGLRT |
Sequence annotation (Features)
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Analysis of DNA (cytosine 5) methyltransferase mRNA sequence and expression in bovine preimplantation embryos, fetal and adult tissues." Golding M.C., Westhusin M.E. Gene Expr. Patterns 3:551-558(2003) [PubMed: 12971987] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Characterization of 954 bovine full-CDS cDNA sequences." Harhay G.P., Sonstegard T.S., Keele J.W., Heaton M.P., Clawson M.L., Snelling W.M., Wiedmann R.T., Van Tassell C.P., Smith T.P.L. BMC Genomics 6:166-166(2005) [PubMed: 16305752] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY244708 mRNA. Translation: AAP20550.1. BT021768 mRNA. Translation: AAX46615.1. |
| IPI | IPI00708300. IPI00717277. |
| RefSeq | NP_861528.1. |
| UniGene | Bt.22960 |
3D structure databases | |
| SMR | Q7YS61. Positions 2-390. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q7YS61. |
Genome annotation databases | |
| Ensembl | ENSBTAT00000027378; ENSBTAP00000027378; ENSBTAG00000020546; Bos taurus. [Genome view] ENSBTAT00000027381; ENSBTAP00000027381; ENSBTAG00000020546; Bos taurus. [Genome view] |
| GeneID | 353353. |
| KEGG | bta:353353. |
Organism-specific databases | |
| CTD | 353353. |
Phylogenomic databases | |
| eggNOG | maNOG12697. |
| HOVERGEN | Q7YS61. |
| InParanoid | Q7YS61. |
| PhylomeDB | Q7YS61. |
Enzyme and pathway databases | |
| BRENDA | 2.1.1.29. 251. |
Family and domain databases | |
| InterPro | IPR001525. C5_DNA_meth. IPR018117. C5_DNA_meth_AS. [Graphical view] |
| PANTHER | PTHR10629. C5_DNA_meth. 1 hit. |
| Pfam | PF00145. DNA_methylase. 1 hit. [Graphical view] |
| PRINTS | PR00105. C5METTRFRASE. |
| TIGRFAMs | TIGR00675. dcm. 1 hit. |
| PROSITE | PS00094. C5_MTASE_1. False negative. PS00095. C5_MTASE_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | TRDMT_BOVIN | ||||||||
| Accession | Primary (citable) accession number: Q7YS61 Secondary accession number(s): Q58D29 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||

Clusters with


