Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Activating transcription factor 7-interacting protein 1

Gene

Atf7ip

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Recruiter that couples transcriptional factors to general transcription apparatus and thereby modulates transcription regulation and chromatin formation. Can both act as an activator or a repressor depending on the context. Mediates MBD1-dependent transcriptional repression, probably by recruiting complexes containing SETDB1. Required to stimulate histone methyltransferase activity of SETDB1 and facilitate the conversion of dimethylated to trimethylated H3 'Lys-9' (H3K9me3). The complex formed with MBD1 and SETDB1 represses transcription and couples DNA methylation and histone H3 'Lys-9' trimethylation (H3K9me3). May have ATPase activity.2 Publications

GO - Molecular functioni

  • ATPase activity Source: MGI
  • transcription corepressor activity Source: MGI

GO - Biological processi

Keywordsi

Molecular functionActivator, Repressor
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-MMU-3214841. PKMTs methylate histone lysines.

Names & Taxonomyi

Protein namesi
Recommended name:
Activating transcription factor 7-interacting protein 1
Alternative name(s):
ATFa-associated modulator
Short name:
mAM
MBD1-containing chromatin-associated factor 1
Gene namesi
Name:Atf7ip
Synonyms:Mcaf1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 6

Organism-specific databases

MGIiMGI:1858965. Atf7ip.

Subcellular locationi

  • Nucleus 1 Publication

GO - Cellular componenti

  • cytosol Source: MGI
  • nuclear body Source: MGI
  • nucleoplasm Source: MGI
  • nucleus Source: UniProtKB
  • transcription factor complex Source: MGI

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002817811 – 1306Activating transcription factor 7-interacting protein 1Add BLAST1306

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineBy similarity1
Cross-linki33Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei57PhosphoserineCombined sources1
Modified residuei112PhosphoserineCombined sources1
Modified residuei124PhosphothreonineBy similarity1
Modified residuei511PhosphoserineBy similarity1
Modified residuei514PhosphoserineCombined sources1
Modified residuei516PhosphoserineCombined sources1
Modified residuei533PhosphoserineBy similarity1
Cross-linki592Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei593PhosphoserineCombined sources1
Modified residuei700PhosphoserineCombined sources1
Modified residuei707PhosphoserineBy similarity1
Modified residuei933PhosphoserineBy similarity1
Cross-linki944Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki974Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ7TT18.
PaxDbiQ7TT18.
PeptideAtlasiQ7TT18.
PRIDEiQ7TT18.

PTM databases

iPTMnetiQ7TT18.
PhosphoSitePlusiQ7TT18.

Expressioni

Tissue specificityi

Ubiquitously expressed at all stages studied.1 Publication

Gene expression databases

BgeeiENSMUSG00000030213.
ExpressionAtlasiQ7TT18. baseline and differential.
GenevisibleiQ7TT18. MM.

Interactioni

Subunit structurei

Interacts with MBD1; the interaction is enhanced when MBD1 is sumoylated. Probably forms a complex with SETDB1 and MBD1. Interacts with SUMO ubiquitin-like proteins (SUMO1, SUNO2 and SUMO3), with a preference for SUMO2 and SUMO3. Interacts with SP1 and ZHX1 (By similarity). Interacts with the general transcription machinery, including ERCC2, ERCC3, GTF2E1, GTF2E2 and POLR2A (By similarity). Interacts with SETDB1 and ATF7.By similarity1 Publication

Protein-protein interaction databases

BioGridi207616. 11 interactors.
IntActiQ7TT18. 4 interactors.
MINTiMINT-4130080.
STRINGi10090.ENSMUSP00000032335.

Structurei

3D structure databases

ProteinModelPortaliQ7TT18.
SMRiQ7TT18.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1054 – 1143Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST90
Domaini1196 – 1302Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST107

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni596 – 851Interaction with SETDB1By similarityAdd BLAST256
Regioni1001 – 1011Interaction with SUMOBy similarityAdd BLAST11
Regioni1190 – 1306Interaction with MBD1By similarityAdd BLAST117

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili666 – 696Sequence analysisAdd BLAST31

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi587 – 605Nuclear localization signal1 PublicationAdd BLAST19

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi189 – 259Ser-richAdd BLAST71
Compositional biasi385 – 614Glu-richAdd BLAST230
Compositional biasi929 – 1036Ser-richAdd BLAST108

Sequence similaritiesi

Belongs to the MCAF family.Curated

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiENOG410IJ5P. Eukaryota.
ENOG410XUWA. LUCA.
GeneTreeiENSGT00530000063707.
HOVERGENiHBG087180.
InParanoidiQ7TT18.
OMAiVRQVNPQ.
OrthoDBiEOG091G058O.
PhylomeDBiQ7TT18.
TreeFamiTF329427.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiView protein in InterPro
IPR026085. ATF7-int.
IPR031870. ATF7IP_BD.
IPR003961. FN3_dom.
IPR013783. Ig-like_fold.
PANTHERiPTHR23210. PTHR23210. 1 hit.
PfamiView protein in Pfam
PF16788. ATF7IP_BD. 1 hit.
PF16794. fn3_4. 1 hit.
SUPFAMiSSF49265. SSF49265. 1 hit.
PROSITEiView protein in PROSITE
PS50853. FN3. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7TT18-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDSVEEPQKK VFKARKTMRA SDRQQLDAVH RVKGELLRAD GKLLNGSHEN
60 70 80 90 100
GDLDPTSPLE NTDCIQDREE VNGIDGICFQ SEESTTEWKE TPCMPNVAVK
110 120 130 140 150
NKQEDLNSEA LSPSITCDLS SRVTTEPGSG SPASDNPGCG TPVSDNPASD
160 170 180 190 200
NPASDNPASD NPDSGDLAAG ELATTVQATG DSACEEPPSS DPSSSDPTSS
210 220 230 240 250
EPSSSEPTCS EPISGDPVSE EAASHDLVSG DSTCSEPVSG EPVSHEAASS
260 270 280 290 300
EPATSEPASD EPVARVVAAC ELAPGESALD DCAPSGDSQS DEPPSSEDSL
310 320 330 340 350
PRSVCSGLAS GELTPGELSV EPATDTVKPS SSAVCEAGPD PDKTEPSSNN
360 370 380 390 400
SDDCPGKSED DEHLDQIQSK DSCDEGNKVN SNVVEKEEPL ETHSAIICSD
410 420 430 440 450
LPPENTTKIA EDPIAEPALE EEAISSSMEV DQSEKDEHKS PAEPVAAVSE
460 470 480 490 500
DPAEEDKEDT VVDNTDSMET DEIIPILEKL APTEDELSCF SKASLLPVET
510 520 530 540 550
SQDLEDKMEG SFGSPSKQES SENLPKEAFL VLSDEEDLSC GKDESEAVAQ
560 570 580 590 600
SKMSTPEGEK SEKDGKAEEE ERVPAEEQPP VRNEFSRRKR SKSEDMDSVE
610 620 630 640 650
SKRRRYMDEE YEAEFQVKIT AKGDINQKLQ KVIQWLLQEK LCALQCAVFD
660 670 680 690 700
KTLAELKTRV EKIECNKRHK AVLTELQAKI ARLTKRFGAA KDDLKKRQES
710 720 730 740 750
PPNPPISPGK PANDTNSNNN MTYRNAGTVR QLLESKRNVS EGPPPSFQTP
760 770 780 790 800
VNTVSSASHA TSTAVVSSQP KLQTSATSGS LPAAPLLPAP STATVVATTQ
810 820 830 840 850
VPSGTPQPTI SLQPLPVILH VPVAVTSQPQ LLQSHPGTLV TNQPSGNVEF
860 870 880 890 900
ISVQSQPTVS GLTKNPVSLP PLPNPTKPNI PSVPSPSSIQ RNSSTTAAPL
910 920 930 940 950
GTTLAVQAVP TAHSIVQATR TSLPTVGPSG LYSSSSSRGP IQMKIPISTF
960 970 980 990 1000
SPPSSAEQNS SATPRIVTEN QTNKTVDSSI NKKAADSTSQ SGKASSSDSS
1010 1020 1030 1040 1050
GVIDLTMDDE ESGTTQDPKK ISPPSSSTVS TSQPMSRPLQ PILPAPPLQP
1060 1070 1080 1090 1100
SGVPTSGPSQ ATIHVLPTAP TTVNVTHRPV TQVTTRLPVP RAPANHQVVY
1110 1120 1130 1140 1150
TTLPAPTTQA PLRGTVMQAP AVRQVNPQNS VTVRVPQTTT YVVNNGLTLG
1160 1170 1180 1190 1200
SAGPQLTVHH RPPQVHNEPP RPLHPAPLPE APQPQRLPPE AASTSLPQKP
1210 1220 1230 1240 1250
HLKLARVQSQ NGIVLSWSVL EVDRSCATVD SYHLYAYHEE PSATVPSQWK
1260 1270 1280 1290 1300
KIGEVKALPL PMACTLTQFV SGSKYYFAVR AKDIYGRFGP FCDPQSTDVI

SSSQNS
Length:1,306
Mass (Da):138,593
Last modified:October 1, 2003 - v1
Checksum:iD09FE3ACC93FA207
GO
Isoform 2 (identifier: Q7TT18-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-959: Missing.
     960-989: SSATPRIVTENQTNKTVDSSINKKAADSTS → MRPFSPLPLLLPHISLVASAPLQNQTSFIF

Note: No experimental confirmation available.
Show »
Length:347
Mass (Da):37,258
Checksum:i8F620344A6744ABE
GO

Sequence cautioni

The sequence BAE39609 differs from that shown. Reason: Frameshift at position 1203.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti121S → Y in BAE22064 (PubMed:16141072).Curated1
Sequence conflicti128G → A in CAB77024 (PubMed:10777215).Curated1
Sequence conflicti128G → A in AAH22714 (PubMed:15489334).Curated1
Sequence conflicti128G → A in AAH48827 (PubMed:15489334).Curated1
Sequence conflicti235S → G in CAB77024 (PubMed:10777215).Curated1
Sequence conflicti235S → G in AAH22714 (PubMed:15489334).Curated1
Sequence conflicti235S → G in AAH48827 (PubMed:15489334).Curated1
Sequence conflicti287D → E in AAH22714 (PubMed:15489334).Curated1
Sequence conflicti287D → E in AAH48827 (PubMed:15489334).Curated1
Sequence conflicti539S → L in CAB77024 (PubMed:10777215).Curated1
Sequence conflicti539S → L in AAH22714 (PubMed:15489334).Curated1
Sequence conflicti539S → L in AAH48827 (PubMed:15489334).Curated1
Sequence conflicti545S → P in BAE39609 (PubMed:16141072).Curated1
Sequence conflicti547A → V in AAH22714 (PubMed:15489334).Curated1
Sequence conflicti547A → V in AAH48827 (PubMed:15489334).Curated1
Sequence conflicti551S → T in CAB77024 (PubMed:10777215).Curated1
Sequence conflicti551S → T in AAH22714 (PubMed:15489334).Curated1
Sequence conflicti551S → T in AAH48827 (PubMed:15489334).Curated1
Sequence conflicti564 – 565DG → GS in CAB77024 (PubMed:10777215).Curated2
Sequence conflicti600 – 602ESK → QST in CAB77024 (PubMed:10777215).Curated3
Sequence conflicti622K → G in CAB77024 (PubMed:10777215).Curated1
Sequence conflicti631K → E in CAB77024 (PubMed:10777215).Curated1
Sequence conflicti634Q → R in CAB77024 (PubMed:10777215).Curated1
Sequence conflicti964P → T in BAE39609 (PubMed:16141072).Curated1
Sequence conflicti968T → A in CAB77024 (PubMed:10777215).Curated1
Sequence conflicti1201H → Q in BAE39609 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0240401 – 959Missing in isoform 2. 1 PublicationAdd BLAST959
Alternative sequenceiVSP_024041960 – 989SSATP…ADSTS → MRPFSPLPLLLPHISLVASA PLQNQTSFIF in isoform 2. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ132702 mRNA. Translation: CAB77024.1.
BC022714 mRNA. Translation: AAH22714.1. Different termination.
AK082697 mRNA. Translation: BAC38574.1.
AK134252 mRNA. Translation: BAE22064.1.
AK137199 mRNA. Translation: BAE23264.1.
AK157479 mRNA. Translation: BAE34096.1.
AK167542 mRNA. Translation: BAE39609.1. Frameshift.
BC048827 mRNA. Translation: AAH48827.1. Different termination.
BC052460 mRNA. Translation: AAH52460.1.
BC060246 mRNA. Translation: AAH60246.1.
CCDSiCCDS20651.1. [Q7TT18-1]
RefSeqiNP_062299.2. NM_019426.2. [Q7TT18-1]
XP_006506452.2. XM_006506389.3. [Q7TT18-1]
XP_017177170.1. XM_017321681.1. [Q7TT18-1]
UniGeneiMm.173271.
Mm.412064.
Mm.491167.

Genome annotation databases

EnsembliENSMUST00000032335; ENSMUSP00000032335; ENSMUSG00000030213. [Q7TT18-1]
GeneIDi54343.
KEGGimmu:54343.
UCSCiuc009elv.1. mouse. [Q7TT18-1]
uc009elx.1. mouse. [Q7TT18-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiMCAF1_MOUSE
AccessioniPrimary (citable) accession number: Q7TT18
Secondary accession number(s): Q3TJ86
, Q3TZW1, Q3UVK5, Q3UYZ7, Q80ZK7, Q8C4A1, Q9JK31
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: October 1, 2003
Last modified: August 30, 2017
This is version 123 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families