Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ataxin-2-like protein

Gene

Atxn2l

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Involved in the regulation of stress granule and P-body formation.By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Ataxin-2-like protein
Gene namesi
Name:Atxn2l
Synonyms:A2lp
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 7

Organism-specific databases

MGIiMGI:2446242. Atxn2l.

Subcellular locationi

  • Membrane By similarity; Peripheral membrane protein By similarity
  • Cytoplasm By similarity
  • Nucleus speckle By similarity
  • Cytoplasmic granule By similarity

  • Note: Predominantly cytoplasmic but is also detected in nuclear speckles. Component of cytoplasmic stress granules. Inhibition of methylation alters nuclear localization. Methylation does not seem to be required for localization to stress granules under stress conditions.By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Membrane, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000647551 – 1049Ataxin-2-like proteinAdd BLAST1049

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineBy similarity1
Modified residuei27PhosphoserineCombined sources1
Modified residuei45PhosphothreonineCombined sources1
Modified residuei109PhosphoserineCombined sources1
Modified residuei116PhosphotyrosineBy similarity1
Modified residuei205N6-acetyllysineCombined sources1
Modified residuei236PhosphoserineCombined sources1
Modified residuei262PhosphotyrosineBy similarity1
Modified residuei304PhosphoserineBy similarity1
Modified residuei307PhosphotyrosineBy similarity1
Modified residuei333PhosphoserineBy similarity1
Modified residuei337PhosphoserineBy similarity1
Modified residuei347PhosphotyrosineBy similarity1
Modified residuei359Asymmetric dimethylarginineBy similarity1
Modified residuei389PhosphoserineBy similarity1
Modified residuei407PhosphoserineCombined sources1
Modified residuei453PhosphoserineBy similarity1
Modified residuei496PhosphoserineCombined sources1
Modified residuei499PhosphoserineCombined sources1
Modified residuei560PhosphoserineCombined sources1
Modified residuei561PhosphoserineBy similarity1
Modified residuei562PhosphoserineBy similarity1
Modified residuei597PhosphoserineCombined sources1
Modified residuei635PhosphothreonineBy similarity1
Modified residuei637PhosphoserineCombined sources1
Modified residuei677PhosphoserineBy similarity1
Modified residuei683PhosphoserineBy similarity1
Modified residuei687PhosphoserineBy similarity1

Post-translational modificationi

Thrombopoietin triggers the phosphorylation on tyrosine residues in a way that is dependent on MPL C-terminal domain.By similarity
Asymmetrically dimethylated. Probably methylated by PRMT1.By similarity

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

PaxDbiQ7TQH0.
PeptideAtlasiQ7TQH0.
PRIDEiQ7TQH0.

PTM databases

iPTMnetiQ7TQH0.
PhosphoSitePlusiQ7TQH0.

Miscellaneous databases

PMAP-CutDBQ7TQH0.

Expressioni

Tissue specificityi

Expressed in cerebellum.1 Publication

Gene expression databases

BgeeiENSMUSG00000032637.
CleanExiMM_ATXN2L.
ExpressionAtlasiQ7TQH0. baseline and differential.
GenevisibleiQ7TQH0. MM.

Interactioni

Subunit structurei

Interacts with MPL/TPOR and EPOR and dissociates after ligand stimulation. Interacts with DDX6, G3BP, and ATXN2. Interacts with PRMT1 (By similarity). Interacts with CIC and ATXN1 (PubMed:17322884).By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

BioGridi231460. 2 interactors.
IntActiQ7TQH0. 3 interactors.
MINTiMINT-4088867.
STRINGi10090.ENSMUSP00000035415.

Structurei

3D structure databases

ProteinModelPortaliQ7TQH0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni96 – 119Interaction with MPLBy similarityAdd BLAST24

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi4 – 61Pro-richAdd BLAST58

Sequence similaritiesi

Belongs to the ataxin-2 family.Curated

Phylogenomic databases

eggNOGiKOG2375. Eukaryota.
COG5180. LUCA.
GeneTreeiENSGT00530000063565.
HOGENOMiHOG000234354.
HOVERGENiHBG050623.
InParanoidiQ7TQH0.
OrthoDBiEOG091G01U5.
PhylomeDBiQ7TQH0.
TreeFamiTF326591.

Family and domain databases

InterProiIPR009818. Ataxin-2_C.
IPR009604. LsmAD_domain.
IPR025852. SM_dom_ATX.
[Graphical view]
PfamiPF06741. LsmAD. 1 hit.
PF07145. PAM2. 1 hit.
PF14438. SM-ATX. 1 hit.
[Graphical view]
SMARTiSM01272. LsmAD. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7TQH0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLKPQPPQQT SQPQQPPPTQ QAVARRSPGG TSPPNGGLPG PLTATAAPPG
60 70 80 90 100
PPAAVSPCLG PAAAAGSGLR RGAESILAAS APPQHQERPG AVAIGSVRGQ
110 120 130 140 150
TTGKGPPQSP VFEGVYNNSR MLHFLTAVVG STCDVKVKNG TTYEGIFKTL
160 170 180 190 200
SSKFELAVDA VHRKASEPAG GPRREDIVDT MVFKPSDVLL VHFRNVDFNY
210 220 230 240 250
ATKDKFTDSA IAMNSKVNGE HKEKVLQRWE GGDSNSDDYD LESDMSNGWD
260 270 280 290 300
PNEMFKFNEE NYGVKTTYDS SLSSYTVPLE KDNSEEFRQR ELRAAQLARE
310 320 330 340 350
IESSPQYRLR IAMENDDGRT EEEKHSAVQR QGSGRESPSL VSREGKYIPL
360 370 380 390 400
PQRVREGPRG GVRCSSSRGG RPGLSSLPPR GPHHLDNSSP GPGSEARGIN
410 420 430 440 450
GGPSRMSPKA QRPLRGAKTL SSPSNRPSGE ASVPPTSAAL PFLPVGRMYP
460 470 480 490 500
PRSPKSAAPA PVSASCPEPP IGSAVASSAS IPVTSSVVDP GAGSISPASP
510 520 530 540 550
KLSLTPTDVK ELPTKEPSRN LEAQELARIA GKVPGLQNEQ KRFQLEELRK
560 570 580 590 600
FGAQFKLQPS SSPETGLDPF PSRILKEEAK GKEKEVDGLL TSDPMGSPVS
610 620 630 640 650
SKTESILDKE DKVPMAGVGG TEGPEQLPAP CPSQTGSPPV GLIKGDEKEE
660 670 680 690 700
GPVTEQVKKS TLNPNAKEFN PTKPLLSVNK STSTPTSPGP RTHSTPSIPV
710 720 730 740 750
LTAGQSGLYS PQYISYIPQI HMGPAVQAPQ MYPYPVSNSV PGQQGKYRGA
760 770 780 790 800
KGSLPPQRSD QHQPASAPPM MQAAAAAAGP PLVAATPYSS YIPYNPQQFP
810 820 830 840 850
GQPAMMQPMA HYPSQPVFAP MLQSNPRMLT SGSHPQAIVS SSTPQYPAAE
860 870 880 890 900
QPTPQALYAT VHQSYPHHAT QLHGHQPQPA TTPTGSQPQS QHAAPSPVQH
910 920 930 940 950
QAGQAPHLGS GQPQQNLYHP GALTGTPPSL PPGPSAQSPQ SSFPQPAAVY
960 970 980 990 1000
AIHPHQQLPH GFTNMAHVTQ AHVQTGVTAA PPPHPGAPHP PQVMLLHPPQ
1010 1020 1030 1040
GHGGPPQGAV PPSGVPALSA STPSPYPYIG HPQVQSHPSQ QLPFHPPGN
Length:1,049
Mass (Da):110,649
Last modified:October 1, 2003 - v1
Checksum:i27ECCFE500688D45
GO
Isoform 2 (identifier: Q7TQH0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     439-444: Missing.
     1034-1049: VQSHPSQQLPFHPPGN → GEQPGQAPGFPGGADDRIREFSLAGGIWHGRAEGLQVGQDARVLGGD

Note: No experimental confirmation available.
Show »
Length:1,074
Mass (Da):113,043
Checksum:iB1D4892E2506AC59
GO
Isoform 3 (identifier: Q7TQH0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     439-444: Missing.

Note: No experimental confirmation available.
Show »
Length:1,043
Mass (Da):110,010
Checksum:i0CC40AF28EEB87BE
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_011595439 – 444Missing in isoform 2 and isoform 3. 1 Publication6
Alternative sequenceiVSP_0115961034 – 1049VQSHP…HPPGN → GEQPGQAPGFPGGADDRIRE FSLAGGIWHGRAEGLQVGQD ARVLGGD in isoform 2. 1 PublicationAdd BLAST16

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC034083 mRNA. Translation: AAH34083.1.
BC043451 mRNA. Translation: AAH43451.1.
BC054483 mRNA. Translation: AAH54483.1.
CCDSiCCDS21831.1. [Q7TQH0-1]
RefSeqiNP_898841.1. NM_183020.1. [Q7TQH0-1]
XP_006507788.1. XM_006507725.2. [Q7TQH0-3]
UniGeneiMm.231450.

Genome annotation databases

EnsembliENSMUST00000040202; ENSMUSP00000035415; ENSMUSG00000032637. [Q7TQH0-1]
GeneIDi233871.
KEGGimmu:233871.
UCSCiuc009jrr.1. mouse. [Q7TQH0-3]
uc009jrs.1. mouse. [Q7TQH0-1]
uc009jru.1. mouse. [Q7TQH0-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC034083 mRNA. Translation: AAH34083.1.
BC043451 mRNA. Translation: AAH43451.1.
BC054483 mRNA. Translation: AAH54483.1.
CCDSiCCDS21831.1. [Q7TQH0-1]
RefSeqiNP_898841.1. NM_183020.1. [Q7TQH0-1]
XP_006507788.1. XM_006507725.2. [Q7TQH0-3]
UniGeneiMm.231450.

3D structure databases

ProteinModelPortaliQ7TQH0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi231460. 2 interactors.
IntActiQ7TQH0. 3 interactors.
MINTiMINT-4088867.
STRINGi10090.ENSMUSP00000035415.

PTM databases

iPTMnetiQ7TQH0.
PhosphoSitePlusiQ7TQH0.

Proteomic databases

PaxDbiQ7TQH0.
PeptideAtlasiQ7TQH0.
PRIDEiQ7TQH0.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000040202; ENSMUSP00000035415; ENSMUSG00000032637. [Q7TQH0-1]
GeneIDi233871.
KEGGimmu:233871.
UCSCiuc009jrr.1. mouse. [Q7TQH0-3]
uc009jrs.1. mouse. [Q7TQH0-1]
uc009jru.1. mouse. [Q7TQH0-2]

Organism-specific databases

CTDi11273.
MGIiMGI:2446242. Atxn2l.

Phylogenomic databases

eggNOGiKOG2375. Eukaryota.
COG5180. LUCA.
GeneTreeiENSGT00530000063565.
HOGENOMiHOG000234354.
HOVERGENiHBG050623.
InParanoidiQ7TQH0.
OrthoDBiEOG091G01U5.
PhylomeDBiQ7TQH0.
TreeFamiTF326591.

Miscellaneous databases

ChiTaRSiAtxn2l. mouse.
PMAP-CutDBQ7TQH0.
PROiQ7TQH0.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000032637.
CleanExiMM_ATXN2L.
ExpressionAtlasiQ7TQH0. baseline and differential.
GenevisibleiQ7TQH0. MM.

Family and domain databases

InterProiIPR009818. Ataxin-2_C.
IPR009604. LsmAD_domain.
IPR025852. SM_dom_ATX.
[Graphical view]
PfamiPF06741. LsmAD. 1 hit.
PF07145. PAM2. 1 hit.
PF14438. SM-ATX. 1 hit.
[Graphical view]
SMARTiSM01272. LsmAD. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiATX2L_MOUSE
AccessioniPrimary (citable) accession number: Q7TQH0
Secondary accession number(s): Q80XN9, Q8K059
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 13, 2004
Last sequence update: October 1, 2003
Last modified: November 2, 2016
This is version 106 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.