Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q7TPA5

- SPA11_RAT

UniProt

Q7TPA5 - SPA11_RAT

Protein

Serpin A11

Gene

Serpina11

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 75 (01 Oct 2014)
      Sequence version 2 (31 Oct 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. serine-type endopeptidase inhibitor activity Source: RefGenome

    GO - Biological processi

    1. negative regulation of endopeptidase activity Source: RefGenome
    2. regulation of proteolysis Source: RefGenome

    Keywords - Molecular functioni

    Protease inhibitor, Serine protease inhibitor

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Serpin A11
    Alternative name(s):
    Liver regeneration-related protein LRRG023
    Gene namesi
    Name:Serpina11
    ORF Names:Ab1-046
    OrganismiRattus norvegicus (Rat)
    Taxonomic identifieri10116 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
    ProteomesiUP000002494: Chromosome 6

    Organism-specific databases

    RGDi1359239. Serpina11.

    Subcellular locationi

    Secreted Curated

    GO - Cellular componenti

    1. extracellular space Source: InterPro

    Keywords - Cellular componenti

    Secreted

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2424Sequence AnalysisAdd
    BLAST
    Chaini25 – 422398Serpin A11PRO_0000041975Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi106 – 1061N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi169 – 1691N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi350 – 3501N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi385 – 3851N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    PaxDbiQ7TPA5.
    PRIDEiQ7TPA5.

    Expressioni

    Gene expression databases

    GenevestigatoriQ7TPA5.

    Structurei

    3D structure databases

    ProteinModelPortaliQ7TPA5.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the serpin family.Curated

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiCOG4826.
    GeneTreeiENSGT00740000115120.
    HOGENOMiHOG000238521.
    HOVERGENiHBG005957.
    OMAiWEVTTQS.
    OrthoDBiEOG7QC7W9.
    PhylomeDBiQ7TPA5.
    TreeFamiTF343201.

    Family and domain databases

    InterProiIPR023796. Serpin_dom.
    IPR000215. Serpin_fam.
    [Graphical view]
    PANTHERiPTHR11461. PTHR11461. 1 hit.
    PfamiPF00079. Serpin. 1 hit.
    [Graphical view]
    SMARTiSM00093. SERPIN. 1 hit.
    [Graphical view]
    SUPFAMiSSF56574. SSF56574. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q7TPA5-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGPVWLWLLI AELLLPVHYQ PSSAHGDKSL GAPQPASHQS LEPAPAYHKV    50
    TPTITNFALR LYKQLAEEIP GNILFSPVSL SSTVALLSLG AHADTQAQIL 100
    QSLGFNLTET PAADIHRGFQ SLLHTLDLPS PKLELKLGHS LFLDRQLKPQ 150
    QRFLDSAKEL YGALAFSANF TEAAATGQQI NDLVRKQTYG QVVGCLPEFD 200
    RDTLMVLLNY IFFKAKWKHP FDRYQTRKQE SFFVDQRLQL RIPMMRQKEM 250
    HRFLYDQEAS CTVLQIEYSG TALLLLVLPD PGKMQQVEAA LQPETLRRWG 300
    QRFLPSLLDL HLPRFSVSAT YNLEEILPLV GLSSLFDVEA DLSGIMGQLN 350
    KTVSRVSHKA VVDMNEKGTE AAAASGLLSQ PPSLNMTSAP HAHFNRPFLL 400
    LLWEVTTQSL LFLGKVVNPA AG 422
    Length:422
    Mass (Da):47,024
    Last modified:October 31, 2006 - v2
    Checksum:i71F5EFF86B63E7B9
    GO
    Isoform 2 (identifier: Q7TPA5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         305-305: P → PRKAQAGGAGNGGLHWDRVNEFPQNRVGKLSLKHLQMTQTW

    Note: No experimental confirmation available.

    Show »
    Length:462
    Mass (Da):51,494
    Checksum:i1FC58011A67F43E2
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei305 – 3051P → PRKAQAGGAGNGGLHWDRVN EFPQNRVGKLSLKHLQMTQT W in isoform 2. 1 PublicationVSP_021274

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY325135 mRNA. Translation: AAP92536.1.
    BC111708 mRNA. Translation: AAI11709.1.
    RefSeqiNP_001008776.1. NM_001008776.2. [Q7TPA5-2]
    NP_001159824.1. NM_001166352.1. [Q7TPA5-1]
    XP_006240543.1. XM_006240481.1. [Q7TPA5-2]
    UniGeneiRn.7875.

    Genome annotation databases

    EnsembliENSRNOT00000015516; ENSRNOP00000015516; ENSRNOG00000011141. [Q7TPA5-1]
    ENSRNOT00000047324; ENSRNOP00000041705; ENSRNOG00000011141. [Q7TPA5-2]
    GeneIDi362774.
    KEGGirno:362774.
    UCSCiRGD:1359239. rat. [Q7TPA5-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY325135 mRNA. Translation: AAP92536.1 .
    BC111708 mRNA. Translation: AAI11709.1 .
    RefSeqi NP_001008776.1. NM_001008776.2. [Q7TPA5-2 ]
    NP_001159824.1. NM_001166352.1. [Q7TPA5-1 ]
    XP_006240543.1. XM_006240481.1. [Q7TPA5-2 ]
    UniGenei Rn.7875.

    3D structure databases

    ProteinModelPortali Q7TPA5.
    ModBasei Search...
    MobiDBi Search...

    Proteomic databases

    PaxDbi Q7TPA5.
    PRIDEi Q7TPA5.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSRNOT00000015516 ; ENSRNOP00000015516 ; ENSRNOG00000011141 . [Q7TPA5-1 ]
    ENSRNOT00000047324 ; ENSRNOP00000041705 ; ENSRNOG00000011141 . [Q7TPA5-2 ]
    GeneIDi 362774.
    KEGGi rno:362774.
    UCSCi RGD:1359239. rat. [Q7TPA5-1 ]

    Organism-specific databases

    CTDi 256394.
    RGDi 1359239. Serpina11.

    Phylogenomic databases

    eggNOGi COG4826.
    GeneTreei ENSGT00740000115120.
    HOGENOMi HOG000238521.
    HOVERGENi HBG005957.
    OMAi WEVTTQS.
    OrthoDBi EOG7QC7W9.
    PhylomeDBi Q7TPA5.
    TreeFami TF343201.

    Miscellaneous databases

    NextBioi 681209.
    PROi Q7TPA5.

    Gene expression databases

    Genevestigatori Q7TPA5.

    Family and domain databases

    InterProi IPR023796. Serpin_dom.
    IPR000215. Serpin_fam.
    [Graphical view ]
    PANTHERi PTHR11461. PTHR11461. 1 hit.
    Pfami PF00079. Serpin. 1 hit.
    [Graphical view ]
    SMARTi SM00093. SERPIN. 1 hit.
    [Graphical view ]
    SUPFAMi SSF56574. SSF56574. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Liver regeneration after PH."
      Xu C.S., Li W.Q., Li Y.C., Yang K.J., Yan H.M., Chang C.F., Zhao L.F., Ma H., Wang L., Wang S.F., Han H.P., Wang G.P., Chai L.Q., Yuan J.Y., Shi J.B., Rahman S., Wang Q.N., Zhang J.B.
      Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Liver.
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Liver.

    Entry informationi

    Entry nameiSPA11_RAT
    AccessioniPrimary (citable) accession number: Q7TPA5
    Secondary accession number(s): Q2M2R9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 27, 2005
    Last sequence update: October 31, 2006
    Last modified: October 1, 2014
    This is version 75 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3