Q7TPA5 (SPA11_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 64.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Serpin A11 Alternative name(s): Liver regeneration-related protein LRRG023 | ||||
| Gene names |
| ||||
| Organism | Rattus norvegicus (Rat) [Reference proteome] | ||||
| Taxonomic identifier | 10116 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus![]() |
Protein attributes
| Sequence length | 422 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Subcellular location | Secreted Potential. |
| Sequence similarities | Belongs to the serpin family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing |
| Domain | Signal |
| Molecular function | Protease inhibitor Serine protease inhibitor |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | regulation of proteolysis Inferred from Biological aspect of Ancestor. Source: RefGenome |
| Cellular_component | extracellular region Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | serine-type endopeptidase inhibitor activity Inferred from Biological aspect of Ancestor. Source: RefGenome |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q7TPA5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q7TPA5-2) The sequence of this isoform differs from the canonical sequence as follows: 305-305: P → PRKAQAGGAGNGGLHWDRVNEFPQNRVGKLSLKHLQMTQTW | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 24 | 24 | Potential | ||||||
| Chain | 25 – 422 | 398 | Serpin A11 | PRO_0000041975 | |||||
Amino acid modifications | |||||||||
| Glycosylation | 106 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 169 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 350 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 385 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 305 | 1 | P → PRKAQAGGAGNGGLHWDRVN EFPQNRVGKLSLKHLQMTQT W in isoform 2. | VSP_021274 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Liver regeneration after PH." Xu C.S., Li W.Q., Li Y.C., Yang K.J., Yan H.M., Chang C.F., Zhao L.F., Ma H., Wang L., Wang S.F., Han H.P., Wang G.P., Chai L.Q., Yuan J.Y., Shi J.B., Rahman S., Wang Q.N., Zhang J.B. Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Liver. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Liver. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY325135 mRNA. Translation: AAP92536.1. BC111708 mRNA. Translation: AAI11709.1. |
| IPI | IPI00365901. IPI00562633. |
| RefSeq | NP_001008776.1. NM_001008776.2. NP_001159824.1. NM_001166352.1. |
| UniGene | Rn.7875. |
3D structure databases | |
| ProteinModelPortal | Q7TPA5. |
| ModBase | Search... |
Protein family/group databases | |
| MEROPS | I04.955. |
Proteomic databases | |
| PaxDb | Q7TPA5. |
| PRIDE | Q7TPA5. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSRNOT00000015516; ENSRNOP00000015516; ENSRNOG00000011141. ENSRNOT00000047324; ENSRNOP00000041705; ENSRNOG00000011141. |
| GeneID | 362774. |
| KEGG | rno:362774. |
| UCSC | RGD:1359239. rat. |
Organism-specific databases | |
| CTD | 256394. |
| RGD | 1359239. Serpina11. |
Phylogenomic databases | |
| eggNOG | COG4826. |
| GeneTree | ENSGT00700000104474. |
| HOGENOM | HOG000238521. |
| HOVERGEN | HBG005957. |
Gene expression databases | |
| Genevestigator | Q7TPA5. |
| GermOnline | ENSRNOG00000011141. Rattus norvegicus. |
Family and domain databases | |
| InterPro | IPR023796. Serpin_dom. IPR000215. Serpin_fam. [Graphical view] |
| PANTHER | PTHR11461. PTHR11461. 1 hit. |
| Pfam | PF00079. Serpin. 1 hit. [Graphical view] |
| SMART | SM00093. SERPIN. 1 hit. [Graphical view] |
| SUPFAM | SSF56574. Prot_inh_serpin. 1 hit. |
| ProtoNet | Search... |
Other | |
| NextBio | 681209. |
Entry information
| Entry name | SPA11_RAT | ||||||||
| Accession | Primary (citable) accession number: Q7TPA5 Secondary accession number(s): Q2M2R9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with
