Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q7TPA5 (SPA11_RAT) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 74. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (1) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Serpin A11
Alternative name(s):
Liver regeneration-related protein LRRG023
Gene names
Name:Serpina11
ORF Names:Ab1-046
OrganismRattus norvegicus (Rat) [Reference proteome]
Taxonomic identifier10116 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus

Protein attributes

Sequence length422 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Subcellular location

Secreted Potential.

Sequence similarities

Belongs to the serpin family.

Ontologies

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q7TPA5-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q7TPA5-2)

The sequence of this isoform differs from the canonical sequence as follows:
     305-305: P → PRKAQAGGAGNGGLHWDRVNEFPQNRVGKLSLKHLQMTQTW
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2424 Potential
Chain25 – 422398Serpin A11
PRO_0000041975

Amino acid modifications

Glycosylation1061N-linked (GlcNAc...) Potential
Glycosylation1691N-linked (GlcNAc...) Potential
Glycosylation3501N-linked (GlcNAc...) Potential
Glycosylation3851N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence3051P → PRKAQAGGAGNGGLHWDRVN EFPQNRVGKLSLKHLQMTQT W in isoform 2.
VSP_021274

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 31, 2006. Version 2.
Checksum: 71F5EFF86B63E7B9

FASTA42247,024
        10         20         30         40         50         60 
MGPVWLWLLI AELLLPVHYQ PSSAHGDKSL GAPQPASHQS LEPAPAYHKV TPTITNFALR 

        70         80         90        100        110        120 
LYKQLAEEIP GNILFSPVSL SSTVALLSLG AHADTQAQIL QSLGFNLTET PAADIHRGFQ 

       130        140        150        160        170        180 
SLLHTLDLPS PKLELKLGHS LFLDRQLKPQ QRFLDSAKEL YGALAFSANF TEAAATGQQI 

       190        200        210        220        230        240 
NDLVRKQTYG QVVGCLPEFD RDTLMVLLNY IFFKAKWKHP FDRYQTRKQE SFFVDQRLQL 

       250        260        270        280        290        300 
RIPMMRQKEM HRFLYDQEAS CTVLQIEYSG TALLLLVLPD PGKMQQVEAA LQPETLRRWG 

       310        320        330        340        350        360 
QRFLPSLLDL HLPRFSVSAT YNLEEILPLV GLSSLFDVEA DLSGIMGQLN KTVSRVSHKA 

       370        380        390        400        410        420 
VVDMNEKGTE AAAASGLLSQ PPSLNMTSAP HAHFNRPFLL LLWEVTTQSL LFLGKVVNPA 


AG 

« Hide

Isoform 2 [UniParc].

Checksum: 1FC58011A67F43E2
Show »

FASTA46251,494

References

[1]"Liver regeneration after PH."
Xu C.S., Li W.Q., Li Y.C., Yang K.J., Yan H.M., Chang C.F., Zhao L.F., Ma H., Wang L., Wang S.F., Han H.P., Wang G.P., Chai L.Q., Yuan J.Y., Shi J.B., Rahman S., Wang Q.N., Zhang J.B.
Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Liver.
[2]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Liver.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY325135 mRNA. Translation: AAP92536.1.
BC111708 mRNA. Translation: AAI11709.1.
RefSeqNP_001008776.1. NM_001008776.2. [Q7TPA5-2]
NP_001159824.1. NM_001166352.1. [Q7TPA5-1]
XP_006240543.1. XM_006240481.1. [Q7TPA5-2]
UniGeneRn.7875.

3D structure databases

ProteinModelPortalQ7TPA5.
ModBaseSearch...
MobiDBSearch...

Proteomic databases

PaxDbQ7TPA5.
PRIDEQ7TPA5.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSRNOT00000015516; ENSRNOP00000015516; ENSRNOG00000011141. [Q7TPA5-1]
ENSRNOT00000047324; ENSRNOP00000041705; ENSRNOG00000011141. [Q7TPA5-2]
GeneID362774.
KEGGrno:362774.
UCSCRGD:1359239. rat. [Q7TPA5-1]

Organism-specific databases

CTD256394.
RGD1359239. Serpina11.

Phylogenomic databases

eggNOGCOG4826.
GeneTreeENSGT00740000115120.
HOGENOMHOG000238521.
HOVERGENHBG005957.
OMAWEVTTQS.
OrthoDBEOG7QC7W9.
PhylomeDBQ7TPA5.
TreeFamTF343201.

Gene expression databases

GenevestigatorQ7TPA5.

Family and domain databases

InterProIPR023796. Serpin_dom.
IPR000215. Serpin_fam.
[Graphical view]
PANTHERPTHR11461. PTHR11461. 1 hit.
PfamPF00079. Serpin. 1 hit.
[Graphical view]
SMARTSM00093. SERPIN. 1 hit.
[Graphical view]
SUPFAMSSF56574. SSF56574. 1 hit.
ProtoNetSearch...

Other

NextBio681209.
PROQ7TPA5.

Entry information

Entry nameSPA11_RAT
AccessionPrimary (citable) accession number: Q7TPA5
Secondary accession number(s): Q2M2R9
Entry history
Integrated into UniProtKB/Swiss-Prot: September 27, 2005
Last sequence update: October 31, 2006
Last modified: July 9, 2014
This is version 74 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families