SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q7TPA5

- SPA11_RAT

UniProt

Q7TPA5 - SPA11_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Serpin A11
Gene
Serpina11, Ab1-046
Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 2 out of 5 - Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

  1. serine-type endopeptidase inhibitor activity Source: RefGenome

GO - Biological processi

  1. negative regulation of endopeptidase activity Source: RefGenome
  2. regulation of proteolysis Source: RefGenome
Complete GO annotation...

Keywords - Molecular functioni

Protease inhibitor, Serine protease inhibitor

Names & Taxonomyi

Protein namesi
Recommended name:
Serpin A11
Alternative name(s):
Liver regeneration-related protein LRRG023
Gene namesi
Name:Serpina11
ORF Names:Ab1-046
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Chromosome 6

Organism-specific databases

RGDi1359239. Serpina11.

Subcellular locationi

Secreted Reviewed prediction

GO - Cellular componenti

  1. extracellular space Source: InterPro
Complete GO annotation...

Keywords - Cellular componenti

Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2424 Reviewed prediction
Add
BLAST
Chaini25 – 422398Serpin A11
PRO_0000041975Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi106 – 1061N-linked (GlcNAc...) Reviewed prediction
Glycosylationi169 – 1691N-linked (GlcNAc...) Reviewed prediction
Glycosylationi350 – 3501N-linked (GlcNAc...) Reviewed prediction
Glycosylationi385 – 3851N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ7TPA5.
PRIDEiQ7TPA5.

Expressioni

Gene expression databases

GenevestigatoriQ7TPA5.

Structurei

3D structure databases

ProteinModelPortaliQ7TPA5.

Family & Domainsi

Sequence similaritiesi

Belongs to the serpin family.

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiCOG4826.
GeneTreeiENSGT00740000115120.
HOGENOMiHOG000238521.
HOVERGENiHBG005957.
OMAiWEVTTQS.
OrthoDBiEOG7QC7W9.
PhylomeDBiQ7TPA5.
TreeFamiTF343201.

Family and domain databases

InterProiIPR023796. Serpin_dom.
IPR000215. Serpin_fam.
[Graphical view]
PANTHERiPTHR11461. PTHR11461. 1 hit.
PfamiPF00079. Serpin. 1 hit.
[Graphical view]
SMARTiSM00093. SERPIN. 1 hit.
[Graphical view]
SUPFAMiSSF56574. SSF56574. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q7TPA5-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGPVWLWLLI AELLLPVHYQ PSSAHGDKSL GAPQPASHQS LEPAPAYHKV    50
TPTITNFALR LYKQLAEEIP GNILFSPVSL SSTVALLSLG AHADTQAQIL 100
QSLGFNLTET PAADIHRGFQ SLLHTLDLPS PKLELKLGHS LFLDRQLKPQ 150
QRFLDSAKEL YGALAFSANF TEAAATGQQI NDLVRKQTYG QVVGCLPEFD 200
RDTLMVLLNY IFFKAKWKHP FDRYQTRKQE SFFVDQRLQL RIPMMRQKEM 250
HRFLYDQEAS CTVLQIEYSG TALLLLVLPD PGKMQQVEAA LQPETLRRWG 300
QRFLPSLLDL HLPRFSVSAT YNLEEILPLV GLSSLFDVEA DLSGIMGQLN 350
KTVSRVSHKA VVDMNEKGTE AAAASGLLSQ PPSLNMTSAP HAHFNRPFLL 400
LLWEVTTQSL LFLGKVVNPA AG 422
Length:422
Mass (Da):47,024
Last modified:October 31, 2006 - v2
Checksum:i71F5EFF86B63E7B9
GO
Isoform 2 (identifier: Q7TPA5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     305-305: P → PRKAQAGGAGNGGLHWDRVNEFPQNRVGKLSLKHLQMTQTW

Note: No experimental confirmation available.

Show »
Length:462
Mass (Da):51,494
Checksum:i1FC58011A67F43E2
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei305 – 3051P → PRKAQAGGAGNGGLHWDRVN EFPQNRVGKLSLKHLQMTQT W in isoform 2.
VSP_021274

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY325135 mRNA. Translation: AAP92536.1.
BC111708 mRNA. Translation: AAI11709.1.
RefSeqiNP_001008776.1. NM_001008776.2. [Q7TPA5-2]
NP_001159824.1. NM_001166352.1. [Q7TPA5-1]
XP_006240543.1. XM_006240481.1. [Q7TPA5-2]
UniGeneiRn.7875.

Genome annotation databases

EnsembliENSRNOT00000015516; ENSRNOP00000015516; ENSRNOG00000011141. [Q7TPA5-1]
ENSRNOT00000047324; ENSRNOP00000041705; ENSRNOG00000011141. [Q7TPA5-2]
GeneIDi362774.
KEGGirno:362774.
UCSCiRGD:1359239. rat. [Q7TPA5-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY325135 mRNA. Translation: AAP92536.1 .
BC111708 mRNA. Translation: AAI11709.1 .
RefSeqi NP_001008776.1. NM_001008776.2. [Q7TPA5-2 ]
NP_001159824.1. NM_001166352.1. [Q7TPA5-1 ]
XP_006240543.1. XM_006240481.1. [Q7TPA5-2 ]
UniGenei Rn.7875.

3D structure databases

ProteinModelPortali Q7TPA5.
ModBasei Search...
MobiDBi Search...

Proteomic databases

PaxDbi Q7TPA5.
PRIDEi Q7TPA5.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSRNOT00000015516 ; ENSRNOP00000015516 ; ENSRNOG00000011141 . [Q7TPA5-1 ]
ENSRNOT00000047324 ; ENSRNOP00000041705 ; ENSRNOG00000011141 . [Q7TPA5-2 ]
GeneIDi 362774.
KEGGi rno:362774.
UCSCi RGD:1359239. rat. [Q7TPA5-1 ]

Organism-specific databases

CTDi 256394.
RGDi 1359239. Serpina11.

Phylogenomic databases

eggNOGi COG4826.
GeneTreei ENSGT00740000115120.
HOGENOMi HOG000238521.
HOVERGENi HBG005957.
OMAi WEVTTQS.
OrthoDBi EOG7QC7W9.
PhylomeDBi Q7TPA5.
TreeFami TF343201.

Miscellaneous databases

NextBioi 681209.
PROi Q7TPA5.

Gene expression databases

Genevestigatori Q7TPA5.

Family and domain databases

InterProi IPR023796. Serpin_dom.
IPR000215. Serpin_fam.
[Graphical view ]
PANTHERi PTHR11461. PTHR11461. 1 hit.
Pfami PF00079. Serpin. 1 hit.
[Graphical view ]
SMARTi SM00093. SERPIN. 1 hit.
[Graphical view ]
SUPFAMi SSF56574. SSF56574. 1 hit.
ProtoNeti Search...

Publicationsi

  1. "Liver regeneration after PH."
    Xu C.S., Li W.Q., Li Y.C., Yang K.J., Yan H.M., Chang C.F., Zhao L.F., Ma H., Wang L., Wang S.F., Han H.P., Wang G.P., Chai L.Q., Yuan J.Y., Shi J.B., Rahman S., Wang Q.N., Zhang J.B.
    Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Liver.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Liver.

Entry informationi

Entry nameiSPA11_RAT
AccessioniPrimary (citable) accession number: Q7TPA5
Secondary accession number(s): Q2M2R9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 27, 2005
Last sequence update: October 31, 2006
Last modified: July 9, 2014
This is version 74 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi