Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serpin A11

Gene

Serpina11

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Protease inhibitor, Serine protease inhibitor

Protein family/group databases

MEROPSiI04.029.

Names & Taxonomyi

Protein namesi
Recommended name:
Serpin A11
Alternative name(s):
Liver regeneration-related protein LRRG023
Gene namesi
Name:Serpina11
ORF Names:Ab1-046
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494 Componenti: Chromosome 6

Organism-specific databases

RGDi1359239. Serpina11.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2424Sequence AnalysisAdd
BLAST
Chaini25 – 422398Serpin A11PRO_0000041975Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi106 – 1061N-linked (GlcNAc...)Sequence Analysis
Glycosylationi169 – 1691N-linked (GlcNAc...)Sequence Analysis
Glycosylationi350 – 3501N-linked (GlcNAc...)Sequence Analysis
Glycosylationi385 – 3851N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ7TPA5.
PRIDEiQ7TPA5.

Expressioni

Gene expression databases

GenevisibleiQ7TPA5. RN.

Structurei

3D structure databases

ProteinModelPortaliQ7TPA5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the serpin family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiCOG4826.
GeneTreeiENSGT00760000118839.
HOGENOMiHOG000238521.
HOVERGENiHBG005957.
InParanoidiQ7TPA5.
OMAiLWEVTTQ.
OrthoDBiEOG7QC7W9.
PhylomeDBiQ7TPA5.
TreeFamiTF343201.

Family and domain databases

InterProiIPR023796. Serpin_dom.
IPR000215. Serpin_fam.
[Graphical view]
PANTHERiPTHR11461. PTHR11461. 1 hit.
PfamiPF00079. Serpin. 1 hit.
[Graphical view]
SMARTiSM00093. SERPIN. 1 hit.
[Graphical view]
SUPFAMiSSF56574. SSF56574. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7TPA5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGPVWLWLLI AELLLPVHYQ PSSAHGDKSL GAPQPASHQS LEPAPAYHKV
60 70 80 90 100
TPTITNFALR LYKQLAEEIP GNILFSPVSL SSTVALLSLG AHADTQAQIL
110 120 130 140 150
QSLGFNLTET PAADIHRGFQ SLLHTLDLPS PKLELKLGHS LFLDRQLKPQ
160 170 180 190 200
QRFLDSAKEL YGALAFSANF TEAAATGQQI NDLVRKQTYG QVVGCLPEFD
210 220 230 240 250
RDTLMVLLNY IFFKAKWKHP FDRYQTRKQE SFFVDQRLQL RIPMMRQKEM
260 270 280 290 300
HRFLYDQEAS CTVLQIEYSG TALLLLVLPD PGKMQQVEAA LQPETLRRWG
310 320 330 340 350
QRFLPSLLDL HLPRFSVSAT YNLEEILPLV GLSSLFDVEA DLSGIMGQLN
360 370 380 390 400
KTVSRVSHKA VVDMNEKGTE AAAASGLLSQ PPSLNMTSAP HAHFNRPFLL
410 420
LLWEVTTQSL LFLGKVVNPA AG
Length:422
Mass (Da):47,024
Last modified:October 31, 2006 - v2
Checksum:i71F5EFF86B63E7B9
GO
Isoform 2 (identifier: Q7TPA5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     305-305: P → PRKAQAGGAGNGGLHWDRVNEFPQNRVGKLSLKHLQMTQTW

Note: No experimental confirmation available.
Show »
Length:462
Mass (Da):51,494
Checksum:i1FC58011A67F43E2
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei305 – 3051P → PRKAQAGGAGNGGLHWDRVN EFPQNRVGKLSLKHLQMTQT W in isoform 2. 1 PublicationVSP_021274

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY325135 mRNA. Translation: AAP92536.1.
BC111708 mRNA. Translation: AAI11709.1.
RefSeqiNP_001008776.1. NM_001008776.2. [Q7TPA5-2]
NP_001159824.1. NM_001166352.1. [Q7TPA5-1]
XP_006240543.1. XM_006240481.2. [Q7TPA5-2]
UniGeneiRn.7875.

Genome annotation databases

EnsembliENSRNOT00000015516; ENSRNOP00000015516; ENSRNOG00000011141. [Q7TPA5-1]
ENSRNOT00000047324; ENSRNOP00000041705; ENSRNOG00000011141. [Q7TPA5-2]
GeneIDi362774.
KEGGirno:362774.
UCSCiRGD:1359239. rat. [Q7TPA5-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY325135 mRNA. Translation: AAP92536.1.
BC111708 mRNA. Translation: AAI11709.1.
RefSeqiNP_001008776.1. NM_001008776.2. [Q7TPA5-2]
NP_001159824.1. NM_001166352.1. [Q7TPA5-1]
XP_006240543.1. XM_006240481.2. [Q7TPA5-2]
UniGeneiRn.7875.

3D structure databases

ProteinModelPortaliQ7TPA5.
ModBaseiSearch...
MobiDBiSearch...

Protein family/group databases

MEROPSiI04.029.

Proteomic databases

PaxDbiQ7TPA5.
PRIDEiQ7TPA5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000015516; ENSRNOP00000015516; ENSRNOG00000011141. [Q7TPA5-1]
ENSRNOT00000047324; ENSRNOP00000041705; ENSRNOG00000011141. [Q7TPA5-2]
GeneIDi362774.
KEGGirno:362774.
UCSCiRGD:1359239. rat. [Q7TPA5-1]

Organism-specific databases

CTDi256394.
RGDi1359239. Serpina11.

Phylogenomic databases

eggNOGiCOG4826.
GeneTreeiENSGT00760000118839.
HOGENOMiHOG000238521.
HOVERGENiHBG005957.
InParanoidiQ7TPA5.
OMAiLWEVTTQ.
OrthoDBiEOG7QC7W9.
PhylomeDBiQ7TPA5.
TreeFamiTF343201.

Miscellaneous databases

NextBioi681209.
PROiQ7TPA5.

Gene expression databases

GenevisibleiQ7TPA5. RN.

Family and domain databases

InterProiIPR023796. Serpin_dom.
IPR000215. Serpin_fam.
[Graphical view]
PANTHERiPTHR11461. PTHR11461. 1 hit.
PfamiPF00079. Serpin. 1 hit.
[Graphical view]
SMARTiSM00093. SERPIN. 1 hit.
[Graphical view]
SUPFAMiSSF56574. SSF56574. 1 hit.
ProtoNetiSearch...

Publicationsi

  1. "Liver regeneration after PH."
    Xu C.S., Li W.Q., Li Y.C., Yang K.J., Yan H.M., Chang C.F., Zhao L.F., Ma H., Wang L., Wang S.F., Han H.P., Wang G.P., Chai L.Q., Yuan J.Y., Shi J.B., Rahman S., Wang Q.N., Zhang J.B.
    Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Liver.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Liver.

Entry informationi

Entry nameiSPA11_RAT
AccessioniPrimary (citable) accession number: Q7TPA5
Secondary accession number(s): Q2M2R9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 27, 2005
Last sequence update: October 31, 2006
Last modified: July 22, 2015
This is version 83 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.