Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Adipocyte plasma membrane-associated protein

Gene

Apmap

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Exhibits strong arylesterase activity with beta-naphthyl acetate and phenyl acetate. May play a role in adipocyte differentiation (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Adipocyte plasma membrane-associated protein
Gene namesi
Name:Apmap
ORF Names:Ab2-305
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 3

Organism-specific databases

RGDi1308874. Apmap.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei1 – 1717HelicalSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 376376Adipocyte plasma membrane-associated proteinPRO_0000370858Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi120 – 1201N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

PRIDEiQ7TP48.

PTM databases

iPTMnetiQ7TP48.
PhosphoSiteiQ7TP48.
UniCarbKBiQ7TP48.

Expressioni

Gene expression databases

BgeeiENSRNOG00000006795.
ExpressionAtlasiQ7TP48. baseline and differential.
GenevisibleiQ7TP48. RN.

Structurei

3D structure databases

ProteinModelPortaliQ7TP48.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the strictosidine synthase family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00440000039984.
HOGENOMiHOG000223914.
InParanoidiQ7TP48.
PhylomeDBiQ7TP48.

Family and domain databases

Gene3Di2.120.10.30. 1 hit.
InterProiIPR011042. 6-blade_b-propeller_TolB-like.
IPR018119. Strictosidine_synth_cons-reg.
IPR004141. Strictosidine_synthase.
[Graphical view]
PANTHERiPTHR10426. PTHR10426. 1 hit.
PfamiPF03088. Str_synth. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7TP48-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTFLMLAVSL AIPLLGAMML LESPIDPQSF SFKEPPFMFG VLQPNTKLRQ
60 70 80 90 100
AERLFENQLN GPESIVNIGD VLFTGTADGR VVKLENGEIE TIARFGSGPC
110 120 130 140 150
KTRDDEPTCG RPLGIRVGPN GTLFVVDAYK GLFEVNPQKR SVKLLLSSET
160 170 180 190 200
PIEGKKMSFV NDLTITRDGR KIYFTDSSSK WQRRDYLLLV MEGTDDGRLL
210 220 230 240 250
EYDTVTKEVK VLLDQLQFPN GVQLSPEEDF VLVAETAMAR IRRVYVSGLM
260 270 280 290 300
KGGADMFVEN MPGFPDNIRP SSSGGYWVAA ATIRANPGFS MLDFLSDKPF
310 320 330 340 350
IKRMIFKLFS QETVMKFVPR YSLVLEVSDS GAFRRSLHDP DGQVVTYVSE
360 370
AHEHDGYLYL GSFRSPFICR LSLQSI
Length:376
Mass (Da):42,062
Last modified:May 5, 2009 - v2
Checksum:i023FF1B600C688C2
GO
Isoform 2 (identifier: Q7TP48-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     70-70: D → AVYWVTPLLWTQDSRSASVPVDVKH
     198-198: R → RQVVVNVLKGWMYTGLCMSS
     327-376: VSDSGAFRRSLHDPDGQVVTYVSEAHEHDGYLYLGSFRSPFICRLSLQSI → PLTVVPSGEVCMILMDRWSPM

Show »
Length:390
Mass (Da):43,630
Checksum:iBC1AE61C93756002
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti309 – 3091F → I in AAP92602 (Ref. 1) Curated
Sequence conflicti314 – 3141V → A in AAP92602 (Ref. 1) Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei70 – 701D → AVYWVTPLLWTQDSRSASVP VDVKH in isoform 2. 1 PublicationVSP_036994
Alternative sequencei198 – 1981R → RQVVVNVLKGWMYTGLCMSS in isoform 2. 1 PublicationVSP_036995
Alternative sequencei327 – 37650VSDSG…SLQSI → PLTVVPSGEVCMILMDRWSP M in isoform 2. 1 PublicationVSP_036996Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY325201 mRNA. Translation: AAP92602.1.
BC105824 mRNA. Translation: AAI05825.1.
RefSeqiNP_001029175.1. NM_001034003.1. [Q7TP48-1]
XP_008760584.1. XM_008762362.1. [Q7TP48-1]
UniGeneiRn.2352.

Genome annotation databases

EnsembliENSRNOT00000008931; ENSRNOP00000008932; ENSRNOG00000006795. [Q7TP48-1]
GeneIDi366227.
KEGGirno:366227.
UCSCiRGD:1308874. rat. [Q7TP48-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY325201 mRNA. Translation: AAP92602.1.
BC105824 mRNA. Translation: AAI05825.1.
RefSeqiNP_001029175.1. NM_001034003.1. [Q7TP48-1]
XP_008760584.1. XM_008762362.1. [Q7TP48-1]
UniGeneiRn.2352.

3D structure databases

ProteinModelPortaliQ7TP48.
ModBaseiSearch...
MobiDBiSearch...

PTM databases

iPTMnetiQ7TP48.
PhosphoSiteiQ7TP48.
UniCarbKBiQ7TP48.

Proteomic databases

PRIDEiQ7TP48.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000008931; ENSRNOP00000008932; ENSRNOG00000006795. [Q7TP48-1]
GeneIDi366227.
KEGGirno:366227.
UCSCiRGD:1308874. rat. [Q7TP48-1]

Organism-specific databases

CTDi57136.
RGDi1308874. Apmap.

Phylogenomic databases

GeneTreeiENSGT00440000039984.
HOGENOMiHOG000223914.
InParanoidiQ7TP48.
PhylomeDBiQ7TP48.

Miscellaneous databases

PROiQ7TP48.

Gene expression databases

BgeeiENSRNOG00000006795.
ExpressionAtlasiQ7TP48. baseline and differential.
GenevisibleiQ7TP48. RN.

Family and domain databases

Gene3Di2.120.10.30. 1 hit.
InterProiIPR011042. 6-blade_b-propeller_TolB-like.
IPR018119. Strictosidine_synth_cons-reg.
IPR004141. Strictosidine_synthase.
[Graphical view]
PANTHERiPTHR10426. PTHR10426. 1 hit.
PfamiPF03088. Str_synth. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiAPMAP_RAT
AccessioniPrimary (citable) accession number: Q7TP48
Secondary accession number(s): Q3KR93
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 5, 2009
Last sequence update: May 5, 2009
Last modified: September 7, 2016
This is version 78 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.