Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transmembrane channel-like protein 6

Gene

Tmc6

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Probable ion channel.By similarity

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Ion channel

Keywords - Biological processi

Ion transport, Transport

Enzyme and pathway databases

ReactomeiR-MMU-6798695. Neutrophil degranulation.

Names & Taxonomyi

Protein namesi
Recommended name:
Transmembrane channel-like protein 6
Gene namesi
Name:Tmc6
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:1098686. Tmc6.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 205LumenalSequence analysisAdd BLAST205
Transmembranei206 – 226HelicalSequence analysisAdd BLAST21
Topological domaini227 – 253CytoplasmicSequence analysisAdd BLAST27
Transmembranei254 – 274HelicalSequence analysisAdd BLAST21
Topological domaini275 – 338LumenalSequence analysisAdd BLAST64
Transmembranei339 – 359HelicalSequence analysisAdd BLAST21
Topological domaini360 – 429CytoplasmicSequence analysisAdd BLAST70
Transmembranei430 – 450HelicalSequence analysisAdd BLAST21
Topological domaini451 – 468LumenalSequence analysisAdd BLAST18
Transmembranei469 – 489HelicalSequence analysisAdd BLAST21
Topological domaini490 – 504CytoplasmicSequence analysisAdd BLAST15
Transmembranei505 – 525HelicalSequence analysisAdd BLAST21
Topological domaini526 – 552LumenalSequence analysisAdd BLAST27
Transmembranei553 – 573HelicalSequence analysisAdd BLAST21
Topological domaini574 – 603CytoplasmicSequence analysisAdd BLAST30
Transmembranei604 – 624HelicalSequence analysisAdd BLAST21
Topological domaini625 – 649LumenalSequence analysisAdd BLAST25
Transmembranei650 – 670HelicalSequence analysisAdd BLAST21
Topological domaini671 – 721CytoplasmicSequence analysisAdd BLAST51
Transmembranei722 – 742HelicalSequence analysisAdd BLAST21
Topological domaini743 – 810LumenalSequence analysisAdd BLAST68

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001853851 – 810Transmembrane channel-like protein 6Add BLAST810

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei88PhosphothreonineBy similarity1
Modified residuei93Omega-N-methylarginineCombined sources1
Glycosylationi102N-linked (GlcNAc...)Sequence analysis1
Modified residuei104PhosphothreonineBy similarity1
Modified residuei136PhosphoserineCombined sources1
Glycosylationi311N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Glycoprotein, Methylation, Phosphoprotein

Proteomic databases

EPDiQ7TN60.
PaxDbiQ7TN60.
PRIDEiQ7TN60.

PTM databases

iPTMnetiQ7TN60.
PhosphoSitePlusiQ7TN60.

Expressioni

Tissue specificityi

Widely expressed.2 Publications

Gene expression databases

BgeeiENSMUSG00000025572.
CleanExiMM_TMC6.
ExpressionAtlasiQ7TN60. baseline and differential.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000026659.

Structurei

3D structure databases

ProteinModelPortaliQ7TN60.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the TMC family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IH09. Eukaryota.
ENOG410XR0Y. LUCA.
GeneTreeiENSGT00760000119171.
HOVERGENiHBG061579.
InParanoidiQ7TN60.
PhylomeDBiQ7TN60.

Family and domain databases

InterProiIPR012496. TMC.
[Graphical view]
PfamiPF07810. TMC. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7TN60-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAQSLALALD VPETTGDEGL EPSPYEESEV HDSFHQLIQE QSLRVAEEGL
60 70 80 90 100
ELLPLGLGRG DQTLPGLEGA PALSSATLRI LASMPSRTIG RSRGAIISQY
110 120 130 140 150
YNRTVRLRRR SSRPLLGNVV PSARPSLRLY DLELDSTILE EDEKRSLLVK
160 170 180 190 200
ELQGLSAAQR DHMVRNMPLS LGEKRCLREK SWSPKGKRRH LQGRSGAFSC
210 220 230 240 250
CSRLRYTCML ALHSLGLALL SGLYAARPWR YALKQIGGQF GSSVLSYFLF
260 270 280 290 300
LKTLLAFNAL MLLPLLAFLV GVQAAFPPDP AGPVPTFSGL ELLTGGGRFT
310 320 330 340 350
HTVMYYGYYS NSTLSPSCDA PREGGQCSPR LGSLPYNMPL AYLFTMGATF
360 370 380 390 400
FLTCIILVYS MSHSFGESYR VGSTKGIHAL TVFCSWDYKV TQKRASRVQQ
410 420 430 440 450
DSICTQLKEL LAEWHLRKRP RSVCGQLRQV VVLGLGWLLC LGSTMGCTVA
460 470 480 490 500
VLTFSEVMIQ RPASGGQGVE ALALPLVVSV LNLGASYLFR GLATLERHDS
510 520 530 540 550
PVLEVYMAIC RNLILKMAVL GVLCYHWLGR RVATLQGQCW EDFVGQELYR
560 570 580 590 600
FMVVDFIFML LDSLFGELVW RLISEKKLKR GQKPEFDIAR NVLDLIYGQT
610 620 630 640 650
LTWLGVLFSP LLPAVQILRL LFLFHIKKAS LMANCQAPRR PWLASHMSTV
660 670 680 690 700
FLTLLCFPSF LGAAVFLCYA VWQVRPSSTC GPFRTLNTMY EAGTVWVRRL
710 720 730 740 750
EHAGSGASWL PWLHHFLVEN TFFLFLASAL LLAVIYFNIQ VVKGQRKVIC
760 770 780 790 800
LLKEQIRNEG EDKIFLINKL HSVYEEEGRS RPGRTQDATE PPAWHEDGGD
810
QKEPCNPRSP
Length:810
Mass (Da):90,546
Last modified:December 6, 2005 - v2
Checksum:i6A78987C46CD4FD5
GO
Isoform 2 (identifier: Q7TN60-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-260: Missing.
     781-810: RPGRTQDATEPPAWHEDGGDQKEPCNPRSP → SKLGLVPSGHVCRSPAAAVRAPHIETDVLKLKA

Note: No experimental confirmation available.
Show »
Length:553
Mass (Da):61,806
Checksum:i89EF622E8B22B66F
GO
Isoform 3 (identifier: Q7TN60-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-360: Missing.

Note: No experimental confirmation available.
Show »
Length:450
Mass (Da):51,010
Checksum:iAF19129C11A53BD0
GO
Isoform 4 (identifier: Q7TN60-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     297-328: GRFTHTVMYYGYYSNSTLSPSCDAPREGGQCS → VRPSAPALAKNWCQACPDSPGGLLPVPRYLYG
     329-810: Missing.

Note: No experimental confirmation available.
Show »
Length:328
Mass (Da):35,819
Checksum:iEB148AF6E800968B
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti2A → T in AAP69875 (PubMed:12906855).Curated1
Sequence conflicti338M → T in AAP69875 (PubMed:12906855).Curated1
Sequence conflicti365F → L in BAC36945 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0164431 – 360Missing in isoform 3. 1 PublicationAdd BLAST360
Alternative sequenceiVSP_0164441 – 260Missing in isoform 2. 1 PublicationAdd BLAST260
Alternative sequenceiVSP_016445297 – 328GRFTH…GGQCS → VRPSAPALAKNWCQACPDSP GGLLPVPRYLYG in isoform 4. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_016446329 – 810Missing in isoform 4. 1 PublicationAdd BLAST482
Alternative sequenceiVSP_016447781 – 810RPGRT…NPRSP → SKLGLVPSGHVCRSPAAAVR APHIETDVLKLKA in isoform 2. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY236497 mRNA. Translation: AAP69875.1.
AY263158 mRNA. Translation: AAP78773.1.
AK052814 mRNA. Translation: BAC35157.1.
AK077671 mRNA. Translation: BAC36945.1.
AL645856 Genomic DNA. Translation: CAM15525.1.
BC004840 mRNA. Translation: AAH04840.2.
BC013502 mRNA. Translation: AAH13502.1.
BC058195 mRNA. Translation: AAH58195.1.
CCDSiCCDS25687.1. [Q7TN60-1]
CCDS25688.1. [Q7TN60-4]
RefSeqiNP_663414.3. NM_145439.2.
NP_851838.1. NM_181321.3. [Q7TN60-4]
UniGeneiMm.286963.

Genome annotation databases

EnsembliENSMUST00000103025; ENSMUSP00000099314; ENSMUSG00000025572. [Q7TN60-4]
GeneIDi217353.
KEGGimmu:217353.
UCSCiuc007mnn.2. mouse. [Q7TN60-2]
uc007mnr.2. mouse. [Q7TN60-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY236497 mRNA. Translation: AAP69875.1.
AY263158 mRNA. Translation: AAP78773.1.
AK052814 mRNA. Translation: BAC35157.1.
AK077671 mRNA. Translation: BAC36945.1.
AL645856 Genomic DNA. Translation: CAM15525.1.
BC004840 mRNA. Translation: AAH04840.2.
BC013502 mRNA. Translation: AAH13502.1.
BC058195 mRNA. Translation: AAH58195.1.
CCDSiCCDS25687.1. [Q7TN60-1]
CCDS25688.1. [Q7TN60-4]
RefSeqiNP_663414.3. NM_145439.2.
NP_851838.1. NM_181321.3. [Q7TN60-4]
UniGeneiMm.286963.

3D structure databases

ProteinModelPortaliQ7TN60.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000026659.

PTM databases

iPTMnetiQ7TN60.
PhosphoSitePlusiQ7TN60.

Proteomic databases

EPDiQ7TN60.
PaxDbiQ7TN60.
PRIDEiQ7TN60.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000103025; ENSMUSP00000099314; ENSMUSG00000025572. [Q7TN60-4]
GeneIDi217353.
KEGGimmu:217353.
UCSCiuc007mnn.2. mouse. [Q7TN60-2]
uc007mnr.2. mouse. [Q7TN60-4]

Organism-specific databases

CTDi11322.
MGIiMGI:1098686. Tmc6.

Phylogenomic databases

eggNOGiENOG410IH09. Eukaryota.
ENOG410XR0Y. LUCA.
GeneTreeiENSGT00760000119171.
HOVERGENiHBG061579.
InParanoidiQ7TN60.
PhylomeDBiQ7TN60.

Enzyme and pathway databases

ReactomeiR-MMU-6798695. Neutrophil degranulation.

Miscellaneous databases

PROiQ7TN60.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000025572.
CleanExiMM_TMC6.
ExpressionAtlasiQ7TN60. baseline and differential.

Family and domain databases

InterProiIPR012496. TMC.
[Graphical view]
PfamiPF07810. TMC. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTMC6_MOUSE
AccessioniPrimary (citable) accession number: Q7TN60
Secondary accession number(s): B1ATB4
, Q78JR7, Q7TQ68, Q8BP52, Q8C6Z5, Q99J32
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 6, 2005
Last sequence update: December 6, 2005
Last modified: November 30, 2016
This is version 96 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.