Q7TN60 (TMC6_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
September 21, 2011.
Version 63.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Transmembrane channel-like protein 6 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus |
Protein attributes
| Sequence length | 810 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Subcellular location | Endoplasmic reticulum membrane; Multi-pass membrane protein By similarity. |
| Tissue specificity | |
| Sequence similarities | Belongs to the TMC family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Endoplasmic reticulum Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | endoplasmic reticulum membrane Inferred from electronic annotation. Source: UniProtKB-SubCell integral to membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q7TN60-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q7TN60-2) The sequence of this isoform differs from the canonical sequence as follows: 1-260: Missing. 781-810: RPGRTQDATEPPAWHEDGGDQKEPCNPRSP → SKLGLVPSGHVCRSPAAAVRAPHIETDVLKLKA | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q7TN60-3) The sequence of this isoform differs from the canonical sequence as follows: 1-360: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q7TN60-4) The sequence of this isoform differs from the canonical sequence as follows: 297-328: GRFTHTVMYYGYYSNSTLSPSCDAPREGGQCS → VRPSAPALAKNWCQACPDSPGGLLPVPRYLYG 329-810: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 810 | 810 | Transmembrane channel-like protein 6 | PRO_0000185385 | |||||
Regions | |||||||||
| Topological domain | 1 – 205 | 205 | Lumenal Potential | ||||||
| Transmembrane | 206 – 226 | 21 | Helical; Potential | ||||||
| Topological domain | 227 – 253 | 27 | Cytoplasmic Potential | ||||||
| Transmembrane | 254 – 274 | 21 | Helical; Potential | ||||||
| Topological domain | 275 – 338 | 64 | Lumenal Potential | ||||||
| Transmembrane | 339 – 359 | 21 | Helical; Potential | ||||||
| Topological domain | 360 – 429 | 70 | Cytoplasmic Potential | ||||||
| Transmembrane | 430 – 450 | 21 | Helical; Potential | ||||||
| Topological domain | 451 – 468 | 18 | Lumenal Potential | ||||||
| Transmembrane | 469 – 489 | 21 | Helical; Potential | ||||||
| Topological domain | 490 – 504 | 15 | Cytoplasmic Potential | ||||||
| Transmembrane | 505 – 525 | 21 | Helical; Potential | ||||||
| Topological domain | 526 – 552 | 27 | Lumenal Potential | ||||||
| Transmembrane | 553 – 573 | 21 | Helical; Potential | ||||||
| Topological domain | 574 – 603 | 30 | Cytoplasmic Potential | ||||||
| Transmembrane | 604 – 624 | 21 | Helical; Potential | ||||||
| Topological domain | 625 – 649 | 25 | Lumenal Potential | ||||||
| Transmembrane | 650 – 670 | 21 | Helical; Potential | ||||||
| Topological domain | 671 – 721 | 51 | Cytoplasmic Potential | ||||||
| Transmembrane | 722 – 742 | 21 | Helical; Potential | ||||||
| Topological domain | 743 – 810 | 68 | Lumenal Potential | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 102 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 311 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 360 | 360 | Missing in isoform 3. | VSP_016443 | |||||
| Alternative sequence | 1 – 260 | 260 | Missing in isoform 2. | VSP_016444 | |||||
| Alternative sequence | 297 – 328 | 32 | GRFTH…GGQCS → VRPSAPALAKNWCQACPDSP GGLLPVPRYLYG in isoform 4. | VSP_016445 | |||||
| Alternative sequence | 329 – 810 | 482 | Missing in isoform 4. | VSP_016446 | |||||
| Alternative sequence | 781 – 810 | 30 | RPGRT…NPRSP → SKLGLVPSGHVCRSPAAAVR APHIETDVLKLKA in isoform 2. | VSP_016447 | |||||
Experimental info | |||||||||
| Sequence conflict | 2 | 1 | A → T in AAP69875. Ref.1 | ||||||
| Sequence conflict | 338 | 1 | M → T in AAP69875. Ref.1 | ||||||
| Sequence conflict | 365 | 1 | F → L in BAC36945. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization of the transmembrane channel-like (TMC) gene family: functional clues from hearing loss and epidermodysplasia verruciformis." Kurima K., Yang Y., Sorber K., Griffith A.J. Genomics 82:300-308(2003) [PubMed: 12906855] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. |
| [2] | "TMC and EVER genes belong to a larger novel family, the TMC gene family encoding transmembrane proteins." Keresztes G., Mutai H., Heller S. BMC Genomics 4:24-24(2003) [PubMed: 12812529] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. Strain: C57BL/6. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4). Strain: C57BL/6J. Tissue: Mammary gland. |
| [4] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed: 19468303] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Strain: 129 and FVB/N. Tissue: Kidney and Mammary gland. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY236497 mRNA. Translation: AAP69875.1. AY263158 mRNA. Translation: AAP78773.1. AK052814 mRNA. Translation: BAC35157.1. AK077671 mRNA. Translation: BAC36945.1. AL645856 Genomic DNA. Translation: CAM15525.1. BC004840 mRNA. Translation: AAH04840.2. BC013502 mRNA. Translation: AAH13502.1. BC058195 mRNA. Translation: AAH58195.1. |
| IPI | IPI00226579. IPI00403990. IPI00468699. IPI00656275. |
| RefSeq | NP_663414.3. NM_145439.2. NP_851838.1. NM_181321.3. |
| UniGene | Mm.286963. |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q7TN60. |
PTM databases | |
| PhosphoSite | Q7TN60. |
Proteomic databases | |
| PRIDE | Q7TN60. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000103025; ENSMUSP00000099314; ENSMUSG00000025572. |
| GeneID | 217353. |
| KEGG | mmu:217353. |
| UCSC | uc007mnn.2. mouse. uc007mnr.2. mouse. |
Organism-specific databases | |
| CTD | 11322. |
| MGI | MGI:1098686. Tmc6. |
Phylogenomic databases | |
| eggNOG | roNOG08310. |
| GeneTree | ENSGT00550000074255. |
| HOGENOM | HBG446241. |
| HOVERGEN | HBG061579. |
| InParanoid | Q7TN60. |
| OrthoDB | EOG4NP73F. |
Gene expression databases | |
| ArrayExpress | Q7TN60. |
| Bgee | Q7TN60. |
| CleanEx | MM_TMC6. |
| Genevestigator | Q7TN60. |
| GermOnline | ENSMUSG00000025572. Mus musculus. |
Family and domain databases | |
| InterPro | IPR012496. TMC. [Graphical view] |
| Pfam | PF07810. TMC. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 375801. |
| SOURCE | Search... |
Entry information
| Entry name | TMC6_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q7TN60 Secondary accession number(s): B1ATB4 Q99J32 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with