Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q7TN60 (TMC6_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 79. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Transmembrane channel-like protein 6
Gene names
Name:Tmc6
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length810 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Probable ion channel By similarity.

Subcellular location

Endoplasmic reticulum membrane; Multi-pass membrane protein By similarity.

Tissue specificity

Widely expressed. Ref.1 Ref.2

Sequence similarities

Belongs to the TMC family.

Ontologies

Keywords
   Biological processIon transport
Transport
   Cellular componentEndoplasmic reticulum
Membrane
   Coding sequence diversityAlternative splicing
   DomainTransmembrane
Transmembrane helix
   Molecular functionIon channel
   PTMGlycoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_procession transport

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentendoplasmic reticulum membrane

Inferred from electronic annotation. Source: UniProtKB-SubCell

integral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q7TN60-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q7TN60-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-260: Missing.
     781-810: RPGRTQDATEPPAWHEDGGDQKEPCNPRSP → SKLGLVPSGHVCRSPAAAVRAPHIETDVLKLKA
Note: No experimental confirmation available.
Isoform 3 (identifier: Q7TN60-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-360: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: Q7TN60-4)

The sequence of this isoform differs from the canonical sequence as follows:
     297-328: GRFTHTVMYYGYYSNSTLSPSCDAPREGGQCS → VRPSAPALAKNWCQACPDSPGGLLPVPRYLYG
     329-810: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 810810Transmembrane channel-like protein 6
PRO_0000185385

Regions

Topological domain1 – 205205Lumenal Potential
Transmembrane206 – 22621Helical; Potential
Topological domain227 – 25327Cytoplasmic Potential
Transmembrane254 – 27421Helical; Potential
Topological domain275 – 33864Lumenal Potential
Transmembrane339 – 35921Helical; Potential
Topological domain360 – 42970Cytoplasmic Potential
Transmembrane430 – 45021Helical; Potential
Topological domain451 – 46818Lumenal Potential
Transmembrane469 – 48921Helical; Potential
Topological domain490 – 50415Cytoplasmic Potential
Transmembrane505 – 52521Helical; Potential
Topological domain526 – 55227Lumenal Potential
Transmembrane553 – 57321Helical; Potential
Topological domain574 – 60330Cytoplasmic Potential
Transmembrane604 – 62421Helical; Potential
Topological domain625 – 64925Lumenal Potential
Transmembrane650 – 67021Helical; Potential
Topological domain671 – 72151Cytoplasmic Potential
Transmembrane722 – 74221Helical; Potential
Topological domain743 – 81068Lumenal Potential

Amino acid modifications

Glycosylation1021N-linked (GlcNAc...) Potential
Glycosylation3111N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence1 – 360360Missing in isoform 3.
VSP_016443
Alternative sequence1 – 260260Missing in isoform 2.
VSP_016444
Alternative sequence297 – 32832GRFTH…GGQCS → VRPSAPALAKNWCQACPDSP GGLLPVPRYLYG in isoform 4.
VSP_016445
Alternative sequence329 – 810482Missing in isoform 4.
VSP_016446
Alternative sequence781 – 81030RPGRT…NPRSP → SKLGLVPSGHVCRSPAAAVR APHIETDVLKLKA in isoform 2.
VSP_016447

Experimental info

Sequence conflict21A → T in AAP69875. Ref.1
Sequence conflict3381M → T in AAP69875. Ref.1
Sequence conflict3651F → L in BAC36945. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified December 6, 2005. Version 2.
Checksum: 6A78987C46CD4FD5

FASTA81090,546
        10         20         30         40         50         60 
MAQSLALALD VPETTGDEGL EPSPYEESEV HDSFHQLIQE QSLRVAEEGL ELLPLGLGRG 

        70         80         90        100        110        120 
DQTLPGLEGA PALSSATLRI LASMPSRTIG RSRGAIISQY YNRTVRLRRR SSRPLLGNVV 

       130        140        150        160        170        180 
PSARPSLRLY DLELDSTILE EDEKRSLLVK ELQGLSAAQR DHMVRNMPLS LGEKRCLREK 

       190        200        210        220        230        240 
SWSPKGKRRH LQGRSGAFSC CSRLRYTCML ALHSLGLALL SGLYAARPWR YALKQIGGQF 

       250        260        270        280        290        300 
GSSVLSYFLF LKTLLAFNAL MLLPLLAFLV GVQAAFPPDP AGPVPTFSGL ELLTGGGRFT 

       310        320        330        340        350        360 
HTVMYYGYYS NSTLSPSCDA PREGGQCSPR LGSLPYNMPL AYLFTMGATF FLTCIILVYS 

       370        380        390        400        410        420 
MSHSFGESYR VGSTKGIHAL TVFCSWDYKV TQKRASRVQQ DSICTQLKEL LAEWHLRKRP 

       430        440        450        460        470        480 
RSVCGQLRQV VVLGLGWLLC LGSTMGCTVA VLTFSEVMIQ RPASGGQGVE ALALPLVVSV 

       490        500        510        520        530        540 
LNLGASYLFR GLATLERHDS PVLEVYMAIC RNLILKMAVL GVLCYHWLGR RVATLQGQCW 

       550        560        570        580        590        600 
EDFVGQELYR FMVVDFIFML LDSLFGELVW RLISEKKLKR GQKPEFDIAR NVLDLIYGQT 

       610        620        630        640        650        660 
LTWLGVLFSP LLPAVQILRL LFLFHIKKAS LMANCQAPRR PWLASHMSTV FLTLLCFPSF 

       670        680        690        700        710        720 
LGAAVFLCYA VWQVRPSSTC GPFRTLNTMY EAGTVWVRRL EHAGSGASWL PWLHHFLVEN 

       730        740        750        760        770        780 
TFFLFLASAL LLAVIYFNIQ VVKGQRKVIC LLKEQIRNEG EDKIFLINKL HSVYEEEGRS 

       790        800        810 
RPGRTQDATE PPAWHEDGGD QKEPCNPRSP 

« Hide

Isoform 2 [UniParc].

Checksum: 89EF622E8B22B66F
Show »

FASTA55361,806
Isoform 3 [UniParc].

Checksum: AF19129C11A53BD0
Show »

FASTA45051,010
Isoform 4 [UniParc].

Checksum: EB148AF6E800968B
Show »

FASTA32835,819

References

« Hide 'large scale' references
[1]"Characterization of the transmembrane channel-like (TMC) gene family: functional clues from hearing loss and epidermodysplasia verruciformis."
Kurima K., Yang Y., Sorber K., Griffith A.J.
Genomics 82:300-308(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
[2]"TMC and EVER genes belong to a larger novel family, the TMC gene family encoding transmembrane proteins."
Keresztes G., Mutai H., Heller S.
BMC Genomics 4:24-24(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
Strain: C57BL/6.
[3]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4).
Strain: C57BL/6J.
Tissue: Mammary gland.
[4]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
Strain: 129 and FVB/N.
Tissue: Kidney and Mammary gland.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY236497 mRNA. Translation: AAP69875.1.
AY263158 mRNA. Translation: AAP78773.1.
AK052814 mRNA. Translation: BAC35157.1.
AK077671 mRNA. Translation: BAC36945.1.
AL645856 Genomic DNA. Translation: CAM15525.1.
BC004840 mRNA. Translation: AAH04840.2.
BC013502 mRNA. Translation: AAH13502.1.
BC058195 mRNA. Translation: AAH58195.1.
CCDSCCDS25687.1. [Q7TN60-1]
CCDS25688.1. [Q7TN60-4]
RefSeqNP_663414.3. NM_145439.2.
NP_851838.1. NM_181321.3. [Q7TN60-4]
UniGeneMm.286963.

3D structure databases

ModBaseSearch...
MobiDBSearch...

PTM databases

PhosphoSiteQ7TN60.

Proteomic databases

PRIDEQ7TN60.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000103025; ENSMUSP00000099314; ENSMUSG00000025572. [Q7TN60-4]
GeneID217353.
KEGGmmu:217353.
UCSCuc007mnr.2. mouse. [Q7TN60-4]

Organism-specific databases

CTD11322.
MGIMGI:1098686. Tmc6.

Phylogenomic databases

eggNOGNOG78295.
GeneTreeENSGT00670000097681.
HOVERGENHBG061579.
InParanoidQ7TN60.
OMAGHIARTE.
PhylomeDBQ7TN60.

Gene expression databases

ArrayExpressQ7TN60.
BgeeQ7TN60.
CleanExMM_TMC6.
GenevestigatorQ7TN60.

Family and domain databases

InterProIPR012496. TMC.
[Graphical view]
PfamPF07810. TMC. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio375801.
PROQ7TN60.
SOURCESearch...

Entry information

Entry nameTMC6_MOUSE
AccessionPrimary (citable) accession number: Q7TN60
Secondary accession number(s): B1ATB4 expand/collapse secondary AC list , Q78JR7, Q7TQ68, Q8BP52, Q8C6Z5, Q99J32
Entry history
Integrated into UniProtKB/Swiss-Prot: December 6, 2005
Last sequence update: December 6, 2005
Last modified: July 9, 2014
This is version 79 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot