Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q7TN60

- TMC6_MOUSE

UniProt

Q7TN60 - TMC6_MOUSE

Protein

Transmembrane channel-like protein 6

Gene

Tmc6

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 80 (01 Oct 2014)
      Sequence version 2 (06 Dec 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Probable ion channel.By similarity

    GO - Biological processi

    1. ion transport Source: UniProtKB-KW

    Keywords - Molecular functioni

    Ion channel

    Keywords - Biological processi

    Ion transport, Transport

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Transmembrane channel-like protein 6
    Gene namesi
    Name:Tmc6
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 11

    Organism-specific databases

    MGIiMGI:1098686. Tmc6.

    Subcellular locationi

    GO - Cellular componenti

    1. endoplasmic reticulum membrane Source: UniProtKB-SubCell
    2. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 810810Transmembrane channel-like protein 6PRO_0000185385Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi102 – 1021N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi311 – 3111N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    PRIDEiQ7TN60.

    PTM databases

    PhosphoSiteiQ7TN60.

    Expressioni

    Tissue specificityi

    Widely expressed.2 Publications

    Gene expression databases

    ArrayExpressiQ7TN60.
    BgeeiQ7TN60.
    CleanExiMM_TMC6.
    GenevestigatoriQ7TN60.

    Structurei

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 205205LumenalSequence AnalysisAdd
    BLAST
    Topological domaini227 – 25327CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini275 – 33864LumenalSequence AnalysisAdd
    BLAST
    Topological domaini360 – 42970CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini451 – 46818LumenalSequence AnalysisAdd
    BLAST
    Topological domaini490 – 50415CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini526 – 55227LumenalSequence AnalysisAdd
    BLAST
    Topological domaini574 – 60330CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini625 – 64925LumenalSequence AnalysisAdd
    BLAST
    Topological domaini671 – 72151CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini743 – 81068LumenalSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei206 – 22621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei254 – 27421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei339 – 35921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei430 – 45021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei469 – 48921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei505 – 52521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei553 – 57321HelicalSequence AnalysisAdd
    BLAST
    Transmembranei604 – 62421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei650 – 67021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei722 – 74221HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the TMC family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG78295.
    GeneTreeiENSGT00670000097681.
    HOVERGENiHBG061579.
    InParanoidiQ7TN60.
    OMAiGHIARTE.
    PhylomeDBiQ7TN60.

    Family and domain databases

    InterProiIPR012496. TMC.
    [Graphical view]
    PfamiPF07810. TMC. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q7TN60-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAQSLALALD VPETTGDEGL EPSPYEESEV HDSFHQLIQE QSLRVAEEGL    50
    ELLPLGLGRG DQTLPGLEGA PALSSATLRI LASMPSRTIG RSRGAIISQY 100
    YNRTVRLRRR SSRPLLGNVV PSARPSLRLY DLELDSTILE EDEKRSLLVK 150
    ELQGLSAAQR DHMVRNMPLS LGEKRCLREK SWSPKGKRRH LQGRSGAFSC 200
    CSRLRYTCML ALHSLGLALL SGLYAARPWR YALKQIGGQF GSSVLSYFLF 250
    LKTLLAFNAL MLLPLLAFLV GVQAAFPPDP AGPVPTFSGL ELLTGGGRFT 300
    HTVMYYGYYS NSTLSPSCDA PREGGQCSPR LGSLPYNMPL AYLFTMGATF 350
    FLTCIILVYS MSHSFGESYR VGSTKGIHAL TVFCSWDYKV TQKRASRVQQ 400
    DSICTQLKEL LAEWHLRKRP RSVCGQLRQV VVLGLGWLLC LGSTMGCTVA 450
    VLTFSEVMIQ RPASGGQGVE ALALPLVVSV LNLGASYLFR GLATLERHDS 500
    PVLEVYMAIC RNLILKMAVL GVLCYHWLGR RVATLQGQCW EDFVGQELYR 550
    FMVVDFIFML LDSLFGELVW RLISEKKLKR GQKPEFDIAR NVLDLIYGQT 600
    LTWLGVLFSP LLPAVQILRL LFLFHIKKAS LMANCQAPRR PWLASHMSTV 650
    FLTLLCFPSF LGAAVFLCYA VWQVRPSSTC GPFRTLNTMY EAGTVWVRRL 700
    EHAGSGASWL PWLHHFLVEN TFFLFLASAL LLAVIYFNIQ VVKGQRKVIC 750
    LLKEQIRNEG EDKIFLINKL HSVYEEEGRS RPGRTQDATE PPAWHEDGGD 800
    QKEPCNPRSP 810
    Length:810
    Mass (Da):90,546
    Last modified:December 6, 2005 - v2
    Checksum:i6A78987C46CD4FD5
    GO
    Isoform 2 (identifier: Q7TN60-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-260: Missing.
         781-810: RPGRTQDATEPPAWHEDGGDQKEPCNPRSP → SKLGLVPSGHVCRSPAAAVRAPHIETDVLKLKA

    Note: No experimental confirmation available.

    Show »
    Length:553
    Mass (Da):61,806
    Checksum:i89EF622E8B22B66F
    GO
    Isoform 3 (identifier: Q7TN60-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-360: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:450
    Mass (Da):51,010
    Checksum:iAF19129C11A53BD0
    GO
    Isoform 4 (identifier: Q7TN60-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         297-328: GRFTHTVMYYGYYSNSTLSPSCDAPREGGQCS → VRPSAPALAKNWCQACPDSPGGLLPVPRYLYG
         329-810: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:328
    Mass (Da):35,819
    Checksum:iEB148AF6E800968B
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti2 – 21A → T in AAP69875. (PubMed:12906855)Curated
    Sequence conflicti338 – 3381M → T in AAP69875. (PubMed:12906855)Curated
    Sequence conflicti365 – 3651F → L in BAC36945. (PubMed:16141072)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 360360Missing in isoform 3. 1 PublicationVSP_016443Add
    BLAST
    Alternative sequencei1 – 260260Missing in isoform 2. 1 PublicationVSP_016444Add
    BLAST
    Alternative sequencei297 – 32832GRFTH…GGQCS → VRPSAPALAKNWCQACPDSP GGLLPVPRYLYG in isoform 4. 1 PublicationVSP_016445Add
    BLAST
    Alternative sequencei329 – 810482Missing in isoform 4. 1 PublicationVSP_016446Add
    BLAST
    Alternative sequencei781 – 81030RPGRT…NPRSP → SKLGLVPSGHVCRSPAAAVR APHIETDVLKLKA in isoform 2. 1 PublicationVSP_016447Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY236497 mRNA. Translation: AAP69875.1.
    AY263158 mRNA. Translation: AAP78773.1.
    AK052814 mRNA. Translation: BAC35157.1.
    AK077671 mRNA. Translation: BAC36945.1.
    AL645856 Genomic DNA. Translation: CAM15525.1.
    BC004840 mRNA. Translation: AAH04840.2.
    BC013502 mRNA. Translation: AAH13502.1.
    BC058195 mRNA. Translation: AAH58195.1.
    CCDSiCCDS25687.1. [Q7TN60-1]
    CCDS25688.1. [Q7TN60-4]
    RefSeqiNP_663414.3. NM_145439.2.
    NP_851838.1. NM_181321.3. [Q7TN60-4]
    UniGeneiMm.286963.

    Genome annotation databases

    EnsembliENSMUST00000103025; ENSMUSP00000099314; ENSMUSG00000025572. [Q7TN60-4]
    GeneIDi217353.
    KEGGimmu:217353.
    UCSCiuc007mnr.2. mouse. [Q7TN60-4]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY236497 mRNA. Translation: AAP69875.1 .
    AY263158 mRNA. Translation: AAP78773.1 .
    AK052814 mRNA. Translation: BAC35157.1 .
    AK077671 mRNA. Translation: BAC36945.1 .
    AL645856 Genomic DNA. Translation: CAM15525.1 .
    BC004840 mRNA. Translation: AAH04840.2 .
    BC013502 mRNA. Translation: AAH13502.1 .
    BC058195 mRNA. Translation: AAH58195.1 .
    CCDSi CCDS25687.1. [Q7TN60-1 ]
    CCDS25688.1. [Q7TN60-4 ]
    RefSeqi NP_663414.3. NM_145439.2.
    NP_851838.1. NM_181321.3. [Q7TN60-4 ]
    UniGenei Mm.286963.

    3D structure databases

    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei Q7TN60.

    Proteomic databases

    PRIDEi Q7TN60.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000103025 ; ENSMUSP00000099314 ; ENSMUSG00000025572 . [Q7TN60-4 ]
    GeneIDi 217353.
    KEGGi mmu:217353.
    UCSCi uc007mnr.2. mouse. [Q7TN60-4 ]

    Organism-specific databases

    CTDi 11322.
    MGIi MGI:1098686. Tmc6.

    Phylogenomic databases

    eggNOGi NOG78295.
    GeneTreei ENSGT00670000097681.
    HOVERGENi HBG061579.
    InParanoidi Q7TN60.
    OMAi GHIARTE.
    PhylomeDBi Q7TN60.

    Miscellaneous databases

    NextBioi 375801.
    PROi Q7TN60.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q7TN60.
    Bgeei Q7TN60.
    CleanExi MM_TMC6.
    Genevestigatori Q7TN60.

    Family and domain databases

    InterProi IPR012496. TMC.
    [Graphical view ]
    Pfami PF07810. TMC. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Characterization of the transmembrane channel-like (TMC) gene family: functional clues from hearing loss and epidermodysplasia verruciformis."
      Kurima K., Yang Y., Sorber K., Griffith A.J.
      Genomics 82:300-308(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    2. "TMC and EVER genes belong to a larger novel family, the TMC gene family encoding transmembrane proteins."
      Keresztes G., Mutai H., Heller S.
      BMC Genomics 4:24-24(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
      Strain: C57BL/6.
    3. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4).
      Strain: C57BL/6J.
      Tissue: Mammary gland.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
      Strain: 129 and FVB/N.
      Tissue: Kidney and Mammary gland.

    Entry informationi

    Entry nameiTMC6_MOUSE
    AccessioniPrimary (citable) accession number: Q7TN60
    Secondary accession number(s): B1ATB4
    , Q78JR7, Q7TQ68, Q8BP52, Q8C6Z5, Q99J32
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 6, 2005
    Last sequence update: December 6, 2005
    Last modified: October 1, 2014
    This is version 80 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3