SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q7TN60

- TMC6_MOUSE

UniProt

Q7TN60 - TMC6_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Transmembrane channel-like protein 6
Gene
Tmc6
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at transcript leveli

Functioni

Probable ion channel By similarity.

GO - Biological processi

  1. ion transport Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Ion channel

Keywords - Biological processi

Ion transport, Transport

Names & Taxonomyi

Protein namesi
Recommended name:
Transmembrane channel-like protein 6
Gene namesi
Name:Tmc6
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 11

Organism-specific databases

MGIiMGI:1098686. Tmc6.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 205205Lumenal Reviewed prediction
Add
BLAST
Transmembranei206 – 22621Helical; Reviewed prediction
Add
BLAST
Topological domaini227 – 25327Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei254 – 27421Helical; Reviewed prediction
Add
BLAST
Topological domaini275 – 33864Lumenal Reviewed prediction
Add
BLAST
Transmembranei339 – 35921Helical; Reviewed prediction
Add
BLAST
Topological domaini360 – 42970Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei430 – 45021Helical; Reviewed prediction
Add
BLAST
Topological domaini451 – 46818Lumenal Reviewed prediction
Add
BLAST
Transmembranei469 – 48921Helical; Reviewed prediction
Add
BLAST
Topological domaini490 – 50415Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei505 – 52521Helical; Reviewed prediction
Add
BLAST
Topological domaini526 – 55227Lumenal Reviewed prediction
Add
BLAST
Transmembranei553 – 57321Helical; Reviewed prediction
Add
BLAST
Topological domaini574 – 60330Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei604 – 62421Helical; Reviewed prediction
Add
BLAST
Topological domaini625 – 64925Lumenal Reviewed prediction
Add
BLAST
Transmembranei650 – 67021Helical; Reviewed prediction
Add
BLAST
Topological domaini671 – 72151Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei722 – 74221Helical; Reviewed prediction
Add
BLAST
Topological domaini743 – 81068Lumenal Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. endoplasmic reticulum membrane Source: UniProtKB-SubCell
  2. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 810810Transmembrane channel-like protein 6
PRO_0000185385Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi102 – 1021N-linked (GlcNAc...) Reviewed prediction
Glycosylationi311 – 3111N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Glycoprotein

Proteomic databases

PRIDEiQ7TN60.

PTM databases

PhosphoSiteiQ7TN60.

Expressioni

Tissue specificityi

Widely expressed.2 Publications

Gene expression databases

ArrayExpressiQ7TN60.
BgeeiQ7TN60.
CleanExiMM_TMC6.
GenevestigatoriQ7TN60.

Family & Domainsi

Sequence similaritiesi

Belongs to the TMC family.

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG78295.
GeneTreeiENSGT00670000097681.
HOVERGENiHBG061579.
InParanoidiQ7TN60.
OMAiGHIARTE.
PhylomeDBiQ7TN60.

Family and domain databases

InterProiIPR012496. TMC.
[Graphical view]
PfamiPF07810. TMC. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q7TN60-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAQSLALALD VPETTGDEGL EPSPYEESEV HDSFHQLIQE QSLRVAEEGL    50
ELLPLGLGRG DQTLPGLEGA PALSSATLRI LASMPSRTIG RSRGAIISQY 100
YNRTVRLRRR SSRPLLGNVV PSARPSLRLY DLELDSTILE EDEKRSLLVK 150
ELQGLSAAQR DHMVRNMPLS LGEKRCLREK SWSPKGKRRH LQGRSGAFSC 200
CSRLRYTCML ALHSLGLALL SGLYAARPWR YALKQIGGQF GSSVLSYFLF 250
LKTLLAFNAL MLLPLLAFLV GVQAAFPPDP AGPVPTFSGL ELLTGGGRFT 300
HTVMYYGYYS NSTLSPSCDA PREGGQCSPR LGSLPYNMPL AYLFTMGATF 350
FLTCIILVYS MSHSFGESYR VGSTKGIHAL TVFCSWDYKV TQKRASRVQQ 400
DSICTQLKEL LAEWHLRKRP RSVCGQLRQV VVLGLGWLLC LGSTMGCTVA 450
VLTFSEVMIQ RPASGGQGVE ALALPLVVSV LNLGASYLFR GLATLERHDS 500
PVLEVYMAIC RNLILKMAVL GVLCYHWLGR RVATLQGQCW EDFVGQELYR 550
FMVVDFIFML LDSLFGELVW RLISEKKLKR GQKPEFDIAR NVLDLIYGQT 600
LTWLGVLFSP LLPAVQILRL LFLFHIKKAS LMANCQAPRR PWLASHMSTV 650
FLTLLCFPSF LGAAVFLCYA VWQVRPSSTC GPFRTLNTMY EAGTVWVRRL 700
EHAGSGASWL PWLHHFLVEN TFFLFLASAL LLAVIYFNIQ VVKGQRKVIC 750
LLKEQIRNEG EDKIFLINKL HSVYEEEGRS RPGRTQDATE PPAWHEDGGD 800
QKEPCNPRSP 810
Length:810
Mass (Da):90,546
Last modified:December 6, 2005 - v2
Checksum:i6A78987C46CD4FD5
GO
Isoform 2 (identifier: Q7TN60-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-260: Missing.
     781-810: RPGRTQDATEPPAWHEDGGDQKEPCNPRSP → SKLGLVPSGHVCRSPAAAVRAPHIETDVLKLKA

Note: No experimental confirmation available.

Show »
Length:553
Mass (Da):61,806
Checksum:i89EF622E8B22B66F
GO
Isoform 3 (identifier: Q7TN60-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-360: Missing.

Note: No experimental confirmation available.

Show »
Length:450
Mass (Da):51,010
Checksum:iAF19129C11A53BD0
GO
Isoform 4 (identifier: Q7TN60-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     297-328: GRFTHTVMYYGYYSNSTLSPSCDAPREGGQCS → VRPSAPALAKNWCQACPDSPGGLLPVPRYLYG
     329-810: Missing.

Note: No experimental confirmation available.

Show »
Length:328
Mass (Da):35,819
Checksum:iEB148AF6E800968B
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 360360Missing in isoform 3.
VSP_016443Add
BLAST
Alternative sequencei1 – 260260Missing in isoform 2.
VSP_016444Add
BLAST
Alternative sequencei297 – 32832GRFTH…GGQCS → VRPSAPALAKNWCQACPDSP GGLLPVPRYLYG in isoform 4.
VSP_016445Add
BLAST
Alternative sequencei329 – 810482Missing in isoform 4.
VSP_016446Add
BLAST
Alternative sequencei781 – 81030RPGRT…NPRSP → SKLGLVPSGHVCRSPAAAVR APHIETDVLKLKA in isoform 2.
VSP_016447Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti2 – 21A → T in AAP69875. 1 Publication
Sequence conflicti338 – 3381M → T in AAP69875. 1 Publication
Sequence conflicti365 – 3651F → L in BAC36945. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY236497 mRNA. Translation: AAP69875.1.
AY263158 mRNA. Translation: AAP78773.1.
AK052814 mRNA. Translation: BAC35157.1.
AK077671 mRNA. Translation: BAC36945.1.
AL645856 Genomic DNA. Translation: CAM15525.1.
BC004840 mRNA. Translation: AAH04840.2.
BC013502 mRNA. Translation: AAH13502.1.
BC058195 mRNA. Translation: AAH58195.1.
CCDSiCCDS25687.1. [Q7TN60-1]
CCDS25688.1. [Q7TN60-4]
RefSeqiNP_663414.3. NM_145439.2.
NP_851838.1. NM_181321.3. [Q7TN60-4]
UniGeneiMm.286963.

Genome annotation databases

EnsembliENSMUST00000103025; ENSMUSP00000099314; ENSMUSG00000025572. [Q7TN60-4]
GeneIDi217353.
KEGGimmu:217353.
UCSCiuc007mnr.2. mouse. [Q7TN60-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY236497 mRNA. Translation: AAP69875.1 .
AY263158 mRNA. Translation: AAP78773.1 .
AK052814 mRNA. Translation: BAC35157.1 .
AK077671 mRNA. Translation: BAC36945.1 .
AL645856 Genomic DNA. Translation: CAM15525.1 .
BC004840 mRNA. Translation: AAH04840.2 .
BC013502 mRNA. Translation: AAH13502.1 .
BC058195 mRNA. Translation: AAH58195.1 .
CCDSi CCDS25687.1. [Q7TN60-1 ]
CCDS25688.1. [Q7TN60-4 ]
RefSeqi NP_663414.3. NM_145439.2.
NP_851838.1. NM_181321.3. [Q7TN60-4 ]
UniGenei Mm.286963.

3D structure databases

ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei Q7TN60.

Proteomic databases

PRIDEi Q7TN60.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000103025 ; ENSMUSP00000099314 ; ENSMUSG00000025572 . [Q7TN60-4 ]
GeneIDi 217353.
KEGGi mmu:217353.
UCSCi uc007mnr.2. mouse. [Q7TN60-4 ]

Organism-specific databases

CTDi 11322.
MGIi MGI:1098686. Tmc6.

Phylogenomic databases

eggNOGi NOG78295.
GeneTreei ENSGT00670000097681.
HOVERGENi HBG061579.
InParanoidi Q7TN60.
OMAi GHIARTE.
PhylomeDBi Q7TN60.

Miscellaneous databases

NextBioi 375801.
PROi Q7TN60.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q7TN60.
Bgeei Q7TN60.
CleanExi MM_TMC6.
Genevestigatori Q7TN60.

Family and domain databases

InterProi IPR012496. TMC.
[Graphical view ]
Pfami PF07810. TMC. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Characterization of the transmembrane channel-like (TMC) gene family: functional clues from hearing loss and epidermodysplasia verruciformis."
    Kurima K., Yang Y., Sorber K., Griffith A.J.
    Genomics 82:300-308(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
  2. "TMC and EVER genes belong to a larger novel family, the TMC gene family encoding transmembrane proteins."
    Keresztes G., Mutai H., Heller S.
    BMC Genomics 4:24-24(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    Strain: C57BL/6.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4).
    Strain: C57BL/6J.
    Tissue: Mammary gland.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Strain: 129 and FVB/N.
    Tissue: Kidney and Mammary gland.

Entry informationi

Entry nameiTMC6_MOUSE
AccessioniPrimary (citable) accession number: Q7TN60
Secondary accession number(s): B1ATB4
, Q78JR7, Q7TQ68, Q8BP52, Q8C6Z5, Q99J32
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 6, 2005
Last sequence update: December 6, 2005
Last modified: July 9, 2014
This is version 79 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi