Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transmembrane channel-like protein 6

Gene

Tmc6

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Probable ion channel.By similarity

GO - Biological processi

  1. ion transport Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Ion channel

Keywords - Biological processi

Ion transport, Transport

Names & Taxonomyi

Protein namesi
Recommended name:
Transmembrane channel-like protein 6
Gene namesi
Name:Tmc6
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:1098686. Tmc6.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 205205LumenalSequence AnalysisAdd
BLAST
Transmembranei206 – 22621HelicalSequence AnalysisAdd
BLAST
Topological domaini227 – 25327CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei254 – 27421HelicalSequence AnalysisAdd
BLAST
Topological domaini275 – 33864LumenalSequence AnalysisAdd
BLAST
Transmembranei339 – 35921HelicalSequence AnalysisAdd
BLAST
Topological domaini360 – 42970CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei430 – 45021HelicalSequence AnalysisAdd
BLAST
Topological domaini451 – 46818LumenalSequence AnalysisAdd
BLAST
Transmembranei469 – 48921HelicalSequence AnalysisAdd
BLAST
Topological domaini490 – 50415CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei505 – 52521HelicalSequence AnalysisAdd
BLAST
Topological domaini526 – 55227LumenalSequence AnalysisAdd
BLAST
Transmembranei553 – 57321HelicalSequence AnalysisAdd
BLAST
Topological domaini574 – 60330CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei604 – 62421HelicalSequence AnalysisAdd
BLAST
Topological domaini625 – 64925LumenalSequence AnalysisAdd
BLAST
Transmembranei650 – 67021HelicalSequence AnalysisAdd
BLAST
Topological domaini671 – 72151CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei722 – 74221HelicalSequence AnalysisAdd
BLAST
Topological domaini743 – 81068LumenalSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. cytoplasm Source: MGI
  2. endoplasmic reticulum Source: MGI
  3. endoplasmic reticulum membrane Source: UniProtKB-SubCell
  4. extracellular vesicular exosome Source: MGI
  5. Golgi apparatus Source: MGI
  6. integral component of membrane Source: UniProtKB-KW
  7. nuclear membrane Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 810810Transmembrane channel-like protein 6PRO_0000185385Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi102 – 1021N-linked (GlcNAc...)Sequence Analysis
Glycosylationi311 – 3111N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ7TN60.
PRIDEiQ7TN60.

PTM databases

PhosphoSiteiQ7TN60.

Expressioni

Tissue specificityi

Widely expressed.2 Publications

Gene expression databases

BgeeiQ7TN60.
CleanExiMM_TMC6.
ExpressionAtlasiQ7TN60. baseline and differential.
GenevestigatoriQ7TN60.

Family & Domainsi

Sequence similaritiesi

Belongs to the TMC family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG78295.
GeneTreeiENSGT00760000119171.
HOVERGENiHBG061579.
InParanoidiQ7TN60.
PhylomeDBiQ7TN60.

Family and domain databases

InterProiIPR012496. TMC.
[Graphical view]
PfamiPF07810. TMC. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7TN60-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAQSLALALD VPETTGDEGL EPSPYEESEV HDSFHQLIQE QSLRVAEEGL
60 70 80 90 100
ELLPLGLGRG DQTLPGLEGA PALSSATLRI LASMPSRTIG RSRGAIISQY
110 120 130 140 150
YNRTVRLRRR SSRPLLGNVV PSARPSLRLY DLELDSTILE EDEKRSLLVK
160 170 180 190 200
ELQGLSAAQR DHMVRNMPLS LGEKRCLREK SWSPKGKRRH LQGRSGAFSC
210 220 230 240 250
CSRLRYTCML ALHSLGLALL SGLYAARPWR YALKQIGGQF GSSVLSYFLF
260 270 280 290 300
LKTLLAFNAL MLLPLLAFLV GVQAAFPPDP AGPVPTFSGL ELLTGGGRFT
310 320 330 340 350
HTVMYYGYYS NSTLSPSCDA PREGGQCSPR LGSLPYNMPL AYLFTMGATF
360 370 380 390 400
FLTCIILVYS MSHSFGESYR VGSTKGIHAL TVFCSWDYKV TQKRASRVQQ
410 420 430 440 450
DSICTQLKEL LAEWHLRKRP RSVCGQLRQV VVLGLGWLLC LGSTMGCTVA
460 470 480 490 500
VLTFSEVMIQ RPASGGQGVE ALALPLVVSV LNLGASYLFR GLATLERHDS
510 520 530 540 550
PVLEVYMAIC RNLILKMAVL GVLCYHWLGR RVATLQGQCW EDFVGQELYR
560 570 580 590 600
FMVVDFIFML LDSLFGELVW RLISEKKLKR GQKPEFDIAR NVLDLIYGQT
610 620 630 640 650
LTWLGVLFSP LLPAVQILRL LFLFHIKKAS LMANCQAPRR PWLASHMSTV
660 670 680 690 700
FLTLLCFPSF LGAAVFLCYA VWQVRPSSTC GPFRTLNTMY EAGTVWVRRL
710 720 730 740 750
EHAGSGASWL PWLHHFLVEN TFFLFLASAL LLAVIYFNIQ VVKGQRKVIC
760 770 780 790 800
LLKEQIRNEG EDKIFLINKL HSVYEEEGRS RPGRTQDATE PPAWHEDGGD
810
QKEPCNPRSP
Length:810
Mass (Da):90,546
Last modified:December 6, 2005 - v2
Checksum:i6A78987C46CD4FD5
GO
Isoform 2 (identifier: Q7TN60-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-260: Missing.
     781-810: RPGRTQDATEPPAWHEDGGDQKEPCNPRSP → SKLGLVPSGHVCRSPAAAVRAPHIETDVLKLKA

Note: No experimental confirmation available.

Show »
Length:553
Mass (Da):61,806
Checksum:i89EF622E8B22B66F
GO
Isoform 3 (identifier: Q7TN60-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-360: Missing.

Note: No experimental confirmation available.

Show »
Length:450
Mass (Da):51,010
Checksum:iAF19129C11A53BD0
GO
Isoform 4 (identifier: Q7TN60-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     297-328: GRFTHTVMYYGYYSNSTLSPSCDAPREGGQCS → VRPSAPALAKNWCQACPDSPGGLLPVPRYLYG
     329-810: Missing.

Note: No experimental confirmation available.

Show »
Length:328
Mass (Da):35,819
Checksum:iEB148AF6E800968B
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti2 – 21A → T in AAP69875 (PubMed:12906855).Curated
Sequence conflicti338 – 3381M → T in AAP69875 (PubMed:12906855).Curated
Sequence conflicti365 – 3651F → L in BAC36945 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 360360Missing in isoform 3. 1 PublicationVSP_016443Add
BLAST
Alternative sequencei1 – 260260Missing in isoform 2. 1 PublicationVSP_016444Add
BLAST
Alternative sequencei297 – 32832GRFTH…GGQCS → VRPSAPALAKNWCQACPDSP GGLLPVPRYLYG in isoform 4. 1 PublicationVSP_016445Add
BLAST
Alternative sequencei329 – 810482Missing in isoform 4. 1 PublicationVSP_016446Add
BLAST
Alternative sequencei781 – 81030RPGRT…NPRSP → SKLGLVPSGHVCRSPAAAVR APHIETDVLKLKA in isoform 2. 1 PublicationVSP_016447Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY236497 mRNA. Translation: AAP69875.1.
AY263158 mRNA. Translation: AAP78773.1.
AK052814 mRNA. Translation: BAC35157.1.
AK077671 mRNA. Translation: BAC36945.1.
AL645856 Genomic DNA. Translation: CAM15525.1.
BC004840 mRNA. Translation: AAH04840.2.
BC013502 mRNA. Translation: AAH13502.1.
BC058195 mRNA. Translation: AAH58195.1.
CCDSiCCDS25687.1. [Q7TN60-1]
CCDS25688.1. [Q7TN60-4]
RefSeqiNP_663414.3. NM_145439.2.
NP_851838.1. NM_181321.3. [Q7TN60-4]
UniGeneiMm.286963.

Genome annotation databases

EnsembliENSMUST00000103025; ENSMUSP00000099314; ENSMUSG00000025572. [Q7TN60-4]
GeneIDi217353.
KEGGimmu:217353.
UCSCiuc007mnr.2. mouse. [Q7TN60-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY236497 mRNA. Translation: AAP69875.1.
AY263158 mRNA. Translation: AAP78773.1.
AK052814 mRNA. Translation: BAC35157.1.
AK077671 mRNA. Translation: BAC36945.1.
AL645856 Genomic DNA. Translation: CAM15525.1.
BC004840 mRNA. Translation: AAH04840.2.
BC013502 mRNA. Translation: AAH13502.1.
BC058195 mRNA. Translation: AAH58195.1.
CCDSiCCDS25687.1. [Q7TN60-1]
CCDS25688.1. [Q7TN60-4]
RefSeqiNP_663414.3. NM_145439.2.
NP_851838.1. NM_181321.3. [Q7TN60-4]
UniGeneiMm.286963.

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

PTM databases

PhosphoSiteiQ7TN60.

Proteomic databases

MaxQBiQ7TN60.
PRIDEiQ7TN60.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000103025; ENSMUSP00000099314; ENSMUSG00000025572. [Q7TN60-4]
GeneIDi217353.
KEGGimmu:217353.
UCSCiuc007mnr.2. mouse. [Q7TN60-4]

Organism-specific databases

CTDi11322.
MGIiMGI:1098686. Tmc6.

Phylogenomic databases

eggNOGiNOG78295.
GeneTreeiENSGT00760000119171.
HOVERGENiHBG061579.
InParanoidiQ7TN60.
PhylomeDBiQ7TN60.

Miscellaneous databases

NextBioi375801.
PROiQ7TN60.
SOURCEiSearch...

Gene expression databases

BgeeiQ7TN60.
CleanExiMM_TMC6.
ExpressionAtlasiQ7TN60. baseline and differential.
GenevestigatoriQ7TN60.

Family and domain databases

InterProiIPR012496. TMC.
[Graphical view]
PfamiPF07810. TMC. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Characterization of the transmembrane channel-like (TMC) gene family: functional clues from hearing loss and epidermodysplasia verruciformis."
    Kurima K., Yang Y., Sorber K., Griffith A.J.
    Genomics 82:300-308(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
  2. "TMC and EVER genes belong to a larger novel family, the TMC gene family encoding transmembrane proteins."
    Keresztes G., Mutai H., Heller S.
    BMC Genomics 4:24-24(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    Strain: C57BL/6.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4).
    Strain: C57BL/6J.
    Tissue: Mammary gland.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Strain: 129 and FVB/N.
    Tissue: Kidney and Mammary gland.

Entry informationi

Entry nameiTMC6_MOUSE
AccessioniPrimary (citable) accession number: Q7TN60
Secondary accession number(s): B1ATB4
, Q78JR7, Q7TQ68, Q8BP52, Q8C6Z5, Q99J32
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 6, 2005
Last sequence update: December 6, 2005
Last modified: February 4, 2015
This is version 83 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.