Q7RTT9 (S29A4_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
December 14, 2011.
Version 69.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Equilibrative nucleoside transporter 4 Short name=hENT4 Alternative name(s): Plasma membrane monoamine transporter Solute carrier family 29 member 4 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 530 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Functions as a polyspecific organic cation transporter, efficiently transporting many organic cations such as monoamine neurotransmitters 1-methyl-4-phenylpyridinium and biogenic amines including serotonin, dopamine, norepinephrine and epinephrine. May play a role in regulating central nervous system homeostasis of monoamine neurotransmitters. May be involved in luminal transport of organic cations in the kidney and seems to use luminal proton gradient to drive organic cation reabsorption. Does not seem to transport nucleoside and nucleoside analogs such as uridine, cytidine, thymidine, adenosine, inosine, guanosine, and azidothymidine. In (Ref.6) adenosine is efficiently transported but in a fashion highly sensitive to extracellular pH, with maximal activity in the pH range 5.5 to 6.5. Glu-206 is essential for the cation selectivity and may function as the charge sensor for cationic substrates. Transport is chloride and sodium-independent but appears to be sensitive to changes in membrane potential. Weakly inhibited by the classical inhibitors of equilibrative nucleoside transport, dipyridamole, dilazep, and nitrobenzylthioinosine. May play a role in the regulation of extracellular adenosine concentrations in cardiac tissues, in particular during ischemia. Ref.1 Ref.6 Ref.7 Ref.8 |
| Subcellular location | Cell membrane; Multi-pass membrane protein Potential. Apical cell membrane; Multi-pass membrane protein Potential. Note: Located to the plasma membranes of ventricular myocytes and vascular endothelial cells. Targeted to the apical membranes of differentiated kidney epithelial cells. Ref.1 Ref.6 |
| Tissue specificity | Expressed abundantly in the heart, in both cardiomyocytes and vascular endothelial cells (at protein level). Highly expressed in brain, kidney and skeletal muscle. In the brain expressed in cerebellum, cerebral cortex, medulla, occipital pole, frontal and temporal lobes putamen and in the spinal cord. Lower expression in liver, pancreas, and liver. Expressed in endometrial tissue, exclusively in the stroma. Expression is high in the proliferative phase, decreases during the secretory phase, and is no longer detectable in the menstrual phase. Ref.1 Ref.6 Ref.7 Ref.9 |
| Post-translational modification | N-glycosylated. Ref.6 |
| Sequence similarities | Belongs to the SLC29A transporter family. |
| Sequence caution | The sequence BAC11612.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transport |
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| PTM | Glycoprotein Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | nucleobase-containing small molecule metabolic process Traceable author statement. Source: Reactome |
| Cellular component | apical plasma membrane Inferred from electronic annotation. Source: UniProtKB-SubCell integral to membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | nucleoside transmembrane transporter activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q7RTT9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q7RTT9-2) The sequence of this isoform differs from the canonical sequence as follows: 139-182: GYLLALGPLLFISICDVWLQLFSRDQAYAINLAAVGTVAFGCTV → ASATCGCSSSLGTRPTPSTWPLWAPWPSAA | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 530 | 530 | Equilibrative nucleoside transporter 4 | PRO_0000326251 | |||||
Regions | |||||||||
| Topological domain | 1 – 68 | 68 | Extracellular Potential | ||||||
| Transmembrane | 69 – 89 | 21 | Helical; Potential | ||||||
| Topological domain | 90 – 101 | 12 | Cytoplasmic Potential | ||||||
| Transmembrane | 102 – 122 | 21 | Helical; Potential | ||||||
| Topological domain | 123 – 139 | 17 | Extracellular Potential | ||||||
| Transmembrane | 140 – 160 | 21 | Helical; Potential | ||||||
| Topological domain | 161 – 166 | 6 | Cytoplasmic Potential | ||||||
| Transmembrane | 167 – 187 | 21 | Helical; Potential | ||||||
| Topological domain | 188 – 231 | 44 | Extracellular Potential | ||||||
| Transmembrane | 232 – 252 | 21 | Helical; Potential | ||||||
| Topological domain | 253 – 351 | 99 | Cytoplasmic Potential | ||||||
| Transmembrane | 352 – 372 | 21 | Helical; Potential | ||||||
| Topological domain | 373 – 381 | 9 | Extracellular Potential | ||||||
| Transmembrane | 382 – 402 | 21 | Helical; Potential | ||||||
| Topological domain | 403 – 416 | 14 | Cytoplasmic Potential | ||||||
| Transmembrane | 417 – 437 | 21 | Helical; Potential | ||||||
| Topological domain | 438 – 450 | 13 | Extracellular Potential | ||||||
| Transmembrane | 451 – 471 | 21 | Helical; Potential | ||||||
| Topological domain | 472 – 486 | 15 | Cytoplasmic Potential | ||||||
| Transmembrane | 487 – 509 | 23 | Helical; Potential | ||||||
| Topological domain | 510 – 530 | 21 | Extracellular Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 220 | 1 | Phosphothreonine By similarity | ||||||
| Glycosylation | 523 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 139 – 182 | 44 | GYLLA…FGCTV → ASATCGCSSSLGTRPTPSTW PLWAPWPSAA in isoform 2. | VSP_032647 | |||||
| Natural variant | 79 | 1 | V → E. Ref.4 Corresponds to variant rs17854505 [ dbSNP | Ensembl ]. | VAR_040044 | |||||
| Natural variant | 124 | 1 | N → K. Ref.4 Corresponds to variant rs17855675 [ dbSNP | Ensembl ]. | VAR_040045 | |||||
| Natural variant | 429 | 1 | P → T. Ref.4 Corresponds to variant rs17857336 [ dbSNP | Ensembl ]. | VAR_040046 | |||||
Experimental info | |||||||||
| Mutagenesis | 91 | 1 | D → A: No significant change in cationic transport activity. Ref.8 | ||||||
| Mutagenesis | 107 | 1 | D → A: Loss of cationic transport activity. Ref.8 | ||||||
| Mutagenesis | 128 | 1 | E → A: No significant change in cationic transport activity. Ref.8 | ||||||
| Mutagenesis | 154 | 1 | D → A: Loss of cationic transport activity; increase in uridine uptake. Ref.8 | ||||||
| Mutagenesis | 163 | 1 | D → A: Loss of cationic transport activity. Ref.8 | ||||||
| Mutagenesis | 206 | 1 | E → A: Loss of cationic transport activity. Ref.6 Ref.8 | ||||||
| Mutagenesis | 206 | 1 | E → D: No loss of cationic transporter activity; no activity towards uridine. Ref.6 Ref.8 | ||||||
| Mutagenesis | 206 | 1 | E → Q: Loss of cationic transporter activity; increase in uridine uptake. Ref.6 Ref.8 | ||||||
| Mutagenesis | 206 | 1 | E → R: Loss of cationic transporter activity. Ref.6 Ref.8 | ||||||
| Mutagenesis | 220 | 1 | T → A: Reduced cationic transport activity. Ref.8 | ||||||
| Mutagenesis | 220 | 1 | T → I: Loss of cationic transporter activity. Ref.8 | ||||||
| Mutagenesis | 220 | 1 | T → S: Reduced cationic transport activity. Ref.8 | ||||||
| Mutagenesis | 227 | 1 | E → A: Functional with slight increased cationic transport activity. Ref.8 | ||||||
| Mutagenesis | 242 | 1 | E → A: Reduced cationic transport activity. Ref.8 | ||||||
| Mutagenesis | 336 | 1 | W → A: Loss of cationic transport activity. Ref.8 | ||||||
| Mutagenesis | 375 | 1 | E → A: Functional with slight increased cationic transport activity. Ref.6 Ref.8 | ||||||
| Mutagenesis | 375 | 1 | E → Q: No change in cationic activity and pH sensitivity. Ref.6 Ref.8 | ||||||
| Sequence conflict | 25 | 1 | S → C in BAC03836. Ref.2 | ||||||
| Sequence conflict | 41 | 1 | Q → R in BAC03836. Ref.2 | ||||||
| Sequence conflict | 196 | 1 | K → R in BAC03836. Ref.2 | ||||||
| Sequence conflict | 261 | 1 | Y → H in BAC11612. Ref.2 | ||||||
| Sequence conflict | 301 | 1 | L → P in BAC03836. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification and characterization of a novel monoamine transporter in the human brain." Engel K., Zhou M., Wang J. J. Biol. Chem. 279:50042-50049(2004) [PubMed: 15448143] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, TOPOLOGY, TISSUE SPECIFICITY. Tissue: Kidney. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Teratocarcinoma. |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANTS GLU-79; LYS-124 AND THR-429. Tissue: Brain and Eye. |
| [5] | "Molecular evolution of the equilibrative nucleoside transporter family: identification of novel family members in prokaryotes and eukaryotes." Acimovic Y., Coe I.R. Mol. Biol. Evol. 19:2199-2210(2002) [PubMed: 12446811] [Abstract] Cited for: IDENTIFICATION. |
| [6] | "Distribution and functional characterization of equilibrative nucleoside transporter-4, a novel cardiac adenosine transporter activated at acidic pH." Barnes K., Dobrzynski H., Foppolo S., Beal P.R., Ismat F., Scullion E.R., Sun L., Tellez J., Ritzel M.W., Claycomb W.C., Cass C.E., Young J.D., Billeter-Clark R., Boyett M.R., Baldwin S.A. Circ. Res. 99:510-519(2006) [PubMed: 16873718] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, GLYCOSYLATION AT ASN-523, MUTAGENESIS OF GLU-206 AND GLU-375. |
| [7] | "Membrane localization and pH-dependent transport of a newly cloned organic cation transporter (PMAT) in kidney cells." Xia L., Engel K., Zhou M., Wang J. Am. J. Physiol. 292:F682-F690(2007) [PubMed: 17018840] [Abstract] Cited for: FUNCTION, TOPOLOGY, TISSUE SPECIFICITY. |
| [8] | "Molecular determinants of substrate selectivity of a novel organic cation transporter (PMAT) in the SLC29 family." Zhou M., Xia L., Engel K., Wang J. J. Biol. Chem. 282:3188-3195(2007) [PubMed: 17121826] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF ASP-91; ASP-107; GLU-128; ASP-154; ASP-163; GLU-206; THR-220; GLU-227; GLU-242; TRP-336 AND GLU-375. |
| [9] | "The organic cation transporters (OCT1, OCT2, EMT) and the plasma membrane monoamine transporter (PMAT) show differential distribution and cyclic expression pattern in human endometrium and early pregnancy decidua." Bottalico B., Noskova V., Pilka R., Larsson I., Domanski H., Casslen B., Hansson S.R. Mol. Reprod. Dev. 74:1303-1311(2007) [PubMed: 17393420] [Abstract] Cited for: TISSUE SPECIFICITY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY485959 mRNA. Translation: AAS65965.1. AK075422 mRNA. Translation: BAC11612.1. Different initiation. AK092242 mRNA. Translation: BAC03836.1. CH471144 Genomic DNA. Translation: EAW87329.1. CH471144 Genomic DNA. Translation: EAW87330.1. BC025325 mRNA. Translation: AAH25325.1. BC047592 mRNA. Translation: AAH47592.1. BK000627 Genomic DNA. Translation: DAA00308.1. |
| IPI | IPI00641511. IPI00888339. |
| RefSeq | NP_001035751.1. NM_001040661.1. NP_694979.2. NM_153247.2. |
| UniGene | Hs.4302. |
3D structure databases | |
| ProteinModelPortal | Q7RTT9. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q7RTT9. |
Protein family/group databases | |
| TCDB | 2.A.57.1.5. equilibrative nucleoside transporter (ENT) family. |
PTM databases | |
| PhosphoSite | Q7RTT9. |
Polymorphism databases | |
| DMDM | 74713147. |
Proteomic databases | |
| PRIDE | Q7RTT9. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000297195; ENSP00000297195; ENSG00000164638. ENST00000396872; ENSP00000380081; ENSG00000164638. |
| GeneID | 222962. |
| KEGG | hsa:222962. |
| UCSC | uc003soc.1. human. uc003soe.1. human. |
Organism-specific databases | |
| CTD | 222962. |
| GeneCards | GC07P005289. |
| H-InvDB | HIX0006450. |
| HGNC | HGNC:23097. SLC29A4. |
| MIM | 609149. gene. |
| neXtProt | NX_Q7RTT9. |
| PharmGKB | PA134976472. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG14491. |
| GeneTree | ENSGT00390000002232. |
| HOGENOM | HBG445133. |
| HOVERGEN | HBG095787. |
| InParanoid | Q7RTT9. |
| OMA | HHDVAAG. |
| PhylomeDB | Q7RTT9. |
Enzyme and pathway databases | |
| Reactome | REACT_15518. Transmembrane transport of small molecules. |
Gene expression databases | |
| ArrayExpress | Q7RTT9. |
| Bgee | Q7RTT9. |
| CleanEx | HS_SLC29A4. |
| Genevestigator | Q7RTT9. |
Family and domain databases | |
| InterPro | IPR002259. DER/eqnu_transpt. IPR016196. MFS_dom_general_subst_transpt. [Graphical view] |
| KO | K03323. |
| PANTHER | PTHR10332. DER/eqnu_transpt. 1 hit. |
| Pfam | PF01733. Nucleoside_tran. 1 hit. [Graphical view] |
| PRINTS | PR01130. DERENTRNSPRT. |
| SUPFAM | SSF103473. MFS_gen_substrate_transporter. 1 hit. |
| ProtoNet | Search... |
Other | |
| NextBio | 91692. |
| SOURCE | Search... |
Entry information
| Entry name | S29A4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q7RTT9 Secondary accession number(s): Q6PJ08 Q8NBM2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with