Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q7RTT9

- S29A4_HUMAN

UniProt

Q7RTT9 - S29A4_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Equilibrative nucleoside transporter 4

Gene

SLC29A4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Functions as a polyspecific organic cation transporter, efficiently transporting many organic cations such as monoamine neurotransmitters 1-methyl-4-phenylpyridinium and biogenic amines including serotonin, dopamine, norepinephrine and epinephrine. May play a role in regulating central nervous system homeostasis of monoamine neurotransmitters. May be involved in luminal transport of organic cations in the kidney and seems to use luminal proton gradient to drive organic cation reabsorption. Does not seem to transport nucleoside and nucleoside analogs such as uridine, cytidine, thymidine, adenosine, inosine, guanosine, and azidothymidine. In (PubMed:16873718) adenosine is efficiently transported but in a fashion highly sensitive to extracellular pH, with maximal activity in the pH range 5.5 to 6.5. Glu-206 is essential for the cation selectivity and may function as the charge sensor for cationic substrates. Transport is chloride and sodium-independent but appears to be sensitive to changes in membrane potential. Weakly inhibited by the classical inhibitors of equilibrative nucleoside transport, dipyridamole, dilazep, and nitrobenzylthioinosine. May play a role in the regulation of extracellular adenosine concentrations in cardiac tissues, in particular during ischemia.4 Publications

GO - Molecular functioni

  1. nucleoside transmembrane transporter activity Source: InterPro

GO - Biological processi

  1. transmembrane transport Source: Reactome
Complete GO annotation...

Keywords - Biological processi

Transport

Enzyme and pathway databases

ReactomeiREACT_1206. Transport of nucleosides and free purine and pyrimidine bases across the plasma membrane.

Protein family/group databases

TCDBi2.A.57.1.5. the equilibrative nucleoside transporter (ent) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Equilibrative nucleoside transporter 4
Short name:
hENT4
Alternative name(s):
Plasma membrane monoamine transporter
Solute carrier family 29 member 4
Gene namesi
Name:SLC29A4
Synonyms:ENT4, PMAT
ORF Names:PSEC0113
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 7

Organism-specific databases

HGNCiHGNC:23097. SLC29A4.

Subcellular locationi

Cell membrane Curated; Multi-pass membrane protein Curated. Apical cell membrane Curated; Multi-pass membrane protein Curated
Note: Located to the plasma membranes of ventricular myocytes and vascular endothelial cells. Targeted to the apical membranes of differentiated kidney epithelial cells.2 Publications

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi91 – 911D → A: No significant change in cationic transport activity. 1 Publication
Mutagenesisi107 – 1071D → A: Loss of cationic transport activity. 1 Publication
Mutagenesisi128 – 1281E → A: No significant change in cationic transport activity. 1 Publication
Mutagenesisi154 – 1541D → A: Loss of cationic transport activity; increase in uridine uptake. 1 Publication
Mutagenesisi163 – 1631D → A: Loss of cationic transport activity. 1 Publication
Mutagenesisi206 – 2061E → A: Loss of cationic transport activity. 2 Publications
Mutagenesisi206 – 2061E → D: No loss of cationic transporter activity; no activity towards uridine. 2 Publications
Mutagenesisi206 – 2061E → Q: Loss of cationic transporter activity; increase in uridine uptake. 2 Publications
Mutagenesisi206 – 2061E → R: Loss of cationic transporter activity. 2 Publications
Mutagenesisi220 – 2201T → A: Reduced cationic transport activity. 1 Publication
Mutagenesisi220 – 2201T → I: Loss of cationic transporter activity. 1 Publication
Mutagenesisi220 – 2201T → S: Reduced cationic transport activity. 1 Publication
Mutagenesisi227 – 2271E → A: Functional with slight increased cationic transport activity. 1 Publication
Mutagenesisi242 – 2421E → A: Reduced cationic transport activity. 1 Publication
Mutagenesisi336 – 3361W → A: Loss of cationic transport activity. 1 Publication
Mutagenesisi375 – 3751E → A: Functional with slight increased cationic transport activity. 2 Publications
Mutagenesisi375 – 3751E → Q: No change in cationic activity and pH sensitivity. 2 Publications

Organism-specific databases

PharmGKBiPA134976472.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 530530Equilibrative nucleoside transporter 4PRO_0000326251Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi523 – 5231N-linked (GlcNAc...)Sequence Analysis

Post-translational modificationi

N-glycosylated.1 Publication

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ7RTT9.
PRIDEiQ7RTT9.

PTM databases

PhosphoSiteiQ7RTT9.

Expressioni

Tissue specificityi

Expressed abundantly in the heart, in both cardiomyocytes and vascular endothelial cells (at protein level). Highly expressed in brain, kidney and skeletal muscle. In the brain expressed in cerebellum, cerebral cortex, medulla, occipital pole, frontal and temporal lobes putamen and in the spinal cord. Lower expression in liver, pancreas, and liver. Expressed in endometrial tissue, exclusively in the stroma. Expression is high in the proliferative phase, decreases during the secretory phase, and is no longer detectable in the menstrual phase.4 Publications

Gene expression databases

BgeeiQ7RTT9.
CleanExiHS_SLC29A4.
ExpressionAtlasiQ7RTT9. baseline and differential.
GenevestigatoriQ7RTT9.

Organism-specific databases

HPAiHPA052829.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000297195.

Structurei

3D structure databases

ProteinModelPortaliQ7RTT9.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 6868ExtracellularSequence AnalysisAdd
BLAST
Topological domaini90 – 10112CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini123 – 13917ExtracellularSequence AnalysisAdd
BLAST
Topological domaini161 – 1666CytoplasmicSequence Analysis
Topological domaini188 – 23144ExtracellularSequence AnalysisAdd
BLAST
Topological domaini253 – 35199CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini373 – 3819ExtracellularSequence Analysis
Topological domaini403 – 41614CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini438 – 45013ExtracellularSequence AnalysisAdd
BLAST
Topological domaini472 – 48615CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini510 – 53021ExtracellularSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei69 – 8921HelicalSequence AnalysisAdd
BLAST
Transmembranei102 – 12221HelicalSequence AnalysisAdd
BLAST
Transmembranei140 – 16021HelicalSequence AnalysisAdd
BLAST
Transmembranei167 – 18721HelicalSequence AnalysisAdd
BLAST
Transmembranei232 – 25221HelicalSequence AnalysisAdd
BLAST
Transmembranei352 – 37221HelicalSequence AnalysisAdd
BLAST
Transmembranei382 – 40221HelicalSequence AnalysisAdd
BLAST
Transmembranei417 – 43721HelicalSequence AnalysisAdd
BLAST
Transmembranei451 – 47121HelicalSequence AnalysisAdd
BLAST
Transmembranei487 – 50923HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG249415.
GeneTreeiENSGT00390000002232.
HOGENOMiHOG000048076.
HOVERGENiHBG095787.
InParanoidiQ7RTT9.
KOiK03323.
OMAiWPSFRAL.
PhylomeDBiQ7RTT9.
TreeFamiTF313950.

Family and domain databases

InterProiIPR002259. Eqnu_transpt.
IPR016196. MFS_dom_general_subst_transpt.
[Graphical view]
PANTHERiPTHR10332. PTHR10332. 1 hit.
PfamiPF01733. Nucleoside_tran. 1 hit.
[Graphical view]
PRINTSiPR01130. DERENTRNSPRT.
SUPFAMiSSF103473. SSF103473. 2 hits.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q7RTT9) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGSVGSQRLE EPSVAGTPDP GVVMSFTFDS HQLEEAAEAA QGQGLRARGV
60 70 80 90 100
PAFTDTTLDE PVPDDRYHAI YFAMLLAGVG FLLPYNSFIT DVDYLHHKYP
110 120 130 140 150
GTSIVFDMSL TYILVALAAV LLNNVLVERL TLHTRITAGY LLALGPLLFI
160 170 180 190 200
SICDVWLQLF SRDQAYAINL AAVGTVAFGC TVQQSSFYGY TGMLPKRYTQ
210 220 230 240 250
GVMTGESTAG VMISLSRILT KLLLPDERAS TLIFFLVSVA LELLCFLLHL
260 270 280 290 300
LVRRSRFVLF YTTRPRDSHR GRPGLGRGYG YRVHHDVVAG DVHFEHPAPA
310 320 330 340 350
LAPNESPKDS PAHEVTGSGG AYMRFDVPRP RVQRSWPTFR ALLLHRYVVA
360 370 380 390 400
RVIWADMLSI AVTYFITLCL FPGLESEIRH CILGEWLPIL IMAVFNLSDF
410 420 430 440 450
VGKILAALPV DWRGTHLLAC SCLRVVFIPL FILCVYPSGM PALRHPAWPC
460 470 480 490 500
IFSLLMGISN GYFGSVPMIL AAGKVSPKQR ELAGNTMTVS YMSGLTLGSA
510 520 530
VAYCTYSLTR DAHGSCLHAS TANGSILAGL
Length:530
Mass (Da):58,059
Last modified:December 15, 2003 - v1
Checksum:i3FE5D5ED1D248A13
GO
Isoform 2 (identifier: Q7RTT9-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     139-182: GYLLALGPLLFISICDVWLQLFSRDQAYAINLAAVGTVAFGCTV → ASATCGCSSSLGTRPTPSTWPLWAPWPSAA

Note: No experimental confirmation available.

Show »
Length:516
Mass (Da):56,401
Checksum:i601976FF77817BFD
GO

Sequence cautioni

The sequence BAC11612.1 differs from that shown. Reason: Erroneous initiation.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti25 – 251S → C in BAC03836. (PubMed:14702039)Curated
Sequence conflicti41 – 411Q → R in BAC03836. (PubMed:14702039)Curated
Sequence conflicti196 – 1961K → R in BAC03836. (PubMed:14702039)Curated
Sequence conflicti261 – 2611Y → H in BAC11612. (PubMed:14702039)Curated
Sequence conflicti301 – 3011L → P in BAC03836. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti79 – 791V → E.1 Publication
Corresponds to variant rs17854505 [ dbSNP | Ensembl ].
VAR_040044
Natural varianti124 – 1241N → K.1 Publication
Corresponds to variant rs17855675 [ dbSNP | Ensembl ].
VAR_040045
Natural varianti429 – 4291P → T.1 Publication
Corresponds to variant rs17857336 [ dbSNP | Ensembl ].
VAR_040046

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei139 – 18244GYLLA…FGCTV → ASATCGCSSSLGTRPTPSTW PLWAPWPSAA in isoform 2. 1 PublicationVSP_032647Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY485959 mRNA. Translation: AAS65965.1.
AK075422 mRNA. Translation: BAC11612.1. Different initiation.
AK092242 mRNA. Translation: BAC03836.1.
CH471144 Genomic DNA. Translation: EAW87329.1.
CH471144 Genomic DNA. Translation: EAW87330.1.
BC025325 mRNA. Translation: AAH25325.1.
BC047592 mRNA. Translation: AAH47592.1.
BK000627 Genomic DNA. Translation: DAA00308.1.
CCDSiCCDS5340.1. [Q7RTT9-1]
CCDS75561.1. [Q7RTT9-2]
RefSeqiNP_001035751.1. NM_001040661.1. [Q7RTT9-1]
NP_694979.2. NM_153247.2. [Q7RTT9-1]
XP_005249715.1. XM_005249658.2. [Q7RTT9-2]
XP_006715730.1. XM_006715667.1. [Q7RTT9-1]
UniGeneiHs.4302.

Genome annotation databases

EnsembliENST00000297195; ENSP00000297195; ENSG00000164638. [Q7RTT9-1]
ENST00000396872; ENSP00000380081; ENSG00000164638. [Q7RTT9-1]
ENST00000406453; ENSP00000385845; ENSG00000164638. [Q7RTT9-2]
GeneIDi222962.
KEGGihsa:222962.
UCSCiuc003soc.3. human. [Q7RTT9-1]
uc003soe.3. human. [Q7RTT9-2]

Polymorphism databases

DMDMi74713147.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY485959 mRNA. Translation: AAS65965.1 .
AK075422 mRNA. Translation: BAC11612.1 . Different initiation.
AK092242 mRNA. Translation: BAC03836.1 .
CH471144 Genomic DNA. Translation: EAW87329.1 .
CH471144 Genomic DNA. Translation: EAW87330.1 .
BC025325 mRNA. Translation: AAH25325.1 .
BC047592 mRNA. Translation: AAH47592.1 .
BK000627 Genomic DNA. Translation: DAA00308.1 .
CCDSi CCDS5340.1. [Q7RTT9-1 ]
CCDS75561.1. [Q7RTT9-2 ]
RefSeqi NP_001035751.1. NM_001040661.1. [Q7RTT9-1 ]
NP_694979.2. NM_153247.2. [Q7RTT9-1 ]
XP_005249715.1. XM_005249658.2. [Q7RTT9-2 ]
XP_006715730.1. XM_006715667.1. [Q7RTT9-1 ]
UniGenei Hs.4302.

3D structure databases

ProteinModelPortali Q7RTT9.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000297195.

Chemistry

DrugBanki DB00331. Metformin.
GuidetoPHARMACOLOGYi 1120.

Protein family/group databases

TCDBi 2.A.57.1.5. the equilibrative nucleoside transporter (ent) family.

PTM databases

PhosphoSitei Q7RTT9.

Polymorphism databases

DMDMi 74713147.

Proteomic databases

PaxDbi Q7RTT9.
PRIDEi Q7RTT9.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000297195 ; ENSP00000297195 ; ENSG00000164638 . [Q7RTT9-1 ]
ENST00000396872 ; ENSP00000380081 ; ENSG00000164638 . [Q7RTT9-1 ]
ENST00000406453 ; ENSP00000385845 ; ENSG00000164638 . [Q7RTT9-2 ]
GeneIDi 222962.
KEGGi hsa:222962.
UCSCi uc003soc.3. human. [Q7RTT9-1 ]
uc003soe.3. human. [Q7RTT9-2 ]

Organism-specific databases

CTDi 222962.
GeneCardsi GC07P005289.
HGNCi HGNC:23097. SLC29A4.
HPAi HPA052829.
MIMi 609149. gene.
neXtProti NX_Q7RTT9.
PharmGKBi PA134976472.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG249415.
GeneTreei ENSGT00390000002232.
HOGENOMi HOG000048076.
HOVERGENi HBG095787.
InParanoidi Q7RTT9.
KOi K03323.
OMAi WPSFRAL.
PhylomeDBi Q7RTT9.
TreeFami TF313950.

Enzyme and pathway databases

Reactomei REACT_1206. Transport of nucleosides and free purine and pyrimidine bases across the plasma membrane.

Miscellaneous databases

ChiTaRSi SLC29A4. human.
GeneWikii SLC29A4.
GenomeRNAii 222962.
NextBioi 91692.
PROi Q7RTT9.
SOURCEi Search...

Gene expression databases

Bgeei Q7RTT9.
CleanExi HS_SLC29A4.
ExpressionAtlasi Q7RTT9. baseline and differential.
Genevestigatori Q7RTT9.

Family and domain databases

InterProi IPR002259. Eqnu_transpt.
IPR016196. MFS_dom_general_subst_transpt.
[Graphical view ]
PANTHERi PTHR10332. PTHR10332. 1 hit.
Pfami PF01733. Nucleoside_tran. 1 hit.
[Graphical view ]
PRINTSi PR01130. DERENTRNSPRT.
SUPFAMi SSF103473. SSF103473. 2 hits.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification and characterization of a novel monoamine transporter in the human brain."
    Engel K., Zhou M., Wang J.
    J. Biol. Chem. 279:50042-50049(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, TOPOLOGY, TISSUE SPECIFICITY.
    Tissue: Kidney.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Teratocarcinoma.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANTS GLU-79; LYS-124 AND THR-429.
    Tissue: Brain and Eye.
  5. "Molecular evolution of the equilibrative nucleoside transporter family: identification of novel family members in prokaryotes and eukaryotes."
    Acimovic Y., Coe I.R.
    Mol. Biol. Evol. 19:2199-2210(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION.
  6. "Distribution and functional characterization of equilibrative nucleoside transporter-4, a novel cardiac adenosine transporter activated at acidic pH."
    Barnes K., Dobrzynski H., Foppolo S., Beal P.R., Ismat F., Scullion E.R., Sun L., Tellez J., Ritzel M.W., Claycomb W.C., Cass C.E., Young J.D., Billeter-Clark R., Boyett M.R., Baldwin S.A.
    Circ. Res. 99:510-519(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, GLYCOSYLATION AT ASN-523, MUTAGENESIS OF GLU-206 AND GLU-375.
  7. "Membrane localization and pH-dependent transport of a newly cloned organic cation transporter (PMAT) in kidney cells."
    Xia L., Engel K., Zhou M., Wang J.
    Am. J. Physiol. 292:F682-F690(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TOPOLOGY, TISSUE SPECIFICITY.
  8. "Molecular determinants of substrate selectivity of a novel organic cation transporter (PMAT) in the SLC29 family."
    Zhou M., Xia L., Engel K., Wang J.
    J. Biol. Chem. 282:3188-3195(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, MUTAGENESIS OF ASP-91; ASP-107; GLU-128; ASP-154; ASP-163; GLU-206; THR-220; GLU-227; GLU-242; TRP-336 AND GLU-375.
  9. "The organic cation transporters (OCT1, OCT2, EMT) and the plasma membrane monoamine transporter (PMAT) show differential distribution and cyclic expression pattern in human endometrium and early pregnancy decidua."
    Bottalico B., Noskova V., Pilka R., Larsson I., Domanski H., Casslen B., Hansson S.R.
    Mol. Reprod. Dev. 74:1303-1311(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.

Entry informationi

Entry nameiS29A4_HUMAN
AccessioniPrimary (citable) accession number: Q7RTT9
Secondary accession number(s): Q6PJ08
, Q86WY8, Q8NAR3, Q8NBM2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: December 15, 2003
Last modified: October 29, 2014
This is version 95 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3