Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein NLRC3

Gene

NLRC3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

May modulate T-cell activation. Decreases the transcription of genes that are normally up-regulated after T-cell stimulation. Delays degradation of NFKBIA/IKBA.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi145 – 1528ATPPROSITE-ProRule annotation

GO - Molecular functioni

GO - Biological processi

  • I-kappaB kinase/NF-kappaB signaling Source: UniProtKB
  • negative regulation of I-kappaB kinase/NF-kappaB signaling Source: MGI
  • negative regulation of interleukin-6 production Source: CACAO
  • negative regulation of NF-kappaB transcription factor activity Source: UniProtKB
  • negative regulation of tumor necrosis factor production Source: CACAO
  • T cell activation Source: UniProtKB
Complete GO annotation...

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Protein NLRC3
Alternative name(s):
CARD15-like protein
Caterpiller protein 16.2
Short name:
CLR16.2
Nucleotide-binding oligomerization domain protein 3
Gene namesi
Name:NLRC3
Synonyms:NOD3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:29889. NLRC3.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162397626.

Polymorphism and mutation databases

BioMutaiNLRC3.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10651065Protein NLRC3PRO_0000296187Add
BLAST

Proteomic databases

MaxQBiQ7RTR2.
PeptideAtlasiQ7RTR2.
PRIDEiQ7RTR2.
TopDownProteomicsiQ7RTR2-3. [Q7RTR2-3]

PTM databases

iPTMnetiQ7RTR2.
PhosphoSiteiQ7RTR2.

Expressioni

Tissue specificityi

Detected in peripheral blood mononuclear cells.1 Publication

Inductioni

Down-regulated upon T-cell activation.1 Publication

Gene expression databases

BgeeiENSG00000167984.
CleanExiHS_NLRC3.
ExpressionAtlasiQ7RTR2. baseline and differential.
GenevisibleiQ7RTR2. HS.

Interactioni

Protein-protein interaction databases

BioGridi128254. 1 interaction.
IntActiQ7RTR2. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ7RTR2.
SMRiQ7RTR2. Positions 572-1064.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini139 – 460322NACHTPROSITE-ProRule annotationAdd
BLAST
Repeati617 – 63923LRR 1Add
BLAST
Repeati641 – 66323LRR 2Add
BLAST
Repeati665 – 68824LRR 3Add
BLAST
Repeati693 – 71624LRR 4Add
BLAST
Repeati721 – 74424LRR 5Add
BLAST
Repeati749 – 77224LRR 6Add
BLAST
Repeati777 – 80024LRR 7Add
BLAST
Repeati805 – 82824LRR 8Add
BLAST
Repeati833 – 85624LRR 9Add
BLAST
Repeati861 – 88424LRR 10Add
BLAST
Repeati889 – 91224LRR 11Add
BLAST
Repeati917 – 94024LRR 12Add
BLAST
Repeati945 – 96824LRR 13Add
BLAST
Repeati973 – 99624LRR 14Add
BLAST
Repeati1001 – 102929LRR 15Add
BLAST
Repeati1031 – 105222LRR 16Add
BLAST

Sequence similaritiesi

Belongs to the NLRP family.Curated
Contains 16 LRR (leucine-rich) repeats.Curated
Contains 1 NACHT domain.PROSITE-ProRule annotation

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

GeneTreeiENSGT00840000129675.
HOGENOMiHOG000108875.
HOVERGENiHBG055285.
InParanoidiQ7RTR2.
PhylomeDBiQ7RTR2.

Family and domain databases

Gene3Di3.80.10.10. 3 hits.
InterProiIPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR007111. NACHT_NTPase.
[Graphical view]
PfamiPF13516. LRR_6. 12 hits.
[Graphical view]
PROSITEiPS50837. NACHT. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7RTR2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRKQEVRTGR EAGQGHGTGS PAEQVKALMD LLAGKGSQGS QAPQALDRTP
60 70 80 90 100
DAPLGPCSND SRIQRHRKAL LSKVGGGPEL GGPWHRLASL LLVEGLTDLQ
110 120 130 140 150
LREHDFTQVE ATRGGGHPAR TVALDRLFLP LSRVSVPPRV SITIGVAGMG
160 170 180 190 200
KTTLVRHFVR LWAHGQVGKD FSLVLPLTFR DLNTHEKLCA DRLICSVFPH
210 220 230 240 250
VGEPSLAVAV PARALLILDG LDECRTPLDF SNTVACTDPK KEIPVDHLIT
260 270 280 290 300
NIIRGNLFPE VSIWITSRPS ASGQIPGGLV DRMTEIRGFN EEEIKVCLEQ
310 320 330 340 350
MFPEDQALLG WMLSQVQADR ALYLMCTVPA FCRLTGMALG HLWRSRTGPQ
360 370 380 390 400
DAELWPPRTL CELYSWYFRM ALSGEGQEKG KASPRIEQVA HGGRKMVGTL
410 420 430 440 450
GRLAFHGLLK KKYVFYEQDM KAFGVDLALL QGAPCSCFLQ REETLASSVA
460 470 480 490 500
YCFTHLSLQE FVAAAYYYGA SRRAIFDLFT ESGVSWPRLG FLTHFRSAAQ
510 520 530 540 550
RAMQAEDGRL DVFLRFLSGL LSPRVNALLA GSLLAQGEHQ AYRTQVAELL
560 570 580 590 600
QGCLRPDAAV CARAINVLHC LHELQHTELA RSVEEAMESG ALARLTGPAH
610 620 630 640 650
RAALAYLLQV SDACAQEANL SLSLSQGVLQ SLLPQLLYCR KLRLDTNQFQ
660 670 680 690 700
DPVMELLGSV LSGKDCRIQK ISLAENQISN KGAKALARSL LVNRSLTSLD
710 720 730 740 750
LRGNSIGPQG AKALADALKI NRTLTSLSLQ GNTVRDDGAR SMAEALASNR
760 770 780 790 800
TLSMLHLQKN SIGPMGAQRM ADALKQNRSL KELMFSSNSI GDGGAKALAE
810 820 830 840 850
ALKVNQGLES LDLQSNSISD AGVAALMGAL CTNQTLLSLS LRENSISPEG
860 870 880 890 900
AQAIAHALCA NSTLKNLDLT ANLLHDQGAR AIAVAVRENR TLTSLHLQWN
910 920 930 940 950
FIQAGAAQAL GQALQLNRSL TSLDLQENAI GDDGACAVAR ALKVNTALTA
960 970 980 990 1000
LYLQVASIGA SGAQVLGEAL AVNRTLEILD LRGNAIGVAG AKALANALKV
1010 1020 1030 1040 1050
NSSLRRLNLQ ENSLGMDGAI CIATALSGNH RLQHINLQGN HIGDSGARMI
1060
SEAIKTNAPT CTVEM
Length:1,065
Mass (Da):114,658
Last modified:July 24, 2007 - v2
Checksum:i9BFFCB21FD134562
GO
Isoform 2 (identifier: Q7RTR2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEMDAPRPPSLAVPGAASRPGRLLDGGHGRQQVQALSSQLLEVIPDS

Show »
Length:1,111
Mass (Da):119,415
Checksum:iFEE1E4406C56A5B4
GO
Isoform 3 (identifier: Q7RTR2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     728-761: SLQGNTVRDDGARSMAEALASNRTLSMLHLQKNS → RVKFMYHKIDCFRRVPEADACNPSTLGGQGRWIT
     762-1065: Missing.

Note: No experimental confirmation available.
Show »
Length:761
Mass (Da):83,456
Checksum:iD15C62D5D14362DF
GO
Isoform 4 (identifier: Q7RTR2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     869-896: Missing.

Note: No experimental confirmation available.
Show »
Length:1,037
Mass (Da):111,634
Checksum:i3773D36A3AA54050
GO

Sequence cautioni

The sequence BAC03412 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti41 – 411Q → H in DAA01245 (PubMed:12766759).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti567 – 5671V → M.
Corresponds to variant rs8057436 [ dbSNP | Ensembl ].
VAR_034606

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MEMDAPRPPSLAVPGAASRP GRLLDGGHGRQQVQALSSQL LEVIPDS in isoform 2. 1 PublicationVSP_027135
Alternative sequencei728 – 76134SLQGN…LQKNS → RVKFMYHKIDCFRRVPEADA CNPSTLGGQGRWIT in isoform 3. 1 PublicationVSP_027136Add
BLAST
Alternative sequencei762 – 1065304Missing in isoform 3. 1 PublicationVSP_027137Add
BLAST
Alternative sequencei869 – 89628Missing in isoform 4. 1 PublicationVSP_027138Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BK001112 mRNA. Translation: DAA01245.1.
AY601811 mRNA. Translation: AAT48367.1.
AK090431 mRNA. Translation: BAC03412.1. Different initiation.
AK074109 mRNA. Translation: BAB84935.1.
AF501291 mRNA. Translation: AAM22459.1.
AF501292 mRNA. Translation: AAM22460.1.
CCDSiCCDS73817.1. [Q7RTR2-1]
RefSeqiNP_849172.2. NM_178844.3. [Q7RTR2-1]
UniGeneiHs.592091.
Hs.741496.

Genome annotation databases

EnsembliENST00000359128; ENSP00000352039; ENSG00000167984. [Q7RTR2-1]
ENST00000448023; ENSP00000414415; ENSG00000167984. [Q7RTR2-1]
ENST00000615877; ENSP00000482989; ENSG00000167984. [Q7RTR2-3]
GeneIDi197358.
KEGGihsa:197358.
UCSCiuc032dpc.2. human. [Q7RTR2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BK001112 mRNA. Translation: DAA01245.1.
AY601811 mRNA. Translation: AAT48367.1.
AK090431 mRNA. Translation: BAC03412.1. Different initiation.
AK074109 mRNA. Translation: BAB84935.1.
AF501291 mRNA. Translation: AAM22459.1.
AF501292 mRNA. Translation: AAM22460.1.
CCDSiCCDS73817.1. [Q7RTR2-1]
RefSeqiNP_849172.2. NM_178844.3. [Q7RTR2-1]
UniGeneiHs.592091.
Hs.741496.

3D structure databases

ProteinModelPortaliQ7RTR2.
SMRiQ7RTR2. Positions 572-1064.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128254. 1 interaction.
IntActiQ7RTR2. 1 interaction.

PTM databases

iPTMnetiQ7RTR2.
PhosphoSiteiQ7RTR2.

Polymorphism and mutation databases

BioMutaiNLRC3.

Proteomic databases

MaxQBiQ7RTR2.
PeptideAtlasiQ7RTR2.
PRIDEiQ7RTR2.
TopDownProteomicsiQ7RTR2-3. [Q7RTR2-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000359128; ENSP00000352039; ENSG00000167984. [Q7RTR2-1]
ENST00000448023; ENSP00000414415; ENSG00000167984. [Q7RTR2-1]
ENST00000615877; ENSP00000482989; ENSG00000167984. [Q7RTR2-3]
GeneIDi197358.
KEGGihsa:197358.
UCSCiuc032dpc.2. human. [Q7RTR2-1]

Organism-specific databases

CTDi197358.
GeneCardsiNLRC3.
HGNCiHGNC:29889. NLRC3.
MIMi615648. gene.
neXtProtiNX_Q7RTR2.
PharmGKBiPA162397626.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00840000129675.
HOGENOMiHOG000108875.
HOVERGENiHBG055285.
InParanoidiQ7RTR2.
PhylomeDBiQ7RTR2.

Miscellaneous databases

ChiTaRSiNLRC3. human.
GeneWikiiNLRC3.
GenomeRNAii197358.
PROiQ7RTR2.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000167984.
CleanExiHS_NLRC3.
ExpressionAtlasiQ7RTR2. baseline and differential.
GenevisibleiQ7RTR2. HS.

Family and domain databases

Gene3Di3.80.10.10. 3 hits.
InterProiIPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR007111. NACHT_NTPase.
[Graphical view]
PfamiPF13516. LRR_6. 12 hits.
[Graphical view]
PROSITEiPS50837. NACHT. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNLRC3_HUMAN
AccessioniPrimary (citable) accession number: Q7RTR2
Secondary accession number(s): Q5EY36
, Q8NF48, Q8NI01, Q8NI02, Q8TEL3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: July 24, 2007
Last modified: September 7, 2016
This is version 110 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.