Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein-methionine sulfoxide oxidase MICAL3

Gene

MICAL3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Monooxygenase that promotes depolymerization of F-actin by mediating oxidation of specific methionine residues on actin. Acts by modifying actin subunits through the addition of oxygen to form methionine-sulfoxide, leading to promote actin filament severing and prevent repolymerization. Involved in exocytic vesicles tethering and fusion: the monooxygenase activity is required for this process.2 Publications

Catalytic activityi

[protein]-methionine + NADPH + O2 = [protein]-methionine-sulfoxide + NADP+ + H2O.

Cofactori

FADBy similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei97FADBy similarity1
Binding sitei116FADBy similarity1
Binding sitei118FADBy similarity1
Binding sitei123FADBy similarity1
Binding sitei125FADBy similarity1
Binding sitei398FADBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi88 – 117FADSequence analysisAdd BLAST30
Nucleotide bindingi97 – 125FADBy similarityAdd BLAST29

GO - Molecular functioni

GO - Biological processi

  • actin filament depolymerization Source: UniProtKB
  • cytoskeleton organization Source: UniProtKB
  • exocytosis Source: UniProtKB-KW
  • oxidation-reduction process Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Monooxygenase, Oxidoreductase

Keywords - Biological processi

Exocytosis

Keywords - Ligandi

Actin-binding, FAD, Flavoprotein, Metal-binding, NADP, Zinc

Enzyme and pathway databases

BioCyciZFISH:G66-33223-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein-methionine sulfoxide oxidase MICAL3 (EC:1.14.13.-)
Alternative name(s):
Molecule interacting with CasL protein 3
Short name:
MICAL-3
Gene namesi
Name:MICAL3
Synonyms:KIAA0819, KIAA1364
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

HGNCiHGNC:24694. MICAL3.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: HPA
  • cytoskeleton Source: UniProtKB-SubCell
  • nucleoplasm Source: HPA
  • nucleus Source: UniProtKB
  • plasma membrane Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi93 – 98GAGPCG → WAWPCW: Abolishes Monooxygenase activity and impairs ability to control docking and fusion of exocytic carriers. 1 Publication6
Mutagenesisi680 – 683KRRK → AAAA in MICAL-3NLSMut; abolishes nuclear localization. 1 Publication4

Organism-specific databases

DisGeNETi57553.
OpenTargetsiENSG00000243156.
PharmGKBiPA142671454.

Polymorphism and mutation databases

BioMutaiMICAL3.
DMDMi300669653.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000758461 – 2002Protein-methionine sulfoxide oxidase MICAL3Add BLAST2002

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei649PhosphoserineCombined sources1
Modified residuei685PhosphoserineBy similarity1
Modified residuei687PhosphoserineBy similarity1
Modified residuei887PhosphothreonineCombined sources1
Modified residuei977PhosphoserineBy similarity1
Modified residuei1134PhosphoserineCombined sources1
Modified residuei1143PhosphoserineCombined sources1
Modified residuei1160PhosphoserineCombined sources1
Modified residuei1192PhosphoserineBy similarity1
Modified residuei1274PhosphoserineCombined sources1
Modified residuei1276PhosphothreonineCombined sources1
Modified residuei1278PhosphoserineCombined sources1
Modified residuei1310PhosphoserineCombined sources1
Modified residuei1337PhosphoserineCombined sources1
Modified residuei1341PhosphothreonineCombined sources1
Modified residuei1371PhosphoserineCombined sources1
Modified residuei1384PhosphoserineCombined sources1
Modified residuei1433PhosphoserineCombined sources1
Modified residuei1454PhosphothreonineCombined sources1
Modified residuei1649PhosphoserineCombined sources1
Modified residuei1651PhosphothreonineCombined sources1
Modified residuei1701PhosphoserineCombined sources1
Modified residuei1704PhosphoserineCombined sources1
Modified residuei1912PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ7RTP6.
MaxQBiQ7RTP6.
PaxDbiQ7RTP6.
PeptideAtlasiQ7RTP6.
PRIDEiQ7RTP6.

PTM databases

iPTMnetiQ7RTP6.
PhosphoSitePlusiQ7RTP6.

Expressioni

Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

BgeeiENSG00000243156.
CleanExiHS_MICAL3.
ExpressionAtlasiQ7RTP6. baseline and differential.
GenevisibleiQ7RTP6. HS.

Organism-specific databases

HPAiHPA000639.
HPA003421.
HPA034882.

Interactioni

Subunit structurei

Interacts with RAB1B. Interacts with ERC1 and RAB8A.2 Publications

GO - Molecular functioni

  • actin binding Source: UniProtKB

Protein-protein interaction databases

BioGridi121609. 27 interactors.
IntActiQ7RTP6. 20 interactors.
STRINGi9606.ENSP00000416015.

Structurei

Secondary structure

12002
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi519 – 521Combined sources3
Helixi523 – 531Combined sources9
Beta strandi535 – 537Combined sources3
Helixi545 – 548Combined sources4
Helixi551 – 560Combined sources10
Turni562 – 564Combined sources3
Turni567 – 569Combined sources3
Helixi575 – 589Combined sources15
Helixi598 – 603Combined sources6
Helixi609 – 623Combined sources15
Helixi1842 – 1877Combined sources36
Helixi1887 – 1889Combined sources3
Helixi1892 – 1938Combined sources47
Helixi1942 – 1944Combined sources3
Helixi1947 – 1980Combined sources34

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2D88NMR-A518-625[»]
5SZGX-ray2.70A/B1841-1990[»]
ProteinModelPortaliQ7RTP6.
SMRiQ7RTP6.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ7RTP6.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini518 – 621CHPROSITE-ProRule annotationAdd BLAST104
Domaini762 – 824LIM zinc-bindingPROSITE-ProRule annotationAdd BLAST63

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni2 – 494Monooxygenase domainBy similarityAdd BLAST493

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili1821 – 1992Sequence analysisAdd BLAST172

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi663 – 684Nuclear localization signal1 PublicationAdd BLAST22

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi688 – 691Poly-Glu4
Compositional biasi889 – 1138Glu-richAdd BLAST250
Compositional biasi1141 – 1505Pro-richAdd BLAST365

Sequence similaritiesi

Belongs to the Mical family.Curated
Contains 1 CH (calponin-homology) domain.PROSITE-ProRule annotation
Contains 1 LIM zinc-binding domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, LIM domain

Phylogenomic databases

eggNOGiKOG1700. Eukaryota.
COG5069. LUCA.
GeneTreeiENSGT00760000118856.
HOGENOMiHOG000047263.
HOVERGENiHBG081827.
InParanoidiQ7RTP6.
KOiK19947.
OMAiPLSPICA.
OrthoDBiEOG091G009H.
PhylomeDBiQ7RTP6.
TreeFamiTF324129.

Family and domain databases

CDDicd00014. CH. 1 hit.
Gene3Di1.10.418.10. 1 hit.
2.10.110.10. 1 hit.
3.50.50.60. 2 hits.
InterProiIPR001715. CH-domain.
IPR022735. DUF3585.
IPR002938. FAD-bd.
IPR023753. FAD/NAD-binding_dom.
IPR029941. MICAL3.
IPR001781. Znf_LIM.
[Graphical view]
PANTHERiPTHR11915:SF239. PTHR11915:SF239. 2 hits.
PfamiPF00307. CH. 1 hit.
PF12130. DUF3585. 1 hit.
PF01494. FAD_binding_3. 1 hit.
PF00412. LIM. 1 hit.
[Graphical view]
SMARTiSM00033. CH. 1 hit.
SM00132. LIM. 1 hit.
[Graphical view]
SUPFAMiSSF47576. SSF47576. 1 hit.
SSF51905. SSF51905. 2 hits.
PROSITEiPS50021. CH. 1 hit.
PS00478. LIM_DOMAIN_1. 1 hit.
PS50023. LIM_DOMAIN_2. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: Q7RTP6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEERKHETMN PAHVLFDRFV QATTCKGTLK AFQELCDHLE LKPKDYRSFY
60 70 80 90 100
HKLKSKLNYW KAKALWAKLD KRGSHKDYKK GKACTNTKCL IIGAGPCGLR
110 120 130 140 150
TAIDLSLLGA KVVVIEKRDA FSRNNVLHLW PFTIHDLRGL GAKKFYGKFC
160 170 180 190 200
AGAIDHISIR QLQLILLKVA LILGIEIHVN VEFQGLIQPP EDQENERIGW
210 220 230 240 250
RALVHPKTHP VSEYEFEVII GGDGRRNTLE GFRRKEFRGK LAIAITANFI
260 270 280 290 300
NRNTTAEAKV EEISGVAFIF NQKFFQELRE ATGIDLENIV YYKDDTHYFV
310 320 330 340 350
MTAKKQSLLD KGVILHDYAD TELLLSRENV DQEALLSYAR EAADFSTQQQ
360 370 380 390 400
LPSLDFAINH YGQPDVAMFD FTCMYASENA ALVREQNGHQ LLVALVGDSL
410 420 430 440 450
LEPFWPMGTG IARGFLAAMD SAWMVRSWSL GTSPLEVLAE RESIYRLLPQ
460 470 480 490 500
TTPENVSKNF SQYSIDPVTR YPNINVNFLR PSQVRHLYDT GETKDIHLEM
510 520 530 540 550
ESLVNSRTTP KLTRNESVAR SSKLLGWCQR QTDGYAGVNV TDLTMSWKSG
560 570 580 590 600
LALCAIIHRY RPDLIDFDSL DEQNVEKNNQ LAFDIAEKEL GISPIMTGKE
610 620 630 640 650
MASVGEPDKL SMVMYLTQFY EMFKDSLPSS DTLDLNAEEK AVLIASTRSP
660 670 680 690 700
ISFLSKLGQT ISRKRSPKDK KEKDLDGAGK RRKTSQSEEE EAPRGHRGER
710 720 730 740 750
PTLVSTLTDR RMDVAVGNQN KVKYMATQLL AKFEENAPAQ SIGIRRQGSM
760 770 780 790 800
KKEFPQNLGG SDTCYFCQKR VYVMERLSAE GKFFHRSCFK CEYCATTLRL
810 820 830 840 850
SAYAYDIEDG KFYCKPHYCY RLSGYAQRKR PAVAPLSGKE AKGPLQDGAT
860 870 880 890 900
TDANGRANAV ASSTERTPGS GVNGLEEPSI AKRLRGTPER IELENYRLSL
910 920 930 940 950
RQAEALQEVP EETQAEHNLS SVLDTGAEED VASSSSESEM EEEGEEEEEE
960 970 980 990 1000
PRLPPSDLGG VPWKEAVRIH ALLKGKSEEE LEASKSFGPG NEEEEEEEEE
1010 1020 1030 1040 1050
YEEEEEEDYD EEEEESSEAG NQRLQQVMHA ADPLEIQADV HWTHIREREE
1060 1070 1080 1090 1100
EERMAPASES SASGAPLDEN DLEEDVDSEP AEIEGEAAED GDPGDTGAEL
1110 1120 1130 1140 1150
DDDQHWSDSP SDADRELRLP CPAEGEAELE LRVSEDEEKL PASPKHQERG
1160 1170 1180 1190 1200
PSQATSPIRS PQESALLFIP VHSPSTEGPQ LPPVPAATQE KSPEERLFPE
1210 1220 1230 1240 1250
PLLPKEKPKA DAPSDLKAVH SPIRSQPVTL PEARTPVSPG SPQPQPPVAA
1260 1270 1280 1290 1300
STPPPSPLPI CSQPQPSTEA TVPSPTQSPI RFQPAPAKTS TPLAPLPVQS
1310 1320 1330 1340 1350
QSDTKDRLGS PLAVDEALRR SDLVEEFWMK SAEIRRSLGL TPVDRSKGPE
1360 1370 1380 1390 1400
PSFPTPAFRP VSLKSYSVEK SPQDEGLHLL KPLSIPKRLG LPKPEGEPLS
1410 1420 1430 1440 1450
LPTPRSPSDR ELRSAQEERR ELSSSSGLGL HGSSSNMKTL GSQSFNTSDS
1460 1470 1480 1490 1500
AMLTPPSSPP PPPPPGEEPA TLRRKLREAE PNASVVPPPL PATWMRPPRE
1510 1520 1530 1540 1550
PAQPPREEVR KSFVESVEEI PFADDVEDTY DDKTEDSSLQ EKFFTPPSCW
1560 1570 1580 1590 1600
PRPEKPRHPP LAKENGRLPA LEGTLQPQKR GLPLVSAEAK ELAEERMRAR
1610 1620 1630 1640 1650
EKSVKSQALR DAMARQLSRM QQMELASGAP RPRKASSAPS QGKERRPDSP
1660 1670 1680 1690 1700
TRPTLRGSEE PTLKHEATSE EVLSPPSDSG GPDGSFTSSE GSSGKSKKRS
1710 1720 1730 1740 1750
SLFSPRRNKK EKKSKGEGRP PEKPSSNLLE EAAAKPKSLW KSVFSGYKKD
1760 1770 1780 1790 1800
KKKKADDKSC PSTPSSGATV DSGKHRVLPV VRAELQLRRQ LSFSEDSDLS
1810 1820 1830 1840 1850
SDDVLEKSSQ KSRREPRTYT EEELNAKLTR RVQKAARRQA KQEELKRLHR
1860 1870 1880 1890 1900
AQIIQRQLQQ VEERQRRLEE RGVAVEKALR GEAGMGKKDD PKLMQEWFKL
1910 1920 1930 1940 1950
VQEKNAMVRY ESELMIFARE LELEDRQSRL QQELRERMAV EDHLKTEEEL
1960 1970 1980 1990 2000
SEEKQILNEM LEVVEQRDSL VALLEEQRLR EREEDKDLEA AMLSKGFSLN

WS
Length:2,002
Mass (Da):224,295
Last modified:July 13, 2010 - v2
Checksum:iF85C97FD4D647B80
GO
Isoform 2 (identifier: Q7RTP6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     934-948: SSSESEMEEEGEEEE → RSARRAAGRPPATRP
     949-2002: Missing.

Note: No experimental confirmation available.
Show »
Length:948
Mass (Da):106,837
Checksum:iD50FC4EC6F46D30C
GO
Isoform 3 (identifier: Q7RTP6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     746-746: R → RQLTQERGASQPSCCLPGQVRPAPTPRWK
     934-948: SSSESEMEEEGEEEE → RSARRAAGRPPATRP
     949-2002: Missing.

Show »
Length:976
Mass (Da):109,911
Checksum:iD94482577189AD04
GO
Isoform 4 (identifier: Q7RTP6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     934-966: SSSESEMEEEGEEEEEEPRLPPSDLGGVPWKEA → RDWVSPWLPRMVSNSWAQMIHPPQPPTVLGSQM
     967-2002: Missing.

Show »
Length:966
Mass (Da):109,047
Checksum:iDC1B9C83CB4D3E35
GO
Isoform 5 (identifier: Q7RTP6-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     747-747: Q → QQREKECSRT...PKALLDKKEL
     871-949: GVNGLEEPSI...MEEEGEEEEE → LTSLFGWVAR...GEFHWQAVAQ
     950-2002: Missing.

Note: No experimental confirmation available.
Show »
Length:1,073
Mass (Da):121,173
Checksum:iC550AC7BE7536179
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti414G → D in BX647382 (PubMed:17974005).Curated1
Sequence conflicti1245Q → R in BAA74842 (PubMed:10718198).Curated1
Sequence conflicti1717E → V in AAH06562 (PubMed:15489334).Curated1
Isoform 4 (identifier: Q7RTP6-4)
Sequence conflicti957Q → R in BX647382 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05945111P → A.Corresponds to variant rs11913706dbSNPEnsembl.1
Natural variantiVAR_059452745R → Q.Corresponds to variant rs2289719dbSNPEnsembl.1
Natural variantiVAR_018263750M → L.Corresponds to variant rs5992128dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_039485746R → RQLTQERGASQPSCCLPGQV RPAPTPRWK in isoform 3. 1 Publication1
Alternative sequenceiVSP_042600747Q → QQREKECSRTCPKKVITLSP PPTPPPCRAHGGQQTYRDLD ADNRGKQSPHHERPEPEPPR RFFVDQWELSLSLRSSARPA SPSSDSLRQKYIKMYTGGVS SLAEQIANQLQRKEQPKALL DKKEL in isoform 5. 1 Publication1
Alternative sequenceiVSP_042601871 – 949GVNGL…EEEEE → LTSLFGWVARHSLGLCDKAK GMSQHLQSNISSFGQQVAQN PLDSFFMCQLLAFGVPFLYG LSEVLVQIRGEFHWQAVAQ in isoform 5. 1 PublicationAdd BLAST79
Alternative sequenceiVSP_039486934 – 966SSSES…PWKEA → RDWVSPWLPRMVSNSWAQMI HPPQPPTVLGSQM in isoform 4. 2 PublicationsAdd BLAST33
Alternative sequenceiVSP_039487934 – 948SSSES…GEEEE → RSARRAAGRPPATRP in isoform 2 and isoform 3. 2 PublicationsAdd BLAST15
Alternative sequenceiVSP_039488949 – 2002Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST1054
Alternative sequenceiVSP_042602950 – 2002Missing in isoform 5. 1 PublicationAdd BLAST1053
Alternative sequenceiVSP_039489967 – 2002Missing in isoform 4. 2 PublicationsAdd BLAST1036

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
CR456364 mRNA. Translation: CAG30250.1.
BX647382 mRNA. No translation available.
AC016026 Genomic DNA. No translation available.
AC016027 Genomic DNA. No translation available.
BC006562 mRNA. Translation: AAH06562.2.
BC085009 mRNA. Translation: AAH85009.1.
BC157876 mRNA. Translation: AAI57877.1.
BC171887 mRNA. Translation: AAI71887.1.
AB020626 mRNA. Translation: BAA74842.1.
AB037785 mRNA. Translation: BAA92602.1.
BK000464 mRNA. Translation: DAA01343.1.
BK000465 mRNA. Translation: DAA01344.1.
CCDSiCCDS46659.1. [Q7RTP6-1]
CCDS46660.1. [Q7RTP6-4]
CCDS46661.1. [Q7RTP6-5]
RefSeqiNP_001116203.1. NM_001122731.2. [Q7RTP6-4]
NP_001129476.1. NM_001136004.3. [Q7RTP6-5]
NP_056056.2. NM_015241.2. [Q7RTP6-1]
XP_005261319.1. XM_005261262.3. [Q7RTP6-1]
UniGeneiHs.528024.

Genome annotation databases

EnsembliENST00000383094; ENSP00000372574; ENSG00000243156. [Q7RTP6-2]
ENST00000400561; ENSP00000383406; ENSG00000243156. [Q7RTP6-4]
ENST00000414725; ENSP00000391827; ENSG00000243156. [Q7RTP6-3]
ENST00000441493; ENSP00000416015; ENSG00000243156. [Q7RTP6-1]
ENST00000585038; ENSP00000462033; ENSG00000243156. [Q7RTP6-5]
GeneIDi57553.
KEGGihsa:57553.
UCSCiuc002zng.5. human. [Q7RTP6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
CR456364 mRNA. Translation: CAG30250.1.
BX647382 mRNA. No translation available.
AC016026 Genomic DNA. No translation available.
AC016027 Genomic DNA. No translation available.
BC006562 mRNA. Translation: AAH06562.2.
BC085009 mRNA. Translation: AAH85009.1.
BC157876 mRNA. Translation: AAI57877.1.
BC171887 mRNA. Translation: AAI71887.1.
AB020626 mRNA. Translation: BAA74842.1.
AB037785 mRNA. Translation: BAA92602.1.
BK000464 mRNA. Translation: DAA01343.1.
BK000465 mRNA. Translation: DAA01344.1.
CCDSiCCDS46659.1. [Q7RTP6-1]
CCDS46660.1. [Q7RTP6-4]
CCDS46661.1. [Q7RTP6-5]
RefSeqiNP_001116203.1. NM_001122731.2. [Q7RTP6-4]
NP_001129476.1. NM_001136004.3. [Q7RTP6-5]
NP_056056.2. NM_015241.2. [Q7RTP6-1]
XP_005261319.1. XM_005261262.3. [Q7RTP6-1]
UniGeneiHs.528024.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2D88NMR-A518-625[»]
5SZGX-ray2.70A/B1841-1990[»]
ProteinModelPortaliQ7RTP6.
SMRiQ7RTP6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121609. 27 interactors.
IntActiQ7RTP6. 20 interactors.
STRINGi9606.ENSP00000416015.

PTM databases

iPTMnetiQ7RTP6.
PhosphoSitePlusiQ7RTP6.

Polymorphism and mutation databases

BioMutaiMICAL3.
DMDMi300669653.

Proteomic databases

EPDiQ7RTP6.
MaxQBiQ7RTP6.
PaxDbiQ7RTP6.
PeptideAtlasiQ7RTP6.
PRIDEiQ7RTP6.

Protocols and materials databases

DNASUi57553.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000383094; ENSP00000372574; ENSG00000243156. [Q7RTP6-2]
ENST00000400561; ENSP00000383406; ENSG00000243156. [Q7RTP6-4]
ENST00000414725; ENSP00000391827; ENSG00000243156. [Q7RTP6-3]
ENST00000441493; ENSP00000416015; ENSG00000243156. [Q7RTP6-1]
ENST00000585038; ENSP00000462033; ENSG00000243156. [Q7RTP6-5]
GeneIDi57553.
KEGGihsa:57553.
UCSCiuc002zng.5. human. [Q7RTP6-1]

Organism-specific databases

CTDi57553.
DisGeNETi57553.
GeneCardsiMICAL3.
H-InvDBHIX0213260.
HGNCiHGNC:24694. MICAL3.
HPAiHPA000639.
HPA003421.
HPA034882.
MIMi608882. gene.
neXtProtiNX_Q7RTP6.
OpenTargetsiENSG00000243156.
PharmGKBiPA142671454.
HUGEiSearch...
Search...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1700. Eukaryota.
COG5069. LUCA.
GeneTreeiENSGT00760000118856.
HOGENOMiHOG000047263.
HOVERGENiHBG081827.
InParanoidiQ7RTP6.
KOiK19947.
OMAiPLSPICA.
OrthoDBiEOG091G009H.
PhylomeDBiQ7RTP6.
TreeFamiTF324129.

Enzyme and pathway databases

BioCyciZFISH:G66-33223-MONOMER.

Miscellaneous databases

ChiTaRSiMICAL3. human.
EvolutionaryTraceiQ7RTP6.
GeneWikiiMICAL3.
GenomeRNAii57553.
PROiQ7RTP6.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000243156.
CleanExiHS_MICAL3.
ExpressionAtlasiQ7RTP6. baseline and differential.
GenevisibleiQ7RTP6. HS.

Family and domain databases

CDDicd00014. CH. 1 hit.
Gene3Di1.10.418.10. 1 hit.
2.10.110.10. 1 hit.
3.50.50.60. 2 hits.
InterProiIPR001715. CH-domain.
IPR022735. DUF3585.
IPR002938. FAD-bd.
IPR023753. FAD/NAD-binding_dom.
IPR029941. MICAL3.
IPR001781. Znf_LIM.
[Graphical view]
PANTHERiPTHR11915:SF239. PTHR11915:SF239. 2 hits.
PfamiPF00307. CH. 1 hit.
PF12130. DUF3585. 1 hit.
PF01494. FAD_binding_3. 1 hit.
PF00412. LIM. 1 hit.
[Graphical view]
SMARTiSM00033. CH. 1 hit.
SM00132. LIM. 1 hit.
[Graphical view]
SUPFAMiSSF47576. SSF47576. 1 hit.
SSF51905. SSF51905. 2 hits.
PROSITEiPS50021. CH. 1 hit.
PS00478. LIM_DOMAIN_1. 1 hit.
PS50023. LIM_DOMAIN_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMICA3_HUMAN
AccessioniPrimary (citable) accession number: Q7RTP6
Secondary accession number(s): B2RXJ5
, E9PEF0, O94909, Q5U4P4, Q6ICK4, Q96DF2, Q9P2I3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 13, 2004
Last sequence update: July 13, 2010
Last modified: November 30, 2016
This is version 140 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.