Q7RTP6 (MICA3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 104.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein-methionine sulfoxide oxidase MICAL3 EC=1.14.13.- Alternative name(s): Molecule interacting with CasL protein 3 Short name=MICAL-3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 2002 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Monooxygenase that promotes depolymerization of F-actin by mediating oxidation of specific methionine residues on actin. Acts by modifying actin subunits through the addition of oxygen to form methionine-sulfoxide, leading to promote actin filament severing and prevent repolymerization By similarity. Involved in exocytic vesicles tethering and fusion: the monooxygenase activity is required for this process. Ref.12 |
| Catalytic activity | [protein]-methionine + NADPH + O2 = [protein]-methionine-sulfoxide + NADP+ + H2O. |
| Cofactor | FAD By similarity. |
| Subunit structure | Interacts with RAB1B. Interacts with ERC1 and RAB8A. Ref.7 Ref.12 |
| Subcellular location | |
| Tissue specificity | Ubiquitous. Ref.7 |
| Sequence similarities | Belongs to the Mical family. Contains 1 CH (calponin-homology) domain. Contains 1 LIM zinc-binding domain. |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: Q7RTP6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q7RTP6-2) The sequence of this isoform differs from the canonical sequence as follows: 934-948: SSSESEMEEEGEEEE → RSARRAAGRPPATRP 949-2002: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q7RTP6-3) The sequence of this isoform differs from the canonical sequence as follows: 746-746: R → RQLTQERGASQPSCCLPGQVRPAPTPRWK 934-948: SSSESEMEEEGEEEE → RSARRAAGRPPATRP 949-2002: Missing. | ||||||
| Isoform 4 (identifier: Q7RTP6-4) The sequence of this isoform differs from the canonical sequence as follows: 934-966: SSSESEMEEEGEEEEEEPRLPPSDLGGVPWKEA → RDWVSPWLPRMVSNSWAQMIHPPQPPTVLGSQM 967-2002: Missing. | ||||||
| Isoform 5 (identifier: Q7RTP6-5) The sequence of this isoform differs from the canonical sequence as follows: 747-747: Q → QQREKECSRT...PKALLDKKEL 871-949: GVNGLEEPSI...MEEEGEEEEE → LTSLFGWVAR...GEFHWQAVAQ 950-2002: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 2002 | 2002 | Protein-methionine sulfoxide oxidase MICAL3 | PRO_0000075846 | |||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||
| Domain | 518 – 621 | 104 | CH | ||||||||||||||||||||||||||
| Domain | 762 – 824 | 63 | LIM zinc-binding | ||||||||||||||||||||||||||
| Nucleotide binding | 88 – 117 | 30 | FAD Potential | ||||||||||||||||||||||||||
| Nucleotide binding | 97 – 125 | 29 | FAD By similarity | ||||||||||||||||||||||||||
| Region | 2 – 494 | 493 | Monooxygenase domain By similarity | ||||||||||||||||||||||||||
| Coiled coil | 1821 – 1992 | 172 | Potential | ||||||||||||||||||||||||||
| Compositional bias | 688 – 691 | 4 | Poly-Glu | ||||||||||||||||||||||||||
| Compositional bias | 889 – 1138 | 250 | Glu-rich | ||||||||||||||||||||||||||
| Compositional bias | 1141 – 1505 | 365 | Pro-rich | ||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||
| Binding site | 97 | 1 | FAD By similarity | ||||||||||||||||||||||||||
| Binding site | 116 | 1 | FAD By similarity | ||||||||||||||||||||||||||
| Binding site | 118 | 1 | FAD By similarity | ||||||||||||||||||||||||||
| Binding site | 123 | 1 | FAD By similarity | ||||||||||||||||||||||||||
| Binding site | 125 | 1 | FAD By similarity | ||||||||||||||||||||||||||
| Binding site | 398 | 1 | FAD By similarity | ||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||
| Modified residue | 649 | 1 | Phosphoserine Ref.9 Ref.11 | ||||||||||||||||||||||||||
| Modified residue | 887 | 1 | Phosphothreonine Ref.9 | ||||||||||||||||||||||||||
| Modified residue | 977 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||
| Modified residue | 1192 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||
| Modified residue | 1221 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||
| Modified residue | 1310 | 1 | Phosphoserine Ref.8 Ref.10 | ||||||||||||||||||||||||||
| Modified residue | 1337 | 1 | Phosphoserine Ref.11 | ||||||||||||||||||||||||||
| Modified residue | 1341 | 1 | Phosphothreonine Ref.11 | ||||||||||||||||||||||||||
| Modified residue | 1371 | 1 | Phosphoserine Ref.9 Ref.13 | ||||||||||||||||||||||||||
| Modified residue | 1384 | 1 | Phosphoserine Ref.9 | ||||||||||||||||||||||||||
| Modified residue | 1454 | 1 | Phosphothreonine Ref.10 | ||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||
| Alternative sequence | 746 | 1 | R → RQLTQERGASQPSCCLPGQV RPAPTPRWK in isoform 3. | VSP_039485 | |||||||||||||||||||||||||
| Alternative sequence | 747 | 1 | Q → QQREKECSRTCPKKVITLSP PPTPPPCRAHGGQQTYRDLD ADNRGKQSPHHERPEPEPPR RFFVDQWELSLSLRSSARPA SPSSDSLRQKYIKMYTGGVS SLAEQIANQLQRKEQPKALL DKKEL in isoform 5. | VSP_042600 | |||||||||||||||||||||||||
| Alternative sequence | 871 – 949 | 79 | GVNGL…EEEEE → LTSLFGWVARHSLGLCDKAK GMSQHLQSNISSFGQQVAQN PLDSFFMCQLLAFGVPFLYG LSEVLVQIRGEFHWQAVAQ in isoform 5. | VSP_042601 | |||||||||||||||||||||||||
| Alternative sequence | 934 – 966 | 33 | SSSES…PWKEA → RDWVSPWLPRMVSNSWAQMI HPPQPPTVLGSQM in isoform 4. | VSP_039486 | |||||||||||||||||||||||||
| Alternative sequence | 934 – 948 | 15 | SSSES…GEEEE → RSARRAAGRPPATRP in isoform 2 and isoform 3. | VSP_039487 | |||||||||||||||||||||||||
| Alternative sequence | 949 – 2002 | 1054 | Missing in isoform 2 and isoform 3. | VSP_039488 | |||||||||||||||||||||||||
| Alternative sequence | 950 – 2002 | 1053 | Missing in isoform 5. | VSP_042602 | |||||||||||||||||||||||||
| Alternative sequence | 967 – 2002 | 1036 | Missing in isoform 4. | VSP_039489 | |||||||||||||||||||||||||
| Natural variant | 11 | 1 | P → A. Corresponds to variant rs11913706 [ dbSNP | Ensembl ]. | VAR_059451 | |||||||||||||||||||||||||
| Natural variant | 745 | 1 | R → Q. Corresponds to variant rs2289719 [ dbSNP | Ensembl ]. | VAR_059452 | |||||||||||||||||||||||||
| Natural variant | 750 | 1 | M → L. Corresponds to variant rs5992128 [ dbSNP | Ensembl ]. | VAR_018263 | |||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||
| Mutagenesis | 93 – 98 | 6 | GAGPCG → WAWPCW: Abolishes Monooxygenase activity and impairs ability to control docking and fusion of exocytic carriers. Ref.12 | ||||||||||||||||||||||||||
| Sequence conflict | 414 | 1 | G → D in BX647382. Ref.2 | ||||||||||||||||||||||||||
| Sequence conflict | 1245 | 1 | Q → R in BAA74842. Ref.5 | ||||||||||||||||||||||||||
| Sequence conflict | 1717 | 1 | E → V in AAH06562. Ref.4 | ||||||||||||||||||||||||||
| Isoform 4: | |||||||||||||||||||||||||||||
| Sequence conflict | 957 | 1 | Q → R in BX647382. Ref.2 | ||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||
| Beta strand | 519 – 521 | 3 | |||||||||||||||||||||||||||
| Helix | 523 – 531 | 9 | |||||||||||||||||||||||||||
| Beta strand | 535 – 537 | 3 | |||||||||||||||||||||||||||
| Helix | 545 – 548 | 4 | |||||||||||||||||||||||||||
| Helix | 551 – 560 | 10 | |||||||||||||||||||||||||||
| Turn | 562 – 564 | 3 | |||||||||||||||||||||||||||
| Turn | 567 – 569 | 3 | |||||||||||||||||||||||||||
| Helix | 575 – 589 | 15 | |||||||||||||||||||||||||||
| Helix | 598 – 603 | 6 | |||||||||||||||||||||||||||
| Helix | 609 – 623 | 15 | |||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A genome annotation-driven approach to cloning the human ORFeome." Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I. Genome Biol. 5:R84.1-R84.11(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [2] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Testis. |
| [3] | "The DNA sequence of human chromosome 22." Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M. Wright H.Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1626-2002 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 682-966 (ISOFORM 4). Tissue: Lymph and Pancreas. |
| [5] | "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O. DNA Res. 7:65-73(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 166-2002 (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1014-2002 (ISOFORM 1). Tissue: Brain. |
| [6] | "MICALs, a family of conserved flavoprotein oxidoreductases, function in plexin-mediated axonal repulsion." Terman J.R., Mao T., Pasterkamp R.J., Yu H.-H., Kolodkin A.L. Cell 109:887-900(2002) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION (ISOFORM 3 AND PARTIAL ISOFORM 1). |
| [7] | "The MICAL proteins and rab1: a possible link to the cytoskeleton?" Fischer J., Weide T., Barnekow A. Biochem. Biophys. Res. Commun. 328:415-423(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH RAB1B, SUBCELLULAR LOCATION, ALTERNATIVE SPLICING, TISSUE SPECIFICITY. |
| [8] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1310, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-649; THR-887; SER-1371 AND SER-1384, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1310 AND THR-1454, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [11] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-649; SER-1337 AND THR-1341, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "Rab6, Rab8, and MICAL3 cooperate in controlling docking and fusion of exocytotic carriers." Grigoriev I., Yu K.L., Martinez-Sanchez E., Serra-Marques A., Smal I., Meijering E., Demmers J., Peranen J., Pasterkamp R.J., van der Sluijs P., Hoogenraad C.C., Akhmanova A. Curr. Biol. 21:967-974(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH ERC1 AND RAB8A, MUTAGENESIS OF 93-GLY--GLY-98. |
| [13] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1371, MASS SPECTROMETRY. |
| [14] | "Solution structure of the CH domain from human MICAL-3 protein." RIKEN structural genomics initiative (RSGI) Submitted (JUN-2006) to the PDB data bank Cited for: STRUCTURE BY NMR OF 515-630. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | CR456364 mRNA. Translation: CAG30250.1. BX647382 mRNA. No translation available. AC016026 Genomic DNA. No translation available. AC016027 Genomic DNA. No translation available. BC006562 mRNA. Translation: AAH06562.2. BC085009 mRNA. Translation: AAH85009.1. BC157876 mRNA. Translation: AAI57877.1. BC171887 mRNA. Translation: AAI71887.1. AB020626 mRNA. Translation: BAA74842.1. AB037785 mRNA. Translation: BAA92602.1. BK000464 mRNA. Translation: DAA01343.1. BK000465 mRNA. Translation: DAA01344.1. | ||||||||||||
| IPI | IPI00177937. IPI00480203. IPI00741791. IPI00896430. IPI00969176. | ||||||||||||
| RefSeq | NP_001116203.1. NM_001122731.1. NP_001129476.1. NM_001136004.1. NP_056056.2. NM_015241.2. | ||||||||||||
| UniGene | Hs.528024. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q7RTP6. | ||||||||||||
| SMR | Q7RTP6. Positions 10-489, 515-630, 762-818. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q7RTP6. 3 interactions. | ||||||||||||
| STRING | 9606.ENSP00000414846. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q7RTP6. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 300669653. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q7RTP6. | ||||||||||||
| PeptideAtlas | O94909. | ||||||||||||
| PRIDE | Q7RTP6. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 57553. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000207726; ENSP00000207726; ENSG00000243156. ENST00000383094; ENSP00000372574; ENSG00000243156. ENST00000400561; ENSP00000383406; ENSG00000243156. ENST00000414725; ENSP00000391827; ENSG00000243156. ENST00000429452; ENSP00000414846; ENSG00000243156. ENST00000441493; ENSP00000416015; ENSG00000243156. ENST00000444520; ENSP00000410315; ENSG00000243156. ENST00000585038; ENSP00000462033; ENSG00000243156. | ||||||||||||
| GeneID | 57553. | ||||||||||||
| KEGG | hsa:57553. | ||||||||||||
| UCSC | uc002zng.4. human. uc002znh.2. human. uc002znj.1. human. uc002znk.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 57553. | ||||||||||||
| GeneCards | GC22M018270. GC22M018271. | ||||||||||||
| H-InvDB | HIX0213260. | ||||||||||||
| HGNC | HGNC:24694. MICAL3. | ||||||||||||
| HPA | HPA000639. HPA003421. | ||||||||||||
| MIM | 608882. gene. | ||||||||||||
| neXtProt | NX_Q7RTP6. | ||||||||||||
| PharmGKB | PA142671454. | ||||||||||||
| HUGE | Search... Search... | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG5069. | ||||||||||||
| HOGENOM | HOG000047263. | ||||||||||||
| HOVERGEN | HBG081827. | ||||||||||||
| InParanoid | O94909. | ||||||||||||
| OMA | PQWKQGS. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q7RTP6. | ||||||||||||
| Bgee | Q7RTP6. | ||||||||||||
| CleanEx | HS_MICAL3. | ||||||||||||
| Genevestigator | Q7RTP6. | ||||||||||||
| GermOnline | ENSG00000093100. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 1.10.418.10. 1 hit. 2.10.110.10. 1 hit. | ||||||||||||
| InterPro | IPR001715. CH-domain. IPR022735. DUF3585. IPR002938. mOase_FAD-bd. IPR003042. Rng_hydrolase-like. IPR001781. Znf_LIM. [Graphical view] | ||||||||||||
| Pfam | PF00307. CH. 1 hit. PF12130. DUF3585. 1 hit. PF01494. FAD_binding_3. 1 hit. PF00412. LIM. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00420. RNGMNOXGNASE. | ||||||||||||
| SMART | SM00033. CH. 1 hit. SM00132. LIM. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF47576. Calponin-homology. 1 hit. | ||||||||||||
| PROSITE | PS50021. CH. 1 hit. PS00478. LIM_DOMAIN_1. 1 hit. PS50023. LIM_DOMAIN_2. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | MICAL3. human. | ||||||||||||
| EvolutionaryTrace | Q7RTP6. | ||||||||||||
| GenomeRNAi | 57553. | ||||||||||||
| NextBio | 64022. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | MICA3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q7RTP6 Secondary accession number(s): B2RXJ5 Q9P2I3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 22 Human chromosome 22: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
