Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

STE20-related kinase adapter protein alpha

Gene

STRADA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Pseudokinase which, in complex with CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta), binds to and activates STK11/LKB1. Adopts a closed conformation typical of active protein kinases and binds STK11/LKB1 as a pseudosubstrate, promoting conformational change of STK11/LKB1 in an active conformation.3 Publications

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • kinase binding Source: BHF-UCL
  • protein kinase activator activity Source: UniProtKB
  • protein serine/threonine kinase activator activity Source: BHF-UCL

GO - Biological processi

  • activation of protein kinase activity Source: UniProtKB
  • cell cycle arrest Source: Reactome
  • protein export from nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Cell cycle

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-HSA-380972. Energy dependent regulation of mTOR by LKB1-AMPK.
SignaLinkiQ7RTN6.
SIGNORiQ7RTN6.

Names & Taxonomyi

Protein namesi
Recommended name:
STE20-related kinase adapter protein alpha
Short name:
STRAD alpha
Alternative name(s):
STE20-related adapter protein
Serologically defined breast cancer antigen NY-BR-96
Gene namesi
Name:STRADA
Synonyms:LYK5Imported, STRAD
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:30172. STRADA.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • cytosol Source: Reactome
  • nucleoplasm Source: HPA
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Involvement in diseasei

A homozygous 7-kb deletion involving STRADA is a cause of a syndrome characterized by polyhydramnios, megalencephaly and symptomatic epilepsy.

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi185Y → F: Suppresses STK11/LKB1 activation without affecting complex assembly. 1 Publication1
Mutagenesisi231H → A: Inhibits interaction with STK11/LKB1; when associated with A-. 1 Publication1
Mutagenesisi233F → A: Inhibits interaction with STK11/LKB1; when associated with A-. 1 Publication1
Mutagenesisi241L → A: Inhibits interaction with STK11/LKB1. 1 Publication1
Mutagenesisi251Q → A: Inhibits interaction with STK11/LKB1. 1 Publication1
Mutagenesisi329T → A: Loss of STK11/LKB1-mediated phosphorylation. 1 Publication1
Mutagenesisi419T → A: Loss of STK11/LKB1-mediated phosphorylation. 1 Publication1

Organism-specific databases

DisGeNETi92335.
MalaCardsiSTRADA.
MIMi611087. phenotype.
OpenTargetsiENSG00000266173.
PharmGKBiPA164726342.

Chemistry databases

ChEMBLiCHEMBL1795198.

Polymorphism and mutation databases

BioMutaiSTRADA.
DMDMi74759034.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002600351 – 431STE20-related kinase adapter protein alphaAdd BLAST431

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2PhosphoserineCombined sources1
Modified residuei46PhosphoserineCombined sources1
Modified residuei329Phosphothreonine; by LKB11 Publication1
Modified residuei419Phosphothreonine; by LKB11 Publication1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ7RTN6.
MaxQBiQ7RTN6.
PaxDbiQ7RTN6.
PeptideAtlasiQ7RTN6.
PRIDEiQ7RTN6.
TopDownProteomicsiQ7RTN6-4. [Q7RTN6-4]

PTM databases

iPTMnetiQ7RTN6.
PhosphoSitePlusiQ7RTN6.

Expressioni

Gene expression databases

BgeeiENSG00000266173.
CleanExiHS_STRADA.
ExpressionAtlasiQ7RTN6. baseline and differential.
GenevisibleiQ7RTN6. HS.

Organism-specific databases

HPAiHPA031637.

Interactioni

Subunit structurei

Component of a trimeric complex composed of STK11/LKB1, STRAD (STRADA or STRADB) and CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta): the complex tethers STK11/LKB1 in the cytoplasm and stimulates its catalytic activity.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CAB39Q9Y3763EBI-1109114,EBI-306905
STK11Q1583112EBI-1109114,EBI-306838

GO - Molecular functioni

  • kinase binding Source: BHF-UCL

Protein-protein interaction databases

BioGridi124934. 10 interactors.
DIPiDIP-35775N.
IntActiQ7RTN6. 3 interactors.
MINTiMINT-1338485.
STRINGi9606.ENSP00000336655.

Structurei

Secondary structure

1431
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi66 – 68Combined sources3
Beta strandi69 – 78Combined sources10
Turni79 – 82Combined sources4
Beta strandi83 – 90Combined sources8
Turni91 – 93Combined sources3
Beta strandi96 – 103Combined sources8
Helixi104 – 106Combined sources3
Helixi109 – 124Combined sources16
Beta strandi133 – 139Combined sources7
Beta strandi142 – 148Combined sources7
Helixi155 – 161Combined sources7
Helixi169 – 188Combined sources20
Helixi198 – 200Combined sources3
Beta strandi201 – 203Combined sources3
Beta strandi209 – 211Combined sources3
Helixi214 – 216Combined sources3
Helixi241 – 243Combined sources3
Helixi246 – 249Combined sources4
Helixi259 – 274Combined sources16
Turni278 – 281Combined sources4
Helixi287 – 290Combined sources4
Helixi350 – 359Combined sources10
Turni364 – 366Combined sources3
Helixi370 – 373Combined sources4
Helixi377 – 381Combined sources5
Helixi386 – 388Combined sources3
Helixi390 – 393Combined sources4
Turni394 – 396Combined sources3
Helixi406 – 409Combined sources4
Beta strandi414 – 416Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1UPKX-ray1.85B420-431[»]
2WTKX-ray2.65B/E59-431[»]
3GNIX-ray2.35B59-431[»]
ProteinModelPortaliQ7RTN6.
SMRiQ7RTN6.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ7RTN6.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini69 – 379Protein kinasePROSITE-ProRule annotationAdd BLAST311

Domaini

The protein kinase domain is predicted to be catalytically inactive.Sequence analysis

Sequence similaritiesi

Contains 1 protein kinase domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0582. Eukaryota.
ENOG410XSWS. LUCA.
GeneTreeiENSGT00860000133680.
HOGENOMiHOG000237355.
HOVERGENiHBG055069.
InParanoidiQ7RTN6.
KOiK08271.
OMAiQEIMSSF.
OrthoDBiEOG091G0E7D.
PhylomeDBiQ7RTN6.
TreeFamiTF319817.

Family and domain databases

InterProiIPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
[Graphical view]
PfamiPF00069. Pkinase. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 2 hits.
PROSITEiPS50011. PROTEIN_KINASE_DOM. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q7RTN6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSFLVSKPER IRRWVSEKFI VEGLRDLELF GEQPPGDTRR KTNDASSESI
60 70 80 90 100
ASFSKQEVMS SFLPEGGCYE LLTVIGKGFE DLMTVNLARY KPTGEYVTVR
110 120 130 140 150
RINLEACSNE MVTFLQGELH VSKLFNHPNI VPYRATFIAD NELWVVTSFM
160 170 180 190 200
AYGSAKDLIC THFMDGMNEL AIAYILQGVL KALDYIHHMG YVHRSVKASH
210 220 230 240 250
ILISVDGKVY LSGLRSNLSM ISHGQRQRVV HDFPKYSVKV LPWLSPEVLQ
260 270 280 290 300
QNLQGYDAKS DIYSVGITAC ELANGHVPFK DMPATQMLLE KLNGTVPCLL
310 320 330 340 350
DTSTIPAEEL TMSPSRSVAN SGLSDSLTTS TPRPSNGDSP SHPYHRTFSP
360 370 380 390 400
HFHHFVEQCL QRNPDARPSA STLLNHSFFK QIKRRASEAL PELLRPVTPI
410 420 430
TNFEGSQSQD HSGIFGLVTN LEELEVDDWE F
Length:431
Mass (Da):48,369
Last modified:December 15, 2003 - v1
Checksum:i9CC0A78D9CC6FC2C
GO
Isoform 22 Publications (identifier: Q7RTN6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     5-41: Missing.
     368-417: PSASTLLNHSFFKQIKRRASEALPELLRPVTPITNFEGSQSQDHSGIFGL → YPCWPGPGLRESRGCSGG
     418-431: Missing.

Show »
Length:348
Mass (Da):38,597
Checksum:iB4A9F1EDE0E86EF4
GO
Isoform 31 Publication (identifier: Q7RTN6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     5-41: Missing.

Show »
Length:394
Mass (Da):43,962
Checksum:i35C80CA906403ADC
GO
Isoform 4 (identifier: Q7RTN6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     32-75: Missing.
     338-431: DSPSHPYHRT...EELEVDDWEF → PVPAPS

Note: No experimental confirmation available.
Show »
Length:299
Mass (Da):33,277
Checksum:i164D23B3189837FC
GO
Isoform 5 (identifier: Q7RTN6-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-58: Missing.

Show »
Length:373
Mass (Da):41,701
Checksum:i3E2837347D7BC42C
GO
Isoform 6 (identifier: Q7RTN6-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     13-41: Missing.
     338-431: DSPSHPYHRT...EELEVDDWEF → PVPAPS

Note: No experimental confirmation available.
Show »
Length:314
Mass (Da):34,625
Checksum:i12F519738B45CDF6
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti163F → S in BAG62879 (PubMed:14702039).Curated1
Sequence conflicti339S → W in AAG48269 (PubMed:12747765).Curated1
Sequence conflicti363N → H in BAC11349 (PubMed:14702039).Curated1
Sequence conflicti388E → K in AAG48269 (PubMed:12747765).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04137713R → W.1 PublicationCorresponds to variant rs35808156dbSNPEnsembl.1
Natural variantiVAR_04137860S → I.1 PublicationCorresponds to variant rs56271007dbSNPEnsembl.1
Natural variantiVAR_04137964P → S.1 PublicationCorresponds to variant rs55695051dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0442781 – 58Missing in isoform 5. 1 PublicationAdd BLAST58
Alternative sequenceiVSP_0522195 – 41Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST37
Alternative sequenceiVSP_04471713 – 41Missing in isoform 6. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_04370732 – 75Missing in isoform 4. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_043708338 – 431DSPSH…DDWEF → PVPAPS in isoform 4 and isoform 6. 1 PublicationAdd BLAST94
Alternative sequenceiVSP_052220368 – 417PSAST…GIFGL → YPCWPGPGLRESRGCSGG in isoform 2. 2 PublicationsAdd BLAST50
Alternative sequenceiVSP_052221418 – 431Missing in isoform 2. 2 PublicationsAdd BLAST14

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF308302 mRNA. Translation: AAG48269.1.
AY290821 mRNA. Translation: AAP42280.1.
AK074771 mRNA. Translation: BAC11197.1.
AK075005 mRNA. Translation: BAC11349.1.
AK293160 mRNA. Translation: BAG56704.1.
AK301331 mRNA. Translation: BAG62879.1.
AL832407 mRNA. Translation: CAI46194.1.
AC015651 Genomic DNA. No translation available.
AC046185 Genomic DNA. No translation available.
CH471109 Genomic DNA. Translation: EAW94283.1.
BK001542 mRNA. Translation: DAA01797.1.
CCDSiCCDS11642.1. [Q7RTN6-2]
CCDS32703.1. [Q7RTN6-1]
CCDS42367.1. [Q7RTN6-5]
CCDS54156.1. [Q7RTN6-4]
CCDS58585.1. [Q7RTN6-6]
RefSeqiNP_001003786.1. NM_001003786.2. [Q7RTN6-3]
NP_001003787.1. NM_001003787.2. [Q7RTN6-1]
NP_001003788.1. NM_001003788.2. [Q7RTN6-5]
NP_001159441.1. NM_001165969.1. [Q7RTN6-6]
NP_001159442.1. NM_001165970.1. [Q7RTN6-4]
NP_699166.2. NM_153335.5. [Q7RTN6-2]
XP_005257856.1. XM_005257799.2. [Q7RTN6-5]
UniGeneiHs.514402.

Genome annotation databases

EnsembliENST00000336174; ENSP00000336655; ENSG00000266173. [Q7RTN6-1]
ENST00000375840; ENSP00000365000; ENSG00000266173. [Q7RTN6-5]
ENST00000392950; ENSP00000376677; ENSG00000266173. [Q7RTN6-2]
ENST00000447001; ENSP00000398841; ENSG00000266173. [Q7RTN6-4]
ENST00000582137; ENSP00000462922; ENSG00000266173. [Q7RTN6-6]
GeneIDi92335.
KEGGihsa:92335.
UCSCiuc002jbm.4. human. [Q7RTN6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF308302 mRNA. Translation: AAG48269.1.
AY290821 mRNA. Translation: AAP42280.1.
AK074771 mRNA. Translation: BAC11197.1.
AK075005 mRNA. Translation: BAC11349.1.
AK293160 mRNA. Translation: BAG56704.1.
AK301331 mRNA. Translation: BAG62879.1.
AL832407 mRNA. Translation: CAI46194.1.
AC015651 Genomic DNA. No translation available.
AC046185 Genomic DNA. No translation available.
CH471109 Genomic DNA. Translation: EAW94283.1.
BK001542 mRNA. Translation: DAA01797.1.
CCDSiCCDS11642.1. [Q7RTN6-2]
CCDS32703.1. [Q7RTN6-1]
CCDS42367.1. [Q7RTN6-5]
CCDS54156.1. [Q7RTN6-4]
CCDS58585.1. [Q7RTN6-6]
RefSeqiNP_001003786.1. NM_001003786.2. [Q7RTN6-3]
NP_001003787.1. NM_001003787.2. [Q7RTN6-1]
NP_001003788.1. NM_001003788.2. [Q7RTN6-5]
NP_001159441.1. NM_001165969.1. [Q7RTN6-6]
NP_001159442.1. NM_001165970.1. [Q7RTN6-4]
NP_699166.2. NM_153335.5. [Q7RTN6-2]
XP_005257856.1. XM_005257799.2. [Q7RTN6-5]
UniGeneiHs.514402.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1UPKX-ray1.85B420-431[»]
2WTKX-ray2.65B/E59-431[»]
3GNIX-ray2.35B59-431[»]
ProteinModelPortaliQ7RTN6.
SMRiQ7RTN6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124934. 10 interactors.
DIPiDIP-35775N.
IntActiQ7RTN6. 3 interactors.
MINTiMINT-1338485.
STRINGi9606.ENSP00000336655.

Chemistry databases

ChEMBLiCHEMBL1795198.

PTM databases

iPTMnetiQ7RTN6.
PhosphoSitePlusiQ7RTN6.

Polymorphism and mutation databases

BioMutaiSTRADA.
DMDMi74759034.

Proteomic databases

EPDiQ7RTN6.
MaxQBiQ7RTN6.
PaxDbiQ7RTN6.
PeptideAtlasiQ7RTN6.
PRIDEiQ7RTN6.
TopDownProteomicsiQ7RTN6-4. [Q7RTN6-4]

Protocols and materials databases

DNASUi92335.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000336174; ENSP00000336655; ENSG00000266173. [Q7RTN6-1]
ENST00000375840; ENSP00000365000; ENSG00000266173. [Q7RTN6-5]
ENST00000392950; ENSP00000376677; ENSG00000266173. [Q7RTN6-2]
ENST00000447001; ENSP00000398841; ENSG00000266173. [Q7RTN6-4]
ENST00000582137; ENSP00000462922; ENSG00000266173. [Q7RTN6-6]
GeneIDi92335.
KEGGihsa:92335.
UCSCiuc002jbm.4. human. [Q7RTN6-1]

Organism-specific databases

CTDi92335.
DisGeNETi92335.
GeneCardsiSTRADA.
HGNCiHGNC:30172. STRADA.
HPAiHPA031637.
MalaCardsiSTRADA.
MIMi608626. gene.
611087. phenotype.
neXtProtiNX_Q7RTN6.
OpenTargetsiENSG00000266173.
PharmGKBiPA164726342.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0582. Eukaryota.
ENOG410XSWS. LUCA.
GeneTreeiENSGT00860000133680.
HOGENOMiHOG000237355.
HOVERGENiHBG055069.
InParanoidiQ7RTN6.
KOiK08271.
OMAiQEIMSSF.
OrthoDBiEOG091G0E7D.
PhylomeDBiQ7RTN6.
TreeFamiTF319817.

Enzyme and pathway databases

ReactomeiR-HSA-380972. Energy dependent regulation of mTOR by LKB1-AMPK.
SignaLinkiQ7RTN6.
SIGNORiQ7RTN6.

Miscellaneous databases

ChiTaRSiSTRADA. human.
EvolutionaryTraceiQ7RTN6.
GeneWikiiLYK5.
GenomeRNAii92335.
PROiQ7RTN6.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000266173.
CleanExiHS_STRADA.
ExpressionAtlasiQ7RTN6. baseline and differential.
GenevisibleiQ7RTN6. HS.

Family and domain databases

InterProiIPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
[Graphical view]
PfamiPF00069. Pkinase. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 2 hits.
PROSITEiPS50011. PROTEIN_KINASE_DOM. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSTRAA_HUMAN
AccessioniPrimary (citable) accession number: Q7RTN6
Secondary accession number(s): B4DDE3
, B4DW17, J3KTC9, Q5JPI2, Q7Z4K9, Q8NC31, Q8NCF1, Q9H272
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: December 15, 2003
Last modified: November 30, 2016
This is version 130 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.