Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q7RTN6

- STRAA_HUMAN

UniProt

Q7RTN6 - STRAA_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

STE20-related kinase adapter protein alpha

Gene

STRADA

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Pseudokinase which, in complex with CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta), binds to and activates STK11/LKB1. Adopts a closed conformation typical of active protein kinases and binds STK11/LKB1 as a pseudosubstrate, promoting conformational change of STK11/LKB1 in an active conformation.3 Publications

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. kinase binding Source: BHF-UCL
  3. protein kinase activator activity Source: UniProtKB
  4. transferase activity, transferring phosphorus-containing groups Source: InterPro

GO - Biological processi

  1. activation of protein kinase activity Source: UniProtKB
  2. cell cycle arrest Source: Reactome
  3. insulin receptor signaling pathway Source: Reactome
  4. protein export from nucleus Source: UniProtKB
  5. protein phosphorylation Source: GOC
Complete GO annotation...

Keywords - Biological processi

Cell cycle

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiREACT_21285. Regulation of AMPK activity via LKB1.
SignaLinkiQ7RTN6.

Names & Taxonomyi

Protein namesi
Recommended name:
STE20-related kinase adapter protein alpha
Short name:
STRAD alpha
Alternative name(s):
STE20-related adapter protein
Serologically defined breast cancer antigen NY-BR-96
Gene namesi
Name:STRADA
Synonyms:LYK5Imported, STRAD
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:30172. STRADA.

Subcellular locationi

Nucleus 2 Publications. Cytoplasm 2 Publications

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
  2. cytosol Source: Reactome
  3. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Involvement in diseasei

A homozygous 7-kb deletion involving STRADA is a cause of a syndrome characterized by polyhydramnios, megalencephaly and symptomatic epilepsy.

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi185 – 1851Y → F: Suppresses STK11/LKB1 activation without affecting complex assembly. 1 Publication
Mutagenesisi231 – 2311H → A: Inhibits interaction with STK11/LKB1; when associated with A-. 1 Publication
Mutagenesisi233 – 2331F → A: Inhibits interaction with STK11/LKB1; when associated with A-. 1 Publication
Mutagenesisi241 – 2411L → A: Inhibits interaction with STK11/LKB1. 1 Publication
Mutagenesisi251 – 2511Q → A: Inhibits interaction with STK11/LKB1. 1 Publication
Mutagenesisi329 – 3291T → A: Loss of STK11/LKB1-mediated phosphorylation. 1 Publication
Mutagenesisi419 – 4191T → A: Loss of STK11/LKB1-mediated phosphorylation. 1 Publication

Organism-specific databases

MIMi611087. phenotype.
PharmGKBiPA164726342.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 431431STE20-related kinase adapter protein alphaPRO_0000260035Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei329 – 3291Phosphothreonine; by LKB11 Publication
Modified residuei419 – 4191Phosphothreonine; by LKB11 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ7RTN6.
PaxDbiQ7RTN6.
PRIDEiQ7RTN6.

PTM databases

PhosphoSiteiQ7RTN6.

Expressioni

Gene expression databases

BgeeiQ7RTN6.
CleanExiHS_STRADA.
ExpressionAtlasiQ7RTN6. baseline and differential.
GenevestigatoriQ7RTN6.

Organism-specific databases

HPAiHPA031637.

Interactioni

Subunit structurei

Component of a trimeric complex composed of STK11/LKB1, STRAD (STRADA or STRADB) and CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta): the complex tethers STK11/LKB1 in the cytoplasm and stimulates its catalytic activity.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CAB39Q9Y3763EBI-1109114,EBI-306905
STK11Q1583110EBI-1109114,EBI-306838

Protein-protein interaction databases

BioGridi124934. 8 interactions.
DIPiDIP-35775N.
IntActiQ7RTN6. 2 interactions.
MINTiMINT-1338485.
STRINGi9606.ENSP00000336655.

Structurei

Secondary structure

1
431
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi66 – 683Combined sources
Beta strandi69 – 7810Combined sources
Turni79 – 824Combined sources
Beta strandi83 – 908Combined sources
Turni91 – 933Combined sources
Beta strandi96 – 1038Combined sources
Helixi104 – 1063Combined sources
Helixi109 – 12416Combined sources
Beta strandi133 – 1397Combined sources
Beta strandi142 – 1487Combined sources
Helixi155 – 1617Combined sources
Helixi169 – 18820Combined sources
Helixi198 – 2003Combined sources
Beta strandi201 – 2033Combined sources
Beta strandi209 – 2113Combined sources
Helixi214 – 2163Combined sources
Helixi241 – 2433Combined sources
Helixi246 – 2494Combined sources
Helixi259 – 27416Combined sources
Turni278 – 2814Combined sources
Helixi287 – 2904Combined sources
Helixi350 – 35910Combined sources
Turni364 – 3663Combined sources
Helixi370 – 3734Combined sources
Helixi377 – 3815Combined sources
Helixi386 – 3883Combined sources
Helixi390 – 3934Combined sources
Turni394 – 3963Combined sources
Helixi406 – 4094Combined sources
Beta strandi414 – 4163Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1UPKX-ray1.85B420-431[»]
2WTKX-ray2.65B/E59-431[»]
3GNIX-ray2.35B59-431[»]
ProteinModelPortaliQ7RTN6.
SMRiQ7RTN6. Positions 60-431.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ7RTN6.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini69 – 379311Protein kinasePROSITE-ProRule annotationAdd
BLAST

Domaini

The protein kinase domain is predicted to be catalytically inactive.Sequence Analysis

Sequence similaritiesi

Contains 1 protein kinase domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiCOG0515.
GeneTreeiENSGT00680000099731.
HOGENOMiHOG000237355.
HOVERGENiHBG055069.
InParanoidiQ7RTN6.
KOiK08271.
OMAiFFKQIKR.
PhylomeDBiQ7RTN6.
TreeFamiTF319817.

Family and domain databases

InterProiIPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
[Graphical view]
PfamiPF00069. Pkinase. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 2 hits.
PROSITEiPS50011. PROTEIN_KINASE_DOM. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 11 Publication (identifier: Q7RTN6-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSFLVSKPER IRRWVSEKFI VEGLRDLELF GEQPPGDTRR KTNDASSESI
60 70 80 90 100
ASFSKQEVMS SFLPEGGCYE LLTVIGKGFE DLMTVNLARY KPTGEYVTVR
110 120 130 140 150
RINLEACSNE MVTFLQGELH VSKLFNHPNI VPYRATFIAD NELWVVTSFM
160 170 180 190 200
AYGSAKDLIC THFMDGMNEL AIAYILQGVL KALDYIHHMG YVHRSVKASH
210 220 230 240 250
ILISVDGKVY LSGLRSNLSM ISHGQRQRVV HDFPKYSVKV LPWLSPEVLQ
260 270 280 290 300
QNLQGYDAKS DIYSVGITAC ELANGHVPFK DMPATQMLLE KLNGTVPCLL
310 320 330 340 350
DTSTIPAEEL TMSPSRSVAN SGLSDSLTTS TPRPSNGDSP SHPYHRTFSP
360 370 380 390 400
HFHHFVEQCL QRNPDARPSA STLLNHSFFK QIKRRASEAL PELLRPVTPI
410 420 430
TNFEGSQSQD HSGIFGLVTN LEELEVDDWE F
Length:431
Mass (Da):48,369
Last modified:December 15, 2003 - v1
Checksum:i9CC0A78D9CC6FC2C
GO
Isoform 22 Publications (identifier: Q7RTN6-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     5-41: Missing.
     368-417: PSASTLLNHSFFKQIKRRASEALPELLRPVTPITNFEGSQSQDHSGIFGL → YPCWPGPGLRESRGCSGG
     418-431: Missing.

Show »
Length:348
Mass (Da):38,597
Checksum:iB4A9F1EDE0E86EF4
GO
Isoform 31 Publication (identifier: Q7RTN6-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     5-41: Missing.

Show »
Length:394
Mass (Da):43,962
Checksum:i35C80CA906403ADC
GO
Isoform 4 (identifier: Q7RTN6-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     32-75: Missing.
     338-431: DSPSHPYHRT...EELEVDDWEF → PVPAPS

Note: No experimental confirmation available.

Show »
Length:299
Mass (Da):33,277
Checksum:i164D23B3189837FC
GO
Isoform 5 (identifier: Q7RTN6-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-58: Missing.

Show »
Length:373
Mass (Da):41,701
Checksum:i3E2837347D7BC42C
GO
Isoform 6 (identifier: Q7RTN6-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     13-41: Missing.
     338-431: DSPSHPYHRT...EELEVDDWEF → PVPAPS

Note: No experimental confirmation available.

Show »
Length:314
Mass (Da):34,625
Checksum:i12F519738B45CDF6
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti163 – 1631F → S in BAG62879. (PubMed:14702039)Curated
Sequence conflicti339 – 3391S → W in AAG48269. (PubMed:12747765)Curated
Sequence conflicti363 – 3631N → H in BAC11349. (PubMed:14702039)Curated
Sequence conflicti388 – 3881E → K in AAG48269. (PubMed:12747765)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti13 – 131R → W.1 Publication
Corresponds to variant rs35808156 [ dbSNP | Ensembl ].
VAR_041377
Natural varianti60 – 601S → I.1 Publication
Corresponds to variant rs56271007 [ dbSNP | Ensembl ].
VAR_041378
Natural varianti64 – 641P → S.1 Publication
Corresponds to variant rs55695051 [ dbSNP | Ensembl ].
VAR_041379

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5858Missing in isoform 5. 1 PublicationVSP_044278Add
BLAST
Alternative sequencei5 – 4137Missing in isoform 2 and isoform 3. 2 PublicationsVSP_052219Add
BLAST
Alternative sequencei13 – 4129Missing in isoform 6. 1 PublicationVSP_044717Add
BLAST
Alternative sequencei32 – 7544Missing in isoform 4. 1 PublicationVSP_043707Add
BLAST
Alternative sequencei338 – 43194DSPSH…DDWEF → PVPAPS in isoform 4 and isoform 6. 1 PublicationVSP_043708Add
BLAST
Alternative sequencei368 – 41750PSAST…GIFGL → YPCWPGPGLRESRGCSGG in isoform 2. 2 PublicationsVSP_052220Add
BLAST
Alternative sequencei418 – 43114Missing in isoform 2. 2 PublicationsVSP_052221Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF308302 mRNA. Translation: AAG48269.1.
AY290821 mRNA. Translation: AAP42280.1.
AK074771 mRNA. Translation: BAC11197.1.
AK075005 mRNA. Translation: BAC11349.1.
AK293160 mRNA. Translation: BAG56704.1.
AK301331 mRNA. Translation: BAG62879.1.
AL832407 mRNA. Translation: CAI46194.1.
AC015651 Genomic DNA. No translation available.
AC046185 Genomic DNA. No translation available.
CH471109 Genomic DNA. Translation: EAW94283.1.
BK001542 mRNA. Translation: DAA01797.1.
CCDSiCCDS11642.1. [Q7RTN6-2]
CCDS32703.1. [Q7RTN6-1]
CCDS42367.1. [Q7RTN6-5]
CCDS54156.1. [Q7RTN6-4]
CCDS58585.1. [Q7RTN6-6]
RefSeqiNP_001003786.1. NM_001003786.2. [Q7RTN6-3]
NP_001003787.1. NM_001003787.2. [Q7RTN6-1]
NP_001003788.1. NM_001003788.2. [Q7RTN6-5]
NP_001159441.1. NM_001165969.1. [Q7RTN6-6]
NP_001159442.1. NM_001165970.1. [Q7RTN6-4]
NP_699166.2. NM_153335.5. [Q7RTN6-2]
XP_005257856.1. XM_005257799.1. [Q7RTN6-5]
UniGeneiHs.514402.

Genome annotation databases

EnsembliENST00000336174; ENSP00000336655; ENSG00000266173. [Q7RTN6-1]
ENST00000375840; ENSP00000365000; ENSG00000266173. [Q7RTN6-5]
ENST00000392950; ENSP00000376677; ENSG00000266173. [Q7RTN6-2]
ENST00000447001; ENSP00000398841; ENSG00000266173. [Q7RTN6-4]
ENST00000582137; ENSP00000462922; ENSG00000266173. [Q7RTN6-6]
GeneIDi92335.
KEGGihsa:92335.
UCSCiuc002jbm.3. human. [Q7RTN6-1]
uc002jbo.3. human. [Q7RTN6-3]
uc002jbp.3. human. [Q7RTN6-2]
uc010wpq.2. human. [Q7RTN6-4]

Polymorphism databases

DMDMi74759034.

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF308302 mRNA. Translation: AAG48269.1 .
AY290821 mRNA. Translation: AAP42280.1 .
AK074771 mRNA. Translation: BAC11197.1 .
AK075005 mRNA. Translation: BAC11349.1 .
AK293160 mRNA. Translation: BAG56704.1 .
AK301331 mRNA. Translation: BAG62879.1 .
AL832407 mRNA. Translation: CAI46194.1 .
AC015651 Genomic DNA. No translation available.
AC046185 Genomic DNA. No translation available.
CH471109 Genomic DNA. Translation: EAW94283.1 .
BK001542 mRNA. Translation: DAA01797.1 .
CCDSi CCDS11642.1. [Q7RTN6-2 ]
CCDS32703.1. [Q7RTN6-1 ]
CCDS42367.1. [Q7RTN6-5 ]
CCDS54156.1. [Q7RTN6-4 ]
CCDS58585.1. [Q7RTN6-6 ]
RefSeqi NP_001003786.1. NM_001003786.2. [Q7RTN6-3 ]
NP_001003787.1. NM_001003787.2. [Q7RTN6-1 ]
NP_001003788.1. NM_001003788.2. [Q7RTN6-5 ]
NP_001159441.1. NM_001165969.1. [Q7RTN6-6 ]
NP_001159442.1. NM_001165970.1. [Q7RTN6-4 ]
NP_699166.2. NM_153335.5. [Q7RTN6-2 ]
XP_005257856.1. XM_005257799.1. [Q7RTN6-5 ]
UniGenei Hs.514402.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1UPK X-ray 1.85 B 420-431 [» ]
2WTK X-ray 2.65 B/E 59-431 [» ]
3GNI X-ray 2.35 B 59-431 [» ]
ProteinModelPortali Q7RTN6.
SMRi Q7RTN6. Positions 60-431.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 124934. 8 interactions.
DIPi DIP-35775N.
IntActi Q7RTN6. 2 interactions.
MINTi MINT-1338485.
STRINGi 9606.ENSP00000336655.

Chemistry

ChEMBLi CHEMBL1795198.

PTM databases

PhosphoSitei Q7RTN6.

Polymorphism databases

DMDMi 74759034.

Proteomic databases

MaxQBi Q7RTN6.
PaxDbi Q7RTN6.
PRIDEi Q7RTN6.

Protocols and materials databases

DNASUi 92335.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000336174 ; ENSP00000336655 ; ENSG00000266173 . [Q7RTN6-1 ]
ENST00000375840 ; ENSP00000365000 ; ENSG00000266173 . [Q7RTN6-5 ]
ENST00000392950 ; ENSP00000376677 ; ENSG00000266173 . [Q7RTN6-2 ]
ENST00000447001 ; ENSP00000398841 ; ENSG00000266173 . [Q7RTN6-4 ]
ENST00000582137 ; ENSP00000462922 ; ENSG00000266173 . [Q7RTN6-6 ]
GeneIDi 92335.
KEGGi hsa:92335.
UCSCi uc002jbm.3. human. [Q7RTN6-1 ]
uc002jbo.3. human. [Q7RTN6-3 ]
uc002jbp.3. human. [Q7RTN6-2 ]
uc010wpq.2. human. [Q7RTN6-4 ]

Organism-specific databases

CTDi 92335.
GeneCardsi GC17M061780.
HGNCi HGNC:30172. STRADA.
HPAi HPA031637.
MIMi 608626. gene.
611087. phenotype.
neXtProti NX_Q7RTN6.
PharmGKBi PA164726342.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0515.
GeneTreei ENSGT00680000099731.
HOGENOMi HOG000237355.
HOVERGENi HBG055069.
InParanoidi Q7RTN6.
KOi K08271.
OMAi FFKQIKR.
PhylomeDBi Q7RTN6.
TreeFami TF319817.

Enzyme and pathway databases

Reactomei REACT_21285. Regulation of AMPK activity via LKB1.
SignaLinki Q7RTN6.

Miscellaneous databases

ChiTaRSi STRADA. human.
EvolutionaryTracei Q7RTN6.
GeneWikii LYK5.
GenomeRNAii 92335.
NextBioi 35536174.
PROi Q7RTN6.
SOURCEi Search...

Gene expression databases

Bgeei Q7RTN6.
CleanExi HS_STRADA.
ExpressionAtlasi Q7RTN6. baseline and differential.
Genevestigatori Q7RTN6.

Family and domain databases

InterProi IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
[Graphical view ]
Pfami PF00069. Pkinase. 1 hit.
[Graphical view ]
SUPFAMi SSF56112. SSF56112. 2 hits.
PROSITEi PS50011. PROTEIN_KINASE_DOM. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Humoral immunity to human breast cancer: antigen definition and quantitative analysis of mRNA expression."
    Scanlan M.J., Gout I., Gordon C.M., Williamson B., Stockert E., Gure A.O., Jaeger D., Chen Y.-T., Mackay A., O'Hare M.J., Old L.J.
    Cancer Immun. 1:4-4(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Mammary tumorImported.
  2. "Cloning, characterization and localization of lyk5 gene."
    Shan Y.X., Huang C.Q., Yu L.
    Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 4 AND 6).
    Tissue: Synovium and TeratocarcinomaImportedCurated.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
    Tissue: Lymph node.
  5. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "Activation of the tumour suppressor kinase LKB1 by the STE20-like pseudokinase STRAD."
    Baas A.F., Boudeau J., Sapkota G.P., Smit L., Medema R., Morrice N.A., Alessi D.R., Clevers H.C.
    EMBO J. 22:3062-3072(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH STK11/LKB1, MUTAGENESIS OF THR-329 AND THR-419, PHOSPHORYLATION AT THR-329 AND THR-419.
  8. "MO25alpha/beta interact with STRADalpha/beta enhancing their ability to bind, activate and localize LKB1 in the cytoplasm."
    Boudeau J., Baas A.F., Deak M., Morrice N.A., Kieloch A., Schutkowski M., Prescott A.R., Clevers H.C., Alessi D.R.
    EMBO J. 22:5102-5114(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH STK11/LKB1 AND CAB39.
  9. "Polyhydramnios, megalencephaly and symptomatic epilepsy caused by a homozygous 7-kilobase deletion in LYK5."
    Puffenberger E.G., Strauss K.A., Ramsey K.E., Craig D.W., Stephan D.A., Robinson D.L., Hendrickson C.L., Gottlieb S., Ramsay D.A., Siu V.M., Heuer G.G., Crino P.B., Morton D.H.
    Brain 130:1929-1941(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: INVOLVEMENT IN PMSE.
  10. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  11. "Crystal structure of MO25 alpha in complex with the C-terminus of the pseudo kinase STE20-related adaptor."
    Milburn C.C., Boudeau J., Deak M., Alessi D.R., van Aalten D.M.
    Nat. Struct. Mol. Biol. 11:193-200(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.85 ANGSTROMS) IN COMPLEX WITH CAB39.
  12. "Structure of the LKB1-STRAD-MO25 complex reveals an allosteric mechanism of kinase activation."
    Zeqiraj E., Filippi B.M., Deak M., Alessi D.R., van Aalten D.M.
    Science 326:1707-1711(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.65 ANGSTROMS) OF 59-431 IN COMPLEX WITH STK11/LKB1 AND CAB39, IDENTIFICATION IN A COMPLEX WITH STK11/LKB1 AND CAB39, FUNCTION, MUTAGENESIS OF TYR-185; HIS-231; PHE-233; LEU-241 AND GLN-251.
  13. "Patterns of somatic mutation in human cancer genomes."
    Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
    , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
    Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS [LARGE SCALE ANALYSIS] TRP-13; ILE-60 AND SER-64.

Entry informationi

Entry nameiSTRAA_HUMAN
AccessioniPrimary (citable) accession number: Q7RTN6
Secondary accession number(s): B4DDE3
, B4DW17, J3KTC9, Q5JPI2, Q7Z4K9, Q8NC31, Q8NCF1, Q9H272
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: December 15, 2003
Last modified: November 26, 2014
This is version 108 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  7. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3