Reviewed,
UniProtKB/Swiss-Prot Q7RTN6 (STRAA_HUMAN)
Last modified
November 3, 2009.
Version 57.
History...
Clusters with 100%,
90%,
50% identity |
Documents (7) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: STE20-related kinase adapter protein alpha Short name=STRAD alpha Alternative name(s): STE20-related adapter protein Serologically defined breast cancer antigen NY-BR-96 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 431 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Pseudokinase which, in complex with CAB39, binds to and activates STK11. Relocates STK11 from the nucleus to the cytoplasm. Plays an essential role in STK11-mediated G1 cell cycle arrest. Ref.4 Ref.5 |
| Subcellular location | |
| Domain | The protein kinase domain is predicted to be catalytically inactive. |
| Involvement in disease | Deletions involving STRADA are the cause of polyhydramnios, megalencephaly, and symptomatic epilepsy syndrome (PMSE) [MIM:611087]. Affected children have large heads, infantile-onset intractable multifocal seizures and severe psychomotor retardation. Neuropathological studies reveal megalencephaly, ventriculomegaly, cytomegaly and extensive vacuolization and astrocytosis of white matter. Ref.7 |
| Sequence similarities | Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily. Contains 1 protein kinase domain. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 Ref.4 (identifier: Q7RTN6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 Ref.2 Ref.3 (identifier: Q7RTN6-2) The sequence of this isoform differs from the canonical sequence as follows: 5-41: Missing. 368-417: PSASTLLNHSFFKQIKRRASEALPELLRPVTPITNFEGSQSQDHSGIFGL → YPCWPGPGLRESRGCSGG 418-431: Missing. | ||||||
| Isoform 3 Ref.3 (identifier: Q7RTN6-3) The sequence of this isoform differs from the canonical sequence as follows: 5-41: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 431 | 431 | STE20-related kinase adapter protein alpha | PRO_0000260035 | |||||
Regions | |||||||||
| Domain | 69 – 379 | 311 | Protein kinase | ||||||
Amino acid modifications | |||||||||
| Modified residue | 329 | 1 | Phosphothreonine; by STK11 Ref.4 | ||||||
| Modified residue | 419 | 1 | Phosphothreonine; by STK11 Ref.4 | ||||||
Natural variations | |||||||||
| Alternative sequence | 5 – 41 | 37 | Missing in isoform 2 and isoform 3. Ref.2 Ref.3 | VSP_052219 | |||||
| Alternative sequence | 368 – 417 | 50 | PSAST…GIFGL → YPCWPGPGLRESRGCSGG in isoform 2. Ref.3 | VSP_052220 | |||||
| Alternative sequence | 418 – 431 | 14 | Missing in isoform 2. Ref.3 | VSP_052221 | |||||
| Natural variant | 13 | 1 | R → W | VAR_041377 | |||||
| Natural variant | 60 | 1 | S → I | VAR_041378 | |||||
| Natural variant | 64 | 1 | P → S | VAR_041379 | |||||
Experimental info | |||||||||
| Mutagenesis | 329 | 1 | T → A: Loss of STK11-mediated phosphorylation. Ref.4 | ||||||
| Mutagenesis | 419 | 1 | T → A: Loss of STK11-mediated phosphorylation. Ref.4 | ||||||
| Sequence conflict | 339 | 1 | S → W in AAG48269. Ref.1 | ||||||
| Sequence conflict | 363 | 1 | N → H in BAC11349. Ref.3 | ||||||
| Sequence conflict | 388 | 1 | E → K in AAG48269. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Humoral immunity to human breast cancer: antigen definition and quantitative analysis of mRNA expression." Scanlan M.J., Gout I., Gordon C.M., Williamson B., Stockert E., Gure A.O., Jaeger D., Chen Y.-T., Mackay A., O'Hare M.J., Old L.J. Cancer Immun. 1:4-4(2001) [PubMed: 12747765] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Mammary tumor. |
| [2] | "Cloning, characterization and localization of lyk5 gene." Shan Y.X., Huang C.Q., Yu L. Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). Tissue: Teratocarcinoma. |
| [4] | "Activation of the tumour suppressor kinase LKB1 by the STE20-like pseudokinase STRAD." Baas A.F., Boudeau J., Sapkota G.P., Smit L., Medema R., Morrice N.A., Alessi D.R., Clevers H.C. EMBO J. 22:3062-3072(2003) [PubMed: 12805220] [Abstract] Cited for: IDENTIFICATION (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH STK11, MUTAGENESIS OF THR-329 AND THR-419, PHOSPHORYLATION AT THR-329 AND THR-419. |
| [5] | "MO25alpha/beta interact with STRADalpha/beta enhancing their ability to bind, activate and localize LKB1 in the cytoplasm." Boudeau J., Baas A.F., Deak M., Morrice N.A., Kieloch A., Schutkowski M., Prescott A.R., Clevers H.C., Alessi D.R. EMBO J. 22:5102-5114(2003) [PubMed: 14517248] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH STK11 AND CAB39. |
| [6] | "Crystal structure of MO25 alpha in complex with the C-terminus of the pseudo kinase STE20-related adaptor." Milburn C.C., Boudeau J., Deak M., Alessi D.R., van Aalten D.M. Nat. Struct. Mol. Biol. 11:193-200(2004) [PubMed: 14730349] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.85 ANGSTROMS) IN COMPLEX WITH CAB39. |
| [7] | "Polyhydramnios, megalencephaly and symptomatic epilepsy caused by a homozygous 7-kilobase deletion in LYK5." Puffenberger E.G., Strauss K.A., Ramsey K.E., Craig D.W., Stephan D.A., Robinson D.L., Hendrickson C.L., Gottlieb S., Ramsay D.A., Siu V.M., Heuer G.G., Crino P.B., Morton D.H. Brain 130:1929-1941(2007) [PubMed: 17522105] [Abstract] Cited for: INVOLVEMENT IN PMSE. |
| [8] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed: 17344846] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] TRP-13; ILE-60 AND SER-64. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| AF308302 mRNA. Translation: AAG48269.1. AY290821 mRNA. Translation: AAP42280.1. AK074771 mRNA. Translation: BAC11197.1. AK075005 mRNA. Translation: BAC11349.1. BK001542 mRNA. Translation: DAA01797.1. | |||||||||||||||||||
| IPI | IPI00300700. IPI00396083. IPI00456673. | ||||||||||||||||||
| RefSeq | NP_001003786.1. NP_001003787.1. NP_001003788.1. NP_699166.2. | ||||||||||||||||||
| UniGene | Hs.514402 | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| |||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | Q7RTN6. 1 interaction. | ||||||||||||||||||
| STRING | Q7RTN6. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q7RTN6. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PRIDE | Q7RTN6. | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000245865; ENSP00000245865; ENSG00000125695; Homo sapiens. [Genome view] ENST00000336174; ENSP00000336655; ENSG00000125695; Homo sapiens. [Genome view] ENST00000375840; ENSP00000365000; ENSG00000125695; Homo sapiens. [Genome view] ENST00000375841; ENSP00000365001; ENSG00000125695; Homo sapiens. [Genome view] ENST00000392950; ENSP00000376677; ENSG00000125695; Homo sapiens. [Genome view] ENST00000447001; ENSP00000398841; ENSG00000125695; Homo sapiens. [Genome view] | ||||||||||||||||||
| GeneID | 92335. | ||||||||||||||||||
| KEGG | hsa:92335. | ||||||||||||||||||
| UCSC | uc002jbm.1. human. uc002jbp.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 92335. | ||||||||||||||||||
| GeneCards | GC17M059134. | ||||||||||||||||||
| HGNC | HGNC:30172. STRADA. | ||||||||||||||||||
| MIM | 608626. gene. 611087. phenotype. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| HOVERGEN | Q7RTN6. | ||||||||||||||||||
| OMA | NGTVPCL. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| Reactome | REACT_1505. Integration of energy metabolism. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q7RTN6. | ||||||||||||||||||
| Bgee | Q7RTN6. | ||||||||||||||||||
| CleanEx | HS_STRADA. | ||||||||||||||||||
| Genevestigator | Q7RTN6. | ||||||||||||||||||
| GermOnline | ENSG00000125695. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR000719. Prot_kinase_core. IPR017442. Se/Thr_pkinase-rel. [Graphical view] | ||||||||||||||||||
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] | ||||||||||||||||||
| ProDom | PD000001. Prot_kinase. 1 hit. [Graphical view] [Entries sharing at least one domain] | ||||||||||||||||||
| PROSITE | PS50011. PROTEIN_KINASE_DOM. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other Resources | |||||||||||||||||||
| NextBio | 77700. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | STRAA_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q7RTN6 Secondary accession number(s): Q7Z4K9 Q9H272 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| SIMILARITY comments Index of protein domains and families |

Clusters with


