Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q7RTN6

- STRAA_HUMAN

UniProt

Q7RTN6 - STRAA_HUMAN

Protein

STE20-related kinase adapter protein alpha

Gene

STRADA

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 106 (01 Oct 2014)
      Sequence version 1 (15 Dec 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Pseudokinase which, in complex with CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta), binds to and activates STK11/LKB1. Adopts a closed conformation typical of active protein kinases and binds STK11/LKB1 as a pseudosubstrate, promoting conformational change of STK11/LKB1 in an active conformation.3 Publications

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. kinase binding Source: BHF-UCL
    3. protein binding Source: UniProtKB
    4. protein kinase activator activity Source: UniProtKB
    5. transferase activity, transferring phosphorus-containing groups Source: InterPro

    GO - Biological processi

    1. activation of protein kinase activity Source: UniProtKB
    2. cell cycle arrest Source: Reactome
    3. insulin receptor signaling pathway Source: Reactome
    4. protein export from nucleus Source: UniProtKB
    5. protein phosphorylation Source: GOC

    Keywords - Biological processi

    Cell cycle

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Enzyme and pathway databases

    ReactomeiREACT_21285. Regulation of AMPK activity via LKB1.
    SignaLinkiQ7RTN6.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    STE20-related kinase adapter protein alpha
    Short name:
    STRAD alpha
    Alternative name(s):
    STE20-related adapter protein
    Serologically defined breast cancer antigen NY-BR-96
    Gene namesi
    Name:STRADA
    Synonyms:LYK5Imported, STRAD
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 17

    Organism-specific databases

    HGNCiHGNC:30172. STRADA.

    Subcellular locationi

    Nucleus 2 Publications. Cytoplasm 2 Publications

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB
    2. cytosol Source: Reactome
    3. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Involvement in diseasei

    A homozygous 7-kb deletion involving STRADA is a cause of a syndrome characterized by polyhydramnios, megalencephaly and symptomatic epilepsy.

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi185 – 1851Y → F: Suppresses STK11/LKB1 activation without affecting complex assembly. 1 Publication
    Mutagenesisi231 – 2311H → A: Inhibits interaction with STK11/LKB1; when associated with A-. 1 Publication
    Mutagenesisi233 – 2331F → A: Inhibits interaction with STK11/LKB1; when associated with A-. 1 Publication
    Mutagenesisi241 – 2411L → A: Inhibits interaction with STK11/LKB1. 1 Publication
    Mutagenesisi251 – 2511Q → A: Inhibits interaction with STK11/LKB1. 1 Publication
    Mutagenesisi329 – 3291T → A: Loss of STK11/LKB1-mediated phosphorylation. 1 Publication
    Mutagenesisi419 – 4191T → A: Loss of STK11/LKB1-mediated phosphorylation. 1 Publication

    Organism-specific databases

    MIMi611087. phenotype.
    PharmGKBiPA164726342.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 431431STE20-related kinase adapter protein alphaPRO_0000260035Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei329 – 3291Phosphothreonine; by LKB11 Publication
    Modified residuei419 – 4191Phosphothreonine; by LKB11 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ7RTN6.
    PaxDbiQ7RTN6.
    PRIDEiQ7RTN6.

    PTM databases

    PhosphoSiteiQ7RTN6.

    Expressioni

    Gene expression databases

    ArrayExpressiQ7RTN6.
    BgeeiQ7RTN6.
    CleanExiHS_STRADA.
    GenevestigatoriQ7RTN6.

    Organism-specific databases

    HPAiHPA031637.

    Interactioni

    Subunit structurei

    Component of a trimeric complex composed of STK11/LKB1, STRAD (STRADA or STRADB) and CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta): the complex tethers STK11/LKB1 in the cytoplasm and stimulates its catalytic activity.2 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    CAB39Q9Y3763EBI-1109114,EBI-306905
    STK11Q1583110EBI-1109114,EBI-306838

    Protein-protein interaction databases

    BioGridi124934. 7 interactions.
    DIPiDIP-35775N.
    IntActiQ7RTN6. 2 interactions.
    MINTiMINT-1338485.
    STRINGi9606.ENSP00000336655.

    Structurei

    Secondary structure

    1
    431
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi66 – 683
    Beta strandi69 – 7810
    Turni79 – 824
    Beta strandi83 – 908
    Turni91 – 933
    Beta strandi96 – 1038
    Helixi104 – 1063
    Helixi109 – 12416
    Beta strandi133 – 1397
    Beta strandi142 – 1487
    Helixi155 – 1617
    Helixi169 – 18820
    Helixi198 – 2003
    Beta strandi201 – 2033
    Beta strandi209 – 2113
    Helixi214 – 2163
    Helixi241 – 2433
    Helixi246 – 2494
    Helixi259 – 27416
    Turni278 – 2814
    Helixi287 – 2904
    Helixi350 – 35910
    Turni364 – 3663
    Helixi370 – 3734
    Helixi377 – 3815
    Helixi386 – 3883
    Helixi390 – 3934
    Turni394 – 3963
    Helixi406 – 4094
    Beta strandi414 – 4163

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1UPKX-ray1.85B420-431[»]
    2WTKX-ray2.65B/E59-431[»]
    3GNIX-ray2.35B59-431[»]
    ProteinModelPortaliQ7RTN6.
    SMRiQ7RTN6. Positions 60-431.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ7RTN6.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini69 – 379311Protein kinasePROSITE-ProRule annotationAdd
    BLAST

    Domaini

    The protein kinase domain is predicted to be catalytically inactive.Sequence Analysis

    Sequence similaritiesi

    Contains 1 protein kinase domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiCOG0515.
    HOGENOMiHOG000237355.
    HOVERGENiHBG055069.
    InParanoidiQ7RTN6.
    KOiK08271.
    OMAiFFKQIKR.
    PhylomeDBiQ7RTN6.
    TreeFamiTF319817.

    Family and domain databases

    InterProiIPR011009. Kinase-like_dom.
    IPR000719. Prot_kinase_dom.
    [Graphical view]
    PfamiPF00069. Pkinase. 1 hit.
    [Graphical view]
    SUPFAMiSSF56112. SSF56112. 2 hits.
    PROSITEiPS50011. PROTEIN_KINASE_DOM. 1 hit.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 11 Publication (identifier: Q7RTN6-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSFLVSKPER IRRWVSEKFI VEGLRDLELF GEQPPGDTRR KTNDASSESI    50
    ASFSKQEVMS SFLPEGGCYE LLTVIGKGFE DLMTVNLARY KPTGEYVTVR 100
    RINLEACSNE MVTFLQGELH VSKLFNHPNI VPYRATFIAD NELWVVTSFM 150
    AYGSAKDLIC THFMDGMNEL AIAYILQGVL KALDYIHHMG YVHRSVKASH 200
    ILISVDGKVY LSGLRSNLSM ISHGQRQRVV HDFPKYSVKV LPWLSPEVLQ 250
    QNLQGYDAKS DIYSVGITAC ELANGHVPFK DMPATQMLLE KLNGTVPCLL 300
    DTSTIPAEEL TMSPSRSVAN SGLSDSLTTS TPRPSNGDSP SHPYHRTFSP 350
    HFHHFVEQCL QRNPDARPSA STLLNHSFFK QIKRRASEAL PELLRPVTPI 400
    TNFEGSQSQD HSGIFGLVTN LEELEVDDWE F 431
    Length:431
    Mass (Da):48,369
    Last modified:December 15, 2003 - v1
    Checksum:i9CC0A78D9CC6FC2C
    GO
    Isoform 22 Publications (identifier: Q7RTN6-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         5-41: Missing.
         368-417: PSASTLLNHSFFKQIKRRASEALPELLRPVTPITNFEGSQSQDHSGIFGL → YPCWPGPGLRESRGCSGG
         418-431: Missing.

    Show »
    Length:348
    Mass (Da):38,597
    Checksum:iB4A9F1EDE0E86EF4
    GO
    Isoform 31 Publication (identifier: Q7RTN6-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         5-41: Missing.

    Show »
    Length:394
    Mass (Da):43,962
    Checksum:i35C80CA906403ADC
    GO
    Isoform 4 (identifier: Q7RTN6-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         32-75: Missing.
         338-431: DSPSHPYHRT...EELEVDDWEF → PVPAPS

    Note: No experimental confirmation available.

    Show »
    Length:299
    Mass (Da):33,277
    Checksum:i164D23B3189837FC
    GO
    Isoform 5 (identifier: Q7RTN6-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-58: Missing.

    Show »
    Length:373
    Mass (Da):41,701
    Checksum:i3E2837347D7BC42C
    GO
    Isoform 6 (identifier: Q7RTN6-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         13-41: Missing.
         338-431: DSPSHPYHRT...EELEVDDWEF → PVPAPS

    Note: No experimental confirmation available.

    Show »
    Length:314
    Mass (Da):34,625
    Checksum:i12F519738B45CDF6
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti163 – 1631F → S in BAG62879. (PubMed:14702039)Curated
    Sequence conflicti339 – 3391S → W in AAG48269. (PubMed:12747765)Curated
    Sequence conflicti363 – 3631N → H in BAC11349. (PubMed:14702039)Curated
    Sequence conflicti388 – 3881E → K in AAG48269. (PubMed:12747765)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti13 – 131R → W.1 Publication
    Corresponds to variant rs35808156 [ dbSNP | Ensembl ].
    VAR_041377
    Natural varianti60 – 601S → I.1 Publication
    Corresponds to variant rs56271007 [ dbSNP | Ensembl ].
    VAR_041378
    Natural varianti64 – 641P → S.1 Publication
    Corresponds to variant rs55695051 [ dbSNP | Ensembl ].
    VAR_041379

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5858Missing in isoform 5. 1 PublicationVSP_044278Add
    BLAST
    Alternative sequencei5 – 4137Missing in isoform 2 and isoform 3. 2 PublicationsVSP_052219Add
    BLAST
    Alternative sequencei13 – 4129Missing in isoform 6. 1 PublicationVSP_044717Add
    BLAST
    Alternative sequencei32 – 7544Missing in isoform 4. 1 PublicationVSP_043707Add
    BLAST
    Alternative sequencei338 – 43194DSPSH…DDWEF → PVPAPS in isoform 4 and isoform 6. 1 PublicationVSP_043708Add
    BLAST
    Alternative sequencei368 – 41750PSAST…GIFGL → YPCWPGPGLRESRGCSGG in isoform 2. 2 PublicationsVSP_052220Add
    BLAST
    Alternative sequencei418 – 43114Missing in isoform 2. 2 PublicationsVSP_052221Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF308302 mRNA. Translation: AAG48269.1.
    AY290821 mRNA. Translation: AAP42280.1.
    AK074771 mRNA. Translation: BAC11197.1.
    AK075005 mRNA. Translation: BAC11349.1.
    AK293160 mRNA. Translation: BAG56704.1.
    AK301331 mRNA. Translation: BAG62879.1.
    AL832407 mRNA. Translation: CAI46194.1.
    AC015651 Genomic DNA. No translation available.
    AC046185 Genomic DNA. No translation available.
    CH471109 Genomic DNA. Translation: EAW94283.1.
    BK001542 mRNA. Translation: DAA01797.1.
    CCDSiCCDS11642.1. [Q7RTN6-2]
    CCDS32703.1. [Q7RTN6-1]
    CCDS42367.1. [Q7RTN6-5]
    CCDS54156.1. [Q7RTN6-4]
    CCDS58585.1. [Q7RTN6-6]
    RefSeqiNP_001003786.1. NM_001003786.2. [Q7RTN6-3]
    NP_001003787.1. NM_001003787.2. [Q7RTN6-1]
    NP_001003788.1. NM_001003788.2. [Q7RTN6-5]
    NP_001159441.1. NM_001165969.1. [Q7RTN6-6]
    NP_001159442.1. NM_001165970.1. [Q7RTN6-4]
    NP_699166.2. NM_153335.5. [Q7RTN6-2]
    XP_005257856.1. XM_005257799.1. [Q7RTN6-5]
    UniGeneiHs.514402.

    Genome annotation databases

    EnsembliENST00000336174; ENSP00000336655; ENSG00000266173. [Q7RTN6-1]
    ENST00000375840; ENSP00000365000; ENSG00000266173. [Q7RTN6-5]
    ENST00000392950; ENSP00000376677; ENSG00000266173. [Q7RTN6-2]
    ENST00000447001; ENSP00000398841; ENSG00000266173. [Q7RTN6-4]
    ENST00000582137; ENSP00000462922; ENSG00000266173. [Q7RTN6-6]
    GeneIDi92335.
    KEGGihsa:92335.
    UCSCiuc002jbm.3. human. [Q7RTN6-1]
    uc002jbo.3. human. [Q7RTN6-3]
    uc002jbp.3. human. [Q7RTN6-2]
    uc010wpq.2. human. [Q7RTN6-4]

    Polymorphism databases

    DMDMi74759034.

    Keywords - Coding sequence diversityi

    Alternative splicing, Chromosomal rearrangement, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF308302 mRNA. Translation: AAG48269.1 .
    AY290821 mRNA. Translation: AAP42280.1 .
    AK074771 mRNA. Translation: BAC11197.1 .
    AK075005 mRNA. Translation: BAC11349.1 .
    AK293160 mRNA. Translation: BAG56704.1 .
    AK301331 mRNA. Translation: BAG62879.1 .
    AL832407 mRNA. Translation: CAI46194.1 .
    AC015651 Genomic DNA. No translation available.
    AC046185 Genomic DNA. No translation available.
    CH471109 Genomic DNA. Translation: EAW94283.1 .
    BK001542 mRNA. Translation: DAA01797.1 .
    CCDSi CCDS11642.1. [Q7RTN6-2 ]
    CCDS32703.1. [Q7RTN6-1 ]
    CCDS42367.1. [Q7RTN6-5 ]
    CCDS54156.1. [Q7RTN6-4 ]
    CCDS58585.1. [Q7RTN6-6 ]
    RefSeqi NP_001003786.1. NM_001003786.2. [Q7RTN6-3 ]
    NP_001003787.1. NM_001003787.2. [Q7RTN6-1 ]
    NP_001003788.1. NM_001003788.2. [Q7RTN6-5 ]
    NP_001159441.1. NM_001165969.1. [Q7RTN6-6 ]
    NP_001159442.1. NM_001165970.1. [Q7RTN6-4 ]
    NP_699166.2. NM_153335.5. [Q7RTN6-2 ]
    XP_005257856.1. XM_005257799.1. [Q7RTN6-5 ]
    UniGenei Hs.514402.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1UPK X-ray 1.85 B 420-431 [» ]
    2WTK X-ray 2.65 B/E 59-431 [» ]
    3GNI X-ray 2.35 B 59-431 [» ]
    ProteinModelPortali Q7RTN6.
    SMRi Q7RTN6. Positions 60-431.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 124934. 7 interactions.
    DIPi DIP-35775N.
    IntActi Q7RTN6. 2 interactions.
    MINTi MINT-1338485.
    STRINGi 9606.ENSP00000336655.

    Chemistry

    ChEMBLi CHEMBL1795198.

    PTM databases

    PhosphoSitei Q7RTN6.

    Polymorphism databases

    DMDMi 74759034.

    Proteomic databases

    MaxQBi Q7RTN6.
    PaxDbi Q7RTN6.
    PRIDEi Q7RTN6.

    Protocols and materials databases

    DNASUi 92335.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000336174 ; ENSP00000336655 ; ENSG00000266173 . [Q7RTN6-1 ]
    ENST00000375840 ; ENSP00000365000 ; ENSG00000266173 . [Q7RTN6-5 ]
    ENST00000392950 ; ENSP00000376677 ; ENSG00000266173 . [Q7RTN6-2 ]
    ENST00000447001 ; ENSP00000398841 ; ENSG00000266173 . [Q7RTN6-4 ]
    ENST00000582137 ; ENSP00000462922 ; ENSG00000266173 . [Q7RTN6-6 ]
    GeneIDi 92335.
    KEGGi hsa:92335.
    UCSCi uc002jbm.3. human. [Q7RTN6-1 ]
    uc002jbo.3. human. [Q7RTN6-3 ]
    uc002jbp.3. human. [Q7RTN6-2 ]
    uc010wpq.2. human. [Q7RTN6-4 ]

    Organism-specific databases

    CTDi 92335.
    GeneCardsi GC17M061780.
    HGNCi HGNC:30172. STRADA.
    HPAi HPA031637.
    MIMi 608626. gene.
    611087. phenotype.
    neXtProti NX_Q7RTN6.
    PharmGKBi PA164726342.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0515.
    HOGENOMi HOG000237355.
    HOVERGENi HBG055069.
    InParanoidi Q7RTN6.
    KOi K08271.
    OMAi FFKQIKR.
    PhylomeDBi Q7RTN6.
    TreeFami TF319817.

    Enzyme and pathway databases

    Reactomei REACT_21285. Regulation of AMPK activity via LKB1.
    SignaLinki Q7RTN6.

    Miscellaneous databases

    ChiTaRSi STRADA. human.
    EvolutionaryTracei Q7RTN6.
    GeneWikii LYK5.
    GenomeRNAii 92335.
    NextBioi 35536174.
    PROi Q7RTN6.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q7RTN6.
    Bgeei Q7RTN6.
    CleanExi HS_STRADA.
    Genevestigatori Q7RTN6.

    Family and domain databases

    InterProi IPR011009. Kinase-like_dom.
    IPR000719. Prot_kinase_dom.
    [Graphical view ]
    Pfami PF00069. Pkinase. 1 hit.
    [Graphical view ]
    SUPFAMi SSF56112. SSF56112. 2 hits.
    PROSITEi PS50011. PROTEIN_KINASE_DOM. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Humoral immunity to human breast cancer: antigen definition and quantitative analysis of mRNA expression."
      Scanlan M.J., Gout I., Gordon C.M., Williamson B., Stockert E., Gure A.O., Jaeger D., Chen Y.-T., Mackay A., O'Hare M.J., Old L.J.
      Cancer Immun. 1:4-4(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Mammary tumorImported.
    2. "Cloning, characterization and localization of lyk5 gene."
      Shan Y.X., Huang C.Q., Yu L.
      Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 4 AND 6).
      Tissue: Synovium and TeratocarcinomaImportedCurated.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
      Tissue: Lymph node.
    5. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
      Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
      , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
      Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "Activation of the tumour suppressor kinase LKB1 by the STE20-like pseudokinase STRAD."
      Baas A.F., Boudeau J., Sapkota G.P., Smit L., Medema R., Morrice N.A., Alessi D.R., Clevers H.C.
      EMBO J. 22:3062-3072(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH STK11/LKB1, MUTAGENESIS OF THR-329 AND THR-419, PHOSPHORYLATION AT THR-329 AND THR-419.
    8. "MO25alpha/beta interact with STRADalpha/beta enhancing their ability to bind, activate and localize LKB1 in the cytoplasm."
      Boudeau J., Baas A.F., Deak M., Morrice N.A., Kieloch A., Schutkowski M., Prescott A.R., Clevers H.C., Alessi D.R.
      EMBO J. 22:5102-5114(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH STK11/LKB1 AND CAB39.
    9. "Polyhydramnios, megalencephaly and symptomatic epilepsy caused by a homozygous 7-kilobase deletion in LYK5."
      Puffenberger E.G., Strauss K.A., Ramsey K.E., Craig D.W., Stephan D.A., Robinson D.L., Hendrickson C.L., Gottlieb S., Ramsay D.A., Siu V.M., Heuer G.G., Crino P.B., Morton D.H.
      Brain 130:1929-1941(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: INVOLVEMENT IN PMSE.
    10. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    11. "Crystal structure of MO25 alpha in complex with the C-terminus of the pseudo kinase STE20-related adaptor."
      Milburn C.C., Boudeau J., Deak M., Alessi D.R., van Aalten D.M.
      Nat. Struct. Mol. Biol. 11:193-200(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (1.85 ANGSTROMS) IN COMPLEX WITH CAB39.
    12. "Structure of the LKB1-STRAD-MO25 complex reveals an allosteric mechanism of kinase activation."
      Zeqiraj E., Filippi B.M., Deak M., Alessi D.R., van Aalten D.M.
      Science 326:1707-1711(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.65 ANGSTROMS) OF 59-431 IN COMPLEX WITH STK11/LKB1 AND CAB39, IDENTIFICATION IN A COMPLEX WITH STK11/LKB1 AND CAB39, FUNCTION, MUTAGENESIS OF TYR-185; HIS-231; PHE-233; LEU-241 AND GLN-251.
    13. "Patterns of somatic mutation in human cancer genomes."
      Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
      , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
      Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS [LARGE SCALE ANALYSIS] TRP-13; ILE-60 AND SER-64.

    Entry informationi

    Entry nameiSTRAA_HUMAN
    AccessioniPrimary (citable) accession number: Q7RTN6
    Secondary accession number(s): B4DDE3
    , B4DW17, J3KTC9, Q5JPI2, Q7Z4K9, Q8NC31, Q8NCF1, Q9H272
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 28, 2006
    Last sequence update: December 15, 2003
    Last modified: October 1, 2014
    This is version 106 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 17
      Human chromosome 17: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. Human and mouse protein kinases
      Human and mouse protein kinases: classification and index
    7. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3