Q7RTN6 (STRAA_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 91.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: STE20-related kinase adapter protein alpha Short name=STRAD alpha Alternative name(s): STE20-related adapter protein Serologically defined breast cancer antigen NY-BR-96 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 431 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Pseudokinase which, in complex with CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta), binds to and activates STK11/LKB1. Adopts a closed conformation typical of active protein kinases and binds STK11/LKB1 as a pseudosubstrate, promoting conformational change of STK11/LKB1 in an active conformation. Ref.7 Ref.8 Ref.12 |
| Subunit structure | Component of a trimeric complex composed of STK11/LKB1, STRAD (STRADA or STRADB) and CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta): the complex tethers STK11/LKB1 in the cytoplasm and stimulates its catalytic activity. Ref.12 |
| Subcellular location | |
| Domain | The protein kinase domain is predicted to be catalytically inactive. |
| Involvement in disease | A homozygous 7-kb deletion involving STRADA is a cause of a syndrome characterized by polyhydramnios, megalencephaly and symptomatic epilepsy. |
| Sequence similarities | Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily. Contains 1 protein kinase domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| STK11 | Q15831 | 9 | EBI-1109114,EBI-306838 |
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 Ref.7 (identifier: Q7RTN6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 Ref.2 Ref.3 (identifier: Q7RTN6-2) The sequence of this isoform differs from the canonical sequence as follows: 5-41: Missing. 368-417: PSASTLLNHSFFKQIKRRASEALPELLRPVTPITNFEGSQSQDHSGIFGL → YPCWPGPGLRESRGCSGG 418-431: Missing. | ||||||
| Isoform 3 Ref.3 (identifier: Q7RTN6-3) The sequence of this isoform differs from the canonical sequence as follows: 5-41: Missing. | ||||||
| Isoform 4 (identifier: Q7RTN6-4) The sequence of this isoform differs from the canonical sequence as follows: 32-75: Missing. 338-431: DSPSHPYHRT...EELEVDDWEF → PVPAPS | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q7RTN6-5) The sequence of this isoform differs from the canonical sequence as follows: 1-58: Missing. | ||||||
| Isoform 6 (identifier: Q7RTN6-6) The sequence of this isoform differs from the canonical sequence as follows: 13-41: Missing. 338-431: DSPSHPYHRT...EELEVDDWEF → PVPAPS | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 431 | 431 | STE20-related kinase adapter protein alpha | PRO_0000260035 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 69 – 379 | 311 | Protein kinase | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 329 | 1 | Phosphothreonine; by LKB1 Ref.7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 419 | 1 | Phosphothreonine; by LKB1 Ref.7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 58 | 58 | Missing in isoform 5. | VSP_044278 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 5 – 41 | 37 | Missing in isoform 2 and isoform 3. Ref.2 Ref.3 | VSP_052219 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 13 – 41 | 29 | Missing in isoform 6. | VSP_044717 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 32 – 75 | 44 | Missing in isoform 4. | VSP_043707 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 338 – 431 | 94 | DSPSH…DDWEF → PVPAPS in isoform 4 and isoform 6. | VSP_043708 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 368 – 417 | 50 | PSAST…GIFGL → YPCWPGPGLRESRGCSGG in isoform 2. Ref.3 | VSP_052220 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 418 – 431 | 14 | Missing in isoform 2. Ref.3 | VSP_052221 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 13 | 1 | R → W. Ref.13 Corresponds to variant rs35808156 [ dbSNP | Ensembl ]. | VAR_041377 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 60 | 1 | S → I. Ref.13 Corresponds to variant rs56271007 [ dbSNP | Ensembl ]. | VAR_041378 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 64 | 1 | P → S. Ref.13 Corresponds to variant rs55695051 [ dbSNP | Ensembl ]. | VAR_041379 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 185 | 1 | Y → F: Suppresses STK11/LKB1 activation without affecting complex assembly. Ref.12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 231 | 1 | H → A: Inhibits interaction with STK11/LKB1; when associated with A-. Ref.12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 233 | 1 | F → A: Inhibits interaction with STK11/LKB1; when associated with A-. Ref.12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 241 | 1 | L → A: Inhibits interaction with STK11/LKB1. Ref.12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 251 | 1 | Q → A: Inhibits interaction with STK11/LKB1. Ref.12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 329 | 1 | T → A: Loss of STK11/LKB1-mediated phosphorylation. Ref.7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 419 | 1 | T → A: Loss of STK11/LKB1-mediated phosphorylation. Ref.7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 163 | 1 | F → S in BAG62879. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 339 | 1 | S → W in AAG48269. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 363 | 1 | N → H in BAC11349. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 388 | 1 | E → K in AAG48269. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 66 – 68 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 69 – 78 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 79 – 82 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 83 – 90 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 91 – 93 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 96 – 103 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 104 – 106 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 109 – 124 | 16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 133 – 139 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 142 – 148 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 155 – 161 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 169 – 188 | 20 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 198 – 200 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 201 – 203 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 209 – 211 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 214 – 216 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 241 – 243 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 246 – 249 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 259 – 274 | 16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 278 – 281 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 287 – 290 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 350 – 359 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 364 – 366 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 370 – 373 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 377 – 381 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 386 – 388 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 390 – 393 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 394 – 396 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 406 – 409 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 414 – 416 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Humoral immunity to human breast cancer: antigen definition and quantitative analysis of mRNA expression." Scanlan M.J., Gout I., Gordon C.M., Williamson B., Stockert E., Gure A.O., Jaeger D., Chen Y.-T., Mackay A., O'Hare M.J., Old L.J. Cancer Immun. 1:4-4(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Mammary tumor. |
| [2] | "Cloning, characterization and localization of lyk5 gene." Shan Y.X., Huang C.Q., Yu L. Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 4 AND 6). Tissue: Synovium and Teratocarcinoma. |
| [4] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5). Tissue: Lymph node. |
| [5] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "Activation of the tumour suppressor kinase LKB1 by the STE20-like pseudokinase STRAD." Baas A.F., Boudeau J., Sapkota G.P., Smit L., Medema R., Morrice N.A., Alessi D.R., Clevers H.C. EMBO J. 22:3062-3072(2003) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH STK11/LKB1, MUTAGENESIS OF THR-329 AND THR-419, PHOSPHORYLATION AT THR-329 AND THR-419. |
| [8] | "MO25alpha/beta interact with STRADalpha/beta enhancing their ability to bind, activate and localize LKB1 in the cytoplasm." Boudeau J., Baas A.F., Deak M., Morrice N.A., Kieloch A., Schutkowski M., Prescott A.R., Clevers H.C., Alessi D.R. EMBO J. 22:5102-5114(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH STK11/LKB1 AND CAB39. |
| [9] | "Polyhydramnios, megalencephaly and symptomatic epilepsy caused by a homozygous 7-kilobase deletion in LYK5." Puffenberger E.G., Strauss K.A., Ramsey K.E., Craig D.W., Stephan D.A., Robinson D.L., Hendrickson C.L., Gottlieb S., Ramsay D.A., Siu V.M., Heuer G.G., Crino P.B., Morton D.H. Brain 130:1929-1941(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN PMSE. |
| [10] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [11] | "Crystal structure of MO25 alpha in complex with the C-terminus of the pseudo kinase STE20-related adaptor." Milburn C.C., Boudeau J., Deak M., Alessi D.R., van Aalten D.M. Nat. Struct. Mol. Biol. 11:193-200(2004) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.85 ANGSTROMS) IN COMPLEX WITH CAB39. |
| [12] | "Structure of the LKB1-STRAD-MO25 complex reveals an allosteric mechanism of kinase activation." Zeqiraj E., Filippi B.M., Deak M., Alessi D.R., van Aalten D.M. Science 326:1707-1711(2009) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.65 ANGSTROMS) OF 59-431 IN COMPLEX WITH STK11/LKB1 AND CAB39, IDENTIFICATION IN A COMPLEX WITH STK11/LKB1 AND CAB39, FUNCTION, MUTAGENESIS OF TYR-185; HIS-231; PHE-233; LEU-241 AND GLN-251. |
| [13] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] TRP-13; ILE-60 AND SER-64. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF308302 mRNA. Translation: AAG48269.1. AY290821 mRNA. Translation: AAP42280.1. AK074771 mRNA. Translation: BAC11197.1. AK075005 mRNA. Translation: BAC11349.1. AK293160 mRNA. Translation: BAG56704.1. AK301331 mRNA. Translation: BAG62879.1. AL832407 mRNA. Translation: CAI46194.1. AC015651 Genomic DNA. No translation available. AC046185 Genomic DNA. No translation available. CH471109 Genomic DNA. Translation: EAW94283.1. BK001542 mRNA. Translation: DAA01797.1. | ||||||||||||||||||||||||
| IPI | IPI00300700. IPI00396083. IPI00456673. IPI00945374. IPI00947317. | ||||||||||||||||||||||||
| RefSeq | NP_001003786.1. NM_001003786.2. NP_001003787.1. NM_001003787.2. NP_001003788.1. NM_001003788.2. NP_001159441.1. NM_001165969.1. NP_001159442.1. NM_001165970.1. NP_699166.2. NM_153335.5. | ||||||||||||||||||||||||
| UniGene | Hs.514402. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | Q7RTN6. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| DIP | DIP-35775N. | ||||||||||||||||||||||||
| IntAct | Q7RTN6. 1 interaction. | ||||||||||||||||||||||||
| MINT | MINT-1338485. | ||||||||||||||||||||||||
| STRING | 9606.ENSP00000336655. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | Q7RTN6. | ||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||
| DMDM | 74759034. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PaxDb | Q7RTN6. | ||||||||||||||||||||||||
| PRIDE | Q7RTN6. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| DNASU | 92335. | ||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000336174; ENSP00000336655; ENSG00000266173. ENST00000375840; ENSP00000365000; ENSG00000266173. ENST00000392950; ENSP00000376677; ENSG00000266173. ENST00000447001; ENSP00000398841; ENSG00000266173. ENST00000582137; ENSP00000462922; ENSG00000266173. | ||||||||||||||||||||||||
| GeneID | 92335. | ||||||||||||||||||||||||
| KEGG | hsa:92335. | ||||||||||||||||||||||||
| UCSC | uc002jbm.3. human. uc002jbo.3. human. uc002jbp.3. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 92335. | ||||||||||||||||||||||||
| GeneCards | GC17M061780. | ||||||||||||||||||||||||
| HGNC | HGNC:30172. STRADA. | ||||||||||||||||||||||||
| HPA | HPA031637. | ||||||||||||||||||||||||
| MIM | 608626. gene. 611087. phenotype. | ||||||||||||||||||||||||
| neXtProt | NX_Q7RTN6. | ||||||||||||||||||||||||
| PharmGKB | PA164726342. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | COG0515. | ||||||||||||||||||||||||
| HOGENOM | HOG000237355. | ||||||||||||||||||||||||
| HOVERGEN | HBG055069. | ||||||||||||||||||||||||
| InParanoid | Q7RTN6. | ||||||||||||||||||||||||
| KO | K08271. | ||||||||||||||||||||||||
| OMA | NGTVPCL. | ||||||||||||||||||||||||
| OrthoDB | EOG4WSW9P. | ||||||||||||||||||||||||
| PhylomeDB | Q7RTN6. | ||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||
| Reactome | REACT_111102. Signal Transduction. REACT_11163. Activated AMPK stimulates fatty-acid oxidation in muscle. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | Q7RTN6. | ||||||||||||||||||||||||
| Bgee | Q7RTN6. | ||||||||||||||||||||||||
| CleanEx | HS_STRADA. | ||||||||||||||||||||||||
| Genevestigator | Q7RTN6. | ||||||||||||||||||||||||
| GermOnline | ENSG00000125695. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| InterPro | IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. [Graphical view] | ||||||||||||||||||||||||
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| SUPFAM | SSF56112. Kinase_like. 1 hit. | ||||||||||||||||||||||||
| PROSITE | PS50011. PROTEIN_KINASE_DOM. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| ChEMBL | CHEMBL1795198. | ||||||||||||||||||||||||
| ChiTaRS | STRADA. human. | ||||||||||||||||||||||||
| EvolutionaryTrace | Q7RTN6. | ||||||||||||||||||||||||
| GenomeRNAi | 92335. | ||||||||||||||||||||||||
| NextBio | 35536174. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | STRAA_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q7RTN6 Secondary accession number(s): B4DDE3 Q9H272 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
