Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q7LGA3 (HS2ST_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 91. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Heparan sulfate 2-O-sulfotransferase 1

Short name=2-O-sulfotransferase
Short name=2OST
EC=2.8.2.-
Gene names
Name:HS2ST1
Synonyms:HS2ST, KIAA0448
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length356 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Catalyzes the transfer of sulfate to the C2-position of selected hexuronic acid residues within the maturing heparan sulfate (HS). 2-O-sulfation within HS, particularly of iduronate residues, is essential for HS to participate in a variety of high-affinity ligand-binding interactions and signaling processes. Mediates 2-O-sulfation of both L-iduronyl and D-glucuronyl residues By similarity.

Subunit structure

Homotrimer. Interacts with the C5-epimerase GLCE By similarity.

Subcellular location

Golgi apparatus membrane; Single-pass type II membrane protein By similarity.

Post-translational modification

N-glycosylated By similarity.

Sequence similarities

Belongs to the sulfotransferase 3 family.

Sequence caution

The sequence BAA32293.2 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q7LGA3-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q7LGA3-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MGLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKL → MLFIKFIHLEVFSMP
     282-356: GKKSHLRKTT...FYEKIYPKSN → APDTATPSHR...KCSRNGLSAV
Note: No experimental confirmation available.
Isoform 3 (identifier: Q7LGA3-3)

The sequence of this isoform differs from the canonical sequence as follows:
     230-356: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 356356Heparan sulfate 2-O-sulfotransferase 1
PRO_0000207674

Regions

Topological domain1 – 1111Cytoplasmic Potential
Transmembrane12 – 2817Helical; Signal-anchor for type II membrane protein; Potential
Topological domain29 – 356328Lumenal Potential

Sites

Active site1401 By similarity

Amino acid modifications

Glycosylation1081N-linked (GlcNAc...) Potential
Glycosylation1271N-linked (GlcNAc...) Potential
Disulfide bond201 ↔ 209 By similarity
Disulfide bond222 ↔ 228 By similarity

Natural variations

Alternative sequence1 – 4141MGLLR…SRSKL → MLFIKFIHLEVFSMP in isoform 2.
VSP_014062
Alternative sequence230 – 356127Missing in isoform 3.
VSP_014063
Alternative sequence282 – 35675GKKSH…YPKSN → APDTATPSHRHGPICGSKSI SSLLVKVSPVCKDSHCLGKC SRNGLSAV in isoform 2.
VSP_014064

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 5, 2004. Version 1.
Checksum: 2F5BBDFC7DF50F78

FASTA35641,881
        10         20         30         40         50         60 
MGLLRIMMPP KLQLLAVVAF AVAMLFLENQ IQKLEESRSK LERAIARHEV REIEQRHTMD 

        70         80         90        100        110        120 
GPRQDATLDE EEDMVIIYNR VPKTASTSFT NIAYDLCAKN KYHVLHINTT KNNPVMSLQD 

       130        140        150        160        170        180 
QVRFVKNITS WKEMKPGFYH GHVSYLDFAK FGVKKKPIYI NVIRDPIERL VSYYYFLRFG 

       190        200        210        220        230        240 
DDYRPGLRRR KQGDKKTFDE CVAEGGSDCA PEKLWLQIPF FCGHSSECWN VGSRWAMDQA 

       250        260        270        280        290        300 
KYNLINEYFL VGVTEELEDF IMLLEAALPR FFRGATELYR TGKKSHLRKT TEKKLPTKQT 

       310        320        330        340        350 
IAKLQQSDIW KMENEFYEFA LEQFQFIRAH AVREKDGDLY ILAQNFFYEK IYPKSN 

« Hide

Isoform 2 [UniParc].

Checksum: 33F937D451024A45
Show »

FASTA30334,907
Isoform 3 [UniParc].

Checksum: F953C9470254BE9D
Show »

FASTA22926,757

References

« Hide 'large scale' references
[1]"Human heparan sulfate 2-O-sulfotransferase."
Habuchi H.
Submitted (JAN-2000) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[2]"Characterization of cDNA clones in size-fractionated cDNA libraries from human brain."
Seki N., Ohira M., Nagase T., Ishikawa K., Miyajima N., Nakajima D., Nomura N., Ohara O.
DNA Res. 4:345-349(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Placenta.
[4]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Brain, Ovary and Testis.
[7]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB024568 mRNA. Translation: BAA89250.1.
AB007917 mRNA. Translation: BAA32293.2. Different initiation.
AK002179 mRNA. Translation: BAA92125.1.
AL139139, AC093155 Genomic DNA. Translation: CAI19004.1.
AL121989 Genomic DNA. Translation: CAC04187.1.
CH471097 Genomic DNA. Translation: EAW73171.1.
CH471097 Genomic DNA. Translation: EAW73172.1.
BC025384 mRNA. Translation: AAH25384.1.
BC025990 mRNA. Translation: AAH25990.1.
BC108735 mRNA. Translation: AAI08736.1.
RefSeqNP_001127964.1. NM_001134492.1.
NP_036394.1. NM_012262.3.
UniGeneHs.743280.

3D structure databases

ProteinModelPortalQ7LGA3.
SMRQ7LGA3. Positions 69-354.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000359581.

PTM databases

PhosphoSiteQ7LGA3.

Polymorphism databases

DMDM68052326.

Proteomic databases

PaxDbQ7LGA3.
PRIDEQ7LGA3.

Protocols and materials databases

DNASU9653.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000370550; ENSP00000359581; ENSG00000153936. [Q7LGA3-1]
ENST00000370551; ENSP00000359582; ENSG00000153936. [Q7LGA3-3]
GeneID9653.
KEGGhsa:9653.
UCSCuc001dmc.4. human. [Q7LGA3-1]
uc001dme.2. human. [Q7LGA3-2]

Organism-specific databases

CTD9653.
GeneCardsGC01P087380.
H-InvDBHIX0000755.
HGNCHGNC:5193. HS2ST1.
HPAHPA043069.
HPA043603.
MIM604844. gene.
neXtProtNX_Q7LGA3.
PharmGKBPA29466.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG293591.
HOVERGENHBG053202.
InParanoidQ7LGA3.
KOK02513.
OMAHAAECWE.
OrthoDBEOG7PS1J6.
PhylomeDBQ7LGA3.
TreeFamTF315238.

Enzyme and pathway databases

BioCycMetaCyc:ENSG00000153936-MONOMER.
ReactomeREACT_111217. Metabolism.
REACT_116125. Disease.

Gene expression databases

ArrayExpressQ7LGA3.
BgeeQ7LGA3.
CleanExHS_HS2ST1.
GenevestigatorQ7LGA3.

Family and domain databases

Gene3D3.40.50.300. 1 hit.
InterProIPR007734. Heparan_SO4_2-O-STrfase.
IPR027417. P-loop_NTPase.
IPR005331. Sulfotransferase.
[Graphical view]
PANTHERPTHR12129. PTHR12129. 1 hit.
PfamPF03567. Sulfotransfer_2. 1 hit.
[Graphical view]
SUPFAMSSF52540. SSF52540. 1 hit.
ProtoNetSearch...

Other

GeneWikiHS2ST1.
GenomeRNAi9653.
NextBio36237.
PROQ7LGA3.
SOURCESearch...

Entry information

Entry nameHS2ST_HUMAN
AccessionPrimary (citable) accession number: Q7LGA3
Secondary accession number(s): D3DT22 expand/collapse secondary AC list , O75036, Q32NB5, Q8TAC5, Q9H441, Q9NUJ9
Entry history
Integrated into UniProtKB/Swiss-Prot: June 21, 2005
Last sequence update: July 5, 2004
Last modified: April 16, 2014
This is version 91 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM