Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Heparan sulfate 2-O-sulfotransferase 1

Gene

HS2ST1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Catalyzes the transfer of sulfate to the C2-position of selected hexuronic acid residues within the maturing heparan sulfate (HS). 2-O-sulfation within HS, particularly of iduronate residues, is essential for HS to participate in a variety of high-affinity ligand-binding interactions and signaling processes. Mediates 2-O-sulfation of both L-iduronyl and D-glucuronyl residues (By similarity).By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei140By similarity1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionTransferase

Enzyme and pathway databases

BioCyciMetaCyc:ENSG00000153936-MONOMER
ReactomeiR-HSA-2022928 HS-GAG biosynthesis

Names & Taxonomyi

Protein namesi
Recommended name:
Heparan sulfate 2-O-sulfotransferase 1 (EC:2.8.2.-)
Short name:
2-O-sulfotransferase
Short name:
2OST
Gene namesi
Name:HS2ST1
Synonyms:HS2ST, KIAA0448
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000153936.16
HGNCiHGNC:5193 HS2ST1
MIMi604844 gene
neXtProtiNX_Q7LGA3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 11CytoplasmicSequence analysisAdd BLAST11
Transmembranei12 – 28Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST17
Topological domaini29 – 356LumenalSequence analysisAdd BLAST328

Keywords - Cellular componenti

Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi9653
OpenTargetsiENSG00000153936
ENSG00000267561
PharmGKBiPA29466

Polymorphism and mutation databases

BioMutaiHS2ST1
DMDMi68052326

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002076741 – 356Heparan sulfate 2-O-sulfotransferase 1Add BLAST356

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi108N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi127N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi201 ↔ 209By similarity
Disulfide bondi222 ↔ 228By similarity

Post-translational modificationi

N-glycosylated.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

EPDiQ7LGA3
MaxQBiQ7LGA3
PaxDbiQ7LGA3
PeptideAtlasiQ7LGA3
PRIDEiQ7LGA3

PTM databases

iPTMnetiQ7LGA3
PhosphoSitePlusiQ7LGA3

Expressioni

Gene expression databases

BgeeiENSG00000153936
CleanExiHS_HS2ST1
ExpressionAtlasiQ7LGA3 baseline and differential
GenevisibleiQ7LGA3 HS

Organism-specific databases

HPAiHPA043069
HPA043603
HPA075001

Interactioni

Subunit structurei

Homotrimer. Interacts with the C5-epimerase GLCE (By similarity).By similarity

Protein-protein interaction databases

BioGridi115011, 23 interactors
IntActiQ7LGA3, 3 interactors
MINTiQ7LGA3
STRINGi9606.ENSP00000359581

Structurei

3D structure databases

ProteinModelPortaliQ7LGA3
SMRiQ7LGA3
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the sulfotransferase 3 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3922 Eukaryota
ENOG410XTA1 LUCA
GeneTreeiENSGT00530000063408
HOVERGENiHBG053202
InParanoidiQ7LGA3
KOiK02513
OMAiSEIRLEH
OrthoDBiEOG091G0CSZ
PhylomeDBiQ7LGA3
TreeFamiTF315238

Family and domain databases

InterProiView protein in InterPro
IPR007734 Heparan_SO4_2-O-STrfase
IPR027417 P-loop_NTPase
IPR005331 Sulfotransferase
PANTHERiPTHR12129 PTHR12129, 1 hit
PfamiView protein in Pfam
PF03567 Sulfotransfer_2, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7LGA3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGLLRIMMPP KLQLLAVVAF AVAMLFLENQ IQKLEESRSK LERAIARHEV
60 70 80 90 100
REIEQRHTMD GPRQDATLDE EEDMVIIYNR VPKTASTSFT NIAYDLCAKN
110 120 130 140 150
KYHVLHINTT KNNPVMSLQD QVRFVKNITS WKEMKPGFYH GHVSYLDFAK
160 170 180 190 200
FGVKKKPIYI NVIRDPIERL VSYYYFLRFG DDYRPGLRRR KQGDKKTFDE
210 220 230 240 250
CVAEGGSDCA PEKLWLQIPF FCGHSSECWN VGSRWAMDQA KYNLINEYFL
260 270 280 290 300
VGVTEELEDF IMLLEAALPR FFRGATELYR TGKKSHLRKT TEKKLPTKQT
310 320 330 340 350
IAKLQQSDIW KMENEFYEFA LEQFQFIRAH AVREKDGDLY ILAQNFFYEK

IYPKSN
Length:356
Mass (Da):41,881
Last modified:July 5, 2004 - v1
Checksum:i2F5BBDFC7DF50F78
GO
Isoform 2 (identifier: Q7LGA3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MGLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKL → MLFIKFIHLEVFSMP
     282-356: GKKSHLRKTT...FYEKIYPKSN → APDTATPSHR...KCSRNGLSAV

Note: No experimental confirmation available.
Show »
Length:303
Mass (Da):34,907
Checksum:i33F937D451024A45
GO
Isoform 3 (identifier: Q7LGA3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     230-356: Missing.

Note: No experimental confirmation available.
Show »
Length:229
Mass (Da):26,757
Checksum:iF953C9470254BE9D
GO

Sequence cautioni

The sequence BAA32293 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0140621 – 41MGLLR…SRSKL → MLFIKFIHLEVFSMP in isoform 2. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_014063230 – 356Missing in isoform 3. 1 PublicationAdd BLAST127
Alternative sequenceiVSP_014064282 – 356GKKSH…YPKSN → APDTATPSHRHGPICGSKSI SSLLVKVSPVCKDSHCLGKC SRNGLSAV in isoform 2. 1 PublicationAdd BLAST75

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB024568 mRNA Translation: BAA89250.1
AB007917 mRNA Translation: BAA32293.2 Different initiation.
AK002179 mRNA Translation: BAA92125.1
AC093155 Genomic DNA No translation available.
AL121989 Genomic DNA No translation available.
AL139139 Genomic DNA No translation available.
CH471097 Genomic DNA Translation: EAW73171.1
CH471097 Genomic DNA Translation: EAW73172.1
BC025384 mRNA Translation: AAH25384.1
BC025990 mRNA Translation: AAH25990.1
BC108735 mRNA Translation: AAI08736.1
CCDSiCCDS44171.1 [Q7LGA3-3]
CCDS711.1 [Q7LGA3-1]
RefSeqiNP_001127964.1, NM_001134492.1 [Q7LGA3-3]
NP_036394.1, NM_012262.3 [Q7LGA3-1]
UniGeneiHs.743280

Genome annotation databases

EnsembliENST00000370550; ENSP00000359581; ENSG00000153936 [Q7LGA3-1]
ENST00000370551; ENSP00000359582; ENSG00000153936 [Q7LGA3-3]
GeneIDi9653
KEGGihsa:9653
UCSCiuc001dmc.5 human [Q7LGA3-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiHS2ST_HUMAN
AccessioniPrimary (citable) accession number: Q7LGA3
Secondary accession number(s): D3DT22
, O75036, Q32NB5, Q8TAC5, Q9H441, Q9NUJ9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 21, 2005
Last sequence update: July 5, 2004
Last modified: May 23, 2018
This is version 127 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health