Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q7LGA3

- HS2ST_HUMAN

UniProt

Q7LGA3 - HS2ST_HUMAN

Protein

Heparan sulfate 2-O-sulfotransferase 1

Gene

HS2ST1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 96 (01 Oct 2014)
      Sequence version 1 (05 Jul 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalyzes the transfer of sulfate to the C2-position of selected hexuronic acid residues within the maturing heparan sulfate (HS). 2-O-sulfation within HS, particularly of iduronate residues, is essential for HS to participate in a variety of high-affinity ligand-binding interactions and signaling processes. Mediates 2-O-sulfation of both L-iduronyl and D-glucuronyl residues By similarity.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei140 – 1401By similarity

    GO - Molecular functioni

    1. sulfotransferase activity Source: InterPro

    GO - Biological processi

    1. carbohydrate metabolic process Source: Reactome
    2. glycosaminoglycan biosynthetic process Source: Reactome
    3. glycosaminoglycan metabolic process Source: Reactome
    4. small molecule metabolic process Source: Reactome

    Keywords - Molecular functioni

    Transferase

    Enzyme and pathway databases

    BioCyciMetaCyc:ENSG00000153936-MONOMER.
    ReactomeiREACT_121248. HS-GAG biosynthesis.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Heparan sulfate 2-O-sulfotransferase 1 (EC:2.8.2.-)
    Short name:
    2-O-sulfotransferase
    Short name:
    2OST
    Gene namesi
    Name:HS2ST1
    Synonyms:HS2ST, KIAA0448
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:5193. HS2ST1.

    Subcellular locationi

    GO - Cellular componenti

    1. Golgi membrane Source: Reactome
    2. integral component of membrane Source: UniProtKB-KW
    3. membrane Source: UniProtKB

    Keywords - Cellular componenti

    Golgi apparatus, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA29466.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 356356Heparan sulfate 2-O-sulfotransferase 1PRO_0000207674Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi108 – 1081N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi127 – 1271N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi201 ↔ 209By similarity
    Disulfide bondi222 ↔ 228By similarity

    Post-translational modificationi

    N-glycosylated.By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    MaxQBiQ7LGA3.
    PaxDbiQ7LGA3.
    PRIDEiQ7LGA3.

    PTM databases

    PhosphoSiteiQ7LGA3.

    Expressioni

    Gene expression databases

    ArrayExpressiQ7LGA3.
    BgeeiQ7LGA3.
    CleanExiHS_HS2ST1.
    GenevestigatoriQ7LGA3.

    Organism-specific databases

    HPAiHPA043069.
    HPA043603.

    Interactioni

    Subunit structurei

    Homotrimer. Interacts with the C5-epimerase GLCE By similarity.By similarity

    Protein-protein interaction databases

    STRINGi9606.ENSP00000359581.

    Structurei

    3D structure databases

    ProteinModelPortaliQ7LGA3.
    SMRiQ7LGA3. Positions 69-355.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 1111CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini29 – 356328LumenalSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei12 – 2817Helical; Signal-anchor for type II membrane proteinSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the sulfotransferase 3 family.Curated

    Keywords - Domaini

    Signal-anchor, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG293591.
    HOVERGENiHBG053202.
    InParanoidiQ7LGA3.
    KOiK02513.
    OMAiLQQSEIW.
    OrthoDBiEOG7PS1J6.
    PhylomeDBiQ7LGA3.
    TreeFamiTF315238.

    Family and domain databases

    Gene3Di3.40.50.300. 1 hit.
    InterProiIPR007734. Heparan_SO4_2-O-STrfase.
    IPR027417. P-loop_NTPase.
    IPR005331. Sulfotransferase.
    [Graphical view]
    PANTHERiPTHR12129. PTHR12129. 1 hit.
    PfamiPF03567. Sulfotransfer_2. 1 hit.
    [Graphical view]
    SUPFAMiSSF52540. SSF52540. 1 hit.

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q7LGA3-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGLLRIMMPP KLQLLAVVAF AVAMLFLENQ IQKLEESRSK LERAIARHEV    50
    REIEQRHTMD GPRQDATLDE EEDMVIIYNR VPKTASTSFT NIAYDLCAKN 100
    KYHVLHINTT KNNPVMSLQD QVRFVKNITS WKEMKPGFYH GHVSYLDFAK 150
    FGVKKKPIYI NVIRDPIERL VSYYYFLRFG DDYRPGLRRR KQGDKKTFDE 200
    CVAEGGSDCA PEKLWLQIPF FCGHSSECWN VGSRWAMDQA KYNLINEYFL 250
    VGVTEELEDF IMLLEAALPR FFRGATELYR TGKKSHLRKT TEKKLPTKQT 300
    IAKLQQSDIW KMENEFYEFA LEQFQFIRAH AVREKDGDLY ILAQNFFYEK 350
    IYPKSN 356
    Length:356
    Mass (Da):41,881
    Last modified:July 5, 2004 - v1
    Checksum:i2F5BBDFC7DF50F78
    GO
    Isoform 2 (identifier: Q7LGA3-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-41: MGLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKL → MLFIKFIHLEVFSMP
         282-356: GKKSHLRKTT...FYEKIYPKSN → APDTATPSHR...KCSRNGLSAV

    Note: No experimental confirmation available.

    Show »
    Length:303
    Mass (Da):34,907
    Checksum:i33F937D451024A45
    GO
    Isoform 3 (identifier: Q7LGA3-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         230-356: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:229
    Mass (Da):26,757
    Checksum:iF953C9470254BE9D
    GO

    Sequence cautioni

    The sequence BAA32293.2 differs from that shown. Reason: Erroneous initiation.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 4141MGLLR…SRSKL → MLFIKFIHLEVFSMP in isoform 2. 1 PublicationVSP_014062Add
    BLAST
    Alternative sequencei230 – 356127Missing in isoform 3. 1 PublicationVSP_014063Add
    BLAST
    Alternative sequencei282 – 35675GKKSH…YPKSN → APDTATPSHRHGPICGSKSI SSLLVKVSPVCKDSHCLGKC SRNGLSAV in isoform 2. 1 PublicationVSP_014064Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB024568 mRNA. Translation: BAA89250.1.
    AB007917 mRNA. Translation: BAA32293.2. Different initiation.
    AK002179 mRNA. Translation: BAA92125.1.
    AL139139, AC093155 Genomic DNA. Translation: CAI19004.1.
    AL121989 Genomic DNA. Translation: CAC04187.1.
    CH471097 Genomic DNA. Translation: EAW73171.1.
    CH471097 Genomic DNA. Translation: EAW73172.1.
    BC025384 mRNA. Translation: AAH25384.1.
    BC025990 mRNA. Translation: AAH25990.1.
    BC108735 mRNA. Translation: AAI08736.1.
    CCDSiCCDS44171.1. [Q7LGA3-3]
    CCDS711.1. [Q7LGA3-1]
    RefSeqiNP_001127964.1. NM_001134492.1. [Q7LGA3-3]
    NP_036394.1. NM_012262.3. [Q7LGA3-1]
    UniGeneiHs.743280.

    Genome annotation databases

    EnsembliENST00000370550; ENSP00000359581; ENSG00000153936. [Q7LGA3-1]
    ENST00000370551; ENSP00000359582; ENSG00000153936. [Q7LGA3-3]
    GeneIDi9653.
    KEGGihsa:9653.
    UCSCiuc001dmc.4. human. [Q7LGA3-1]
    uc001dme.2. human. [Q7LGA3-2]

    Polymorphism databases

    DMDMi68052326.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB024568 mRNA. Translation: BAA89250.1 .
    AB007917 mRNA. Translation: BAA32293.2 . Different initiation.
    AK002179 mRNA. Translation: BAA92125.1 .
    AL139139 , AC093155 Genomic DNA. Translation: CAI19004.1 .
    AL121989 Genomic DNA. Translation: CAC04187.1 .
    CH471097 Genomic DNA. Translation: EAW73171.1 .
    CH471097 Genomic DNA. Translation: EAW73172.1 .
    BC025384 mRNA. Translation: AAH25384.1 .
    BC025990 mRNA. Translation: AAH25990.1 .
    BC108735 mRNA. Translation: AAI08736.1 .
    CCDSi CCDS44171.1. [Q7LGA3-3 ]
    CCDS711.1. [Q7LGA3-1 ]
    RefSeqi NP_001127964.1. NM_001134492.1. [Q7LGA3-3 ]
    NP_036394.1. NM_012262.3. [Q7LGA3-1 ]
    UniGenei Hs.743280.

    3D structure databases

    ProteinModelPortali Q7LGA3.
    SMRi Q7LGA3. Positions 69-355.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000359581.

    PTM databases

    PhosphoSitei Q7LGA3.

    Polymorphism databases

    DMDMi 68052326.

    Proteomic databases

    MaxQBi Q7LGA3.
    PaxDbi Q7LGA3.
    PRIDEi Q7LGA3.

    Protocols and materials databases

    DNASUi 9653.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000370550 ; ENSP00000359581 ; ENSG00000153936 . [Q7LGA3-1 ]
    ENST00000370551 ; ENSP00000359582 ; ENSG00000153936 . [Q7LGA3-3 ]
    GeneIDi 9653.
    KEGGi hsa:9653.
    UCSCi uc001dmc.4. human. [Q7LGA3-1 ]
    uc001dme.2. human. [Q7LGA3-2 ]

    Organism-specific databases

    CTDi 9653.
    GeneCardsi GC01P087380.
    H-InvDB HIX0000755.
    HGNCi HGNC:5193. HS2ST1.
    HPAi HPA043069.
    HPA043603.
    MIMi 604844. gene.
    neXtProti NX_Q7LGA3.
    PharmGKBi PA29466.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG293591.
    HOVERGENi HBG053202.
    InParanoidi Q7LGA3.
    KOi K02513.
    OMAi LQQSEIW.
    OrthoDBi EOG7PS1J6.
    PhylomeDBi Q7LGA3.
    TreeFami TF315238.

    Enzyme and pathway databases

    BioCyci MetaCyc:ENSG00000153936-MONOMER.
    Reactomei REACT_121248. HS-GAG biosynthesis.

    Miscellaneous databases

    GeneWikii HS2ST1.
    GenomeRNAii 9653.
    NextBioi 36237.
    PROi Q7LGA3.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q7LGA3.
    Bgeei Q7LGA3.
    CleanExi HS_HS2ST1.
    Genevestigatori Q7LGA3.

    Family and domain databases

    Gene3Di 3.40.50.300. 1 hit.
    InterProi IPR007734. Heparan_SO4_2-O-STrfase.
    IPR027417. P-loop_NTPase.
    IPR005331. Sulfotransferase.
    [Graphical view ]
    PANTHERi PTHR12129. PTHR12129. 1 hit.
    Pfami PF03567. Sulfotransfer_2. 1 hit.
    [Graphical view ]
    SUPFAMi SSF52540. SSF52540. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Human heparan sulfate 2-O-sulfotransferase."
      Habuchi H.
      Submitted (JAN-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Characterization of cDNA clones in size-fractionated cDNA libraries from human brain."
      Seki N., Ohira M., Nagase T., Ishikawa K., Miyajima N., Nakajima D., Nomura N., Ohara O.
      DNA Res. 4:345-349(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Placenta.
    4. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Brain, Ovary and Testis.
    7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiHS2ST_HUMAN
    AccessioniPrimary (citable) accession number: Q7LGA3
    Secondary accession number(s): D3DT22
    , O75036, Q32NB5, Q8TAC5, Q9H441, Q9NUJ9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 21, 2005
    Last sequence update: July 5, 2004
    Last modified: October 1, 2014
    This is version 96 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3