Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Heparan sulfate 2-O-sulfotransferase 1

Gene

HS2ST1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Catalyzes the transfer of sulfate to the C2-position of selected hexuronic acid residues within the maturing heparan sulfate (HS). 2-O-sulfation within HS, particularly of iduronate residues, is essential for HS to participate in a variety of high-affinity ligand-binding interactions and signaling processes. Mediates 2-O-sulfation of both L-iduronyl and D-glucuronyl residues (By similarity).By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei140 – 1401By similarity

GO - Molecular functioni

  1. sulfotransferase activity Source: InterPro

GO - Biological processi

  1. carbohydrate metabolic process Source: Reactome
  2. glycosaminoglycan biosynthetic process Source: Reactome
  3. glycosaminoglycan metabolic process Source: Reactome
  4. pathogenesis Source: Reactome
  5. small molecule metabolic process Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Transferase

Enzyme and pathway databases

BioCyciMetaCyc:ENSG00000153936-MONOMER.
ReactomeiREACT_121248. HS-GAG biosynthesis.

Names & Taxonomyi

Protein namesi
Recommended name:
Heparan sulfate 2-O-sulfotransferase 1 (EC:2.8.2.-)
Short name:
2-O-sulfotransferase
Short name:
2OST
Gene namesi
Name:HS2ST1
Synonyms:HS2ST, KIAA0448
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:5193. HS2ST1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 1111CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei12 – 2817Helical; Signal-anchor for type II membrane proteinSequence AnalysisAdd
BLAST
Topological domaini29 – 356328LumenalSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. Golgi membrane Source: Reactome
  2. integral component of membrane Source: UniProtKB-KW
  3. membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA29466.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 356356Heparan sulfate 2-O-sulfotransferase 1PRO_0000207674Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi108 – 1081N-linked (GlcNAc...)Sequence Analysis
Glycosylationi127 – 1271N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi201 ↔ 209By similarity
Disulfide bondi222 ↔ 228By similarity

Post-translational modificationi

N-glycosylated.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiQ7LGA3.
PaxDbiQ7LGA3.
PRIDEiQ7LGA3.

PTM databases

PhosphoSiteiQ7LGA3.

Expressioni

Gene expression databases

BgeeiQ7LGA3.
CleanExiHS_HS2ST1.
ExpressionAtlasiQ7LGA3. baseline and differential.
GenevestigatoriQ7LGA3.

Organism-specific databases

HPAiHPA043069.
HPA043603.

Interactioni

Subunit structurei

Homotrimer. Interacts with the C5-epimerase GLCE (By similarity).By similarity

Protein-protein interaction databases

BioGridi115011. 13 interactions.
STRINGi9606.ENSP00000359581.

Structurei

3D structure databases

ProteinModelPortaliQ7LGA3.
SMRiQ7LGA3. Positions 69-355.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the sulfotransferase 3 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG293591.
GeneTreeiENSGT00530000063408.
HOVERGENiHBG053202.
InParanoidiQ7LGA3.
KOiK02513.
OMAiLQQSEIW.
OrthoDBiEOG7PS1J6.
PhylomeDBiQ7LGA3.
TreeFamiTF315238.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR007734. Heparan_SO4_2-O-STrfase.
IPR027417. P-loop_NTPase.
IPR005331. Sulfotransferase.
[Graphical view]
PANTHERiPTHR12129. PTHR12129. 1 hit.
PfamiPF03567. Sulfotransfer_2. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7LGA3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGLLRIMMPP KLQLLAVVAF AVAMLFLENQ IQKLEESRSK LERAIARHEV
60 70 80 90 100
REIEQRHTMD GPRQDATLDE EEDMVIIYNR VPKTASTSFT NIAYDLCAKN
110 120 130 140 150
KYHVLHINTT KNNPVMSLQD QVRFVKNITS WKEMKPGFYH GHVSYLDFAK
160 170 180 190 200
FGVKKKPIYI NVIRDPIERL VSYYYFLRFG DDYRPGLRRR KQGDKKTFDE
210 220 230 240 250
CVAEGGSDCA PEKLWLQIPF FCGHSSECWN VGSRWAMDQA KYNLINEYFL
260 270 280 290 300
VGVTEELEDF IMLLEAALPR FFRGATELYR TGKKSHLRKT TEKKLPTKQT
310 320 330 340 350
IAKLQQSDIW KMENEFYEFA LEQFQFIRAH AVREKDGDLY ILAQNFFYEK

IYPKSN
Length:356
Mass (Da):41,881
Last modified:July 5, 2004 - v1
Checksum:i2F5BBDFC7DF50F78
GO
Isoform 2 (identifier: Q7LGA3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MGLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKL → MLFIKFIHLEVFSMP
     282-356: GKKSHLRKTT...FYEKIYPKSN → APDTATPSHR...KCSRNGLSAV

Note: No experimental confirmation available.

Show »
Length:303
Mass (Da):34,907
Checksum:i33F937D451024A45
GO
Isoform 3 (identifier: Q7LGA3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     230-356: Missing.

Note: No experimental confirmation available.

Show »
Length:229
Mass (Da):26,757
Checksum:iF953C9470254BE9D
GO

Sequence cautioni

The sequence BAA32293.2 differs from that shown. Reason: Erroneous initiation. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4141MGLLR…SRSKL → MLFIKFIHLEVFSMP in isoform 2. 1 PublicationVSP_014062Add
BLAST
Alternative sequencei230 – 356127Missing in isoform 3. 1 PublicationVSP_014063Add
BLAST
Alternative sequencei282 – 35675GKKSH…YPKSN → APDTATPSHRHGPICGSKSI SSLLVKVSPVCKDSHCLGKC SRNGLSAV in isoform 2. 1 PublicationVSP_014064Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB024568 mRNA. Translation: BAA89250.1.
AB007917 mRNA. Translation: BAA32293.2. Different initiation.
AK002179 mRNA. Translation: BAA92125.1.
AL139139, AC093155 Genomic DNA. Translation: CAI19004.1.
AL121989 Genomic DNA. Translation: CAC04187.1.
CH471097 Genomic DNA. Translation: EAW73171.1.
CH471097 Genomic DNA. Translation: EAW73172.1.
BC025384 mRNA. Translation: AAH25384.1.
BC025990 mRNA. Translation: AAH25990.1.
BC108735 mRNA. Translation: AAI08736.1.
CCDSiCCDS44171.1. [Q7LGA3-3]
CCDS711.1. [Q7LGA3-1]
RefSeqiNP_001127964.1. NM_001134492.1. [Q7LGA3-3]
NP_036394.1. NM_012262.3. [Q7LGA3-1]
UniGeneiHs.743280.

Genome annotation databases

EnsembliENST00000370550; ENSP00000359581; ENSG00000153936. [Q7LGA3-1]
ENST00000370551; ENSP00000359582; ENSG00000153936. [Q7LGA3-3]
GeneIDi9653.
KEGGihsa:9653.
UCSCiuc001dmc.4. human. [Q7LGA3-1]
uc001dme.2. human. [Q7LGA3-2]

Polymorphism databases

DMDMi68052326.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB024568 mRNA. Translation: BAA89250.1.
AB007917 mRNA. Translation: BAA32293.2. Different initiation.
AK002179 mRNA. Translation: BAA92125.1.
AL139139, AC093155 Genomic DNA. Translation: CAI19004.1.
AL121989 Genomic DNA. Translation: CAC04187.1.
CH471097 Genomic DNA. Translation: EAW73171.1.
CH471097 Genomic DNA. Translation: EAW73172.1.
BC025384 mRNA. Translation: AAH25384.1.
BC025990 mRNA. Translation: AAH25990.1.
BC108735 mRNA. Translation: AAI08736.1.
CCDSiCCDS44171.1. [Q7LGA3-3]
CCDS711.1. [Q7LGA3-1]
RefSeqiNP_001127964.1. NM_001134492.1. [Q7LGA3-3]
NP_036394.1. NM_012262.3. [Q7LGA3-1]
UniGeneiHs.743280.

3D structure databases

ProteinModelPortaliQ7LGA3.
SMRiQ7LGA3. Positions 69-355.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115011. 13 interactions.
STRINGi9606.ENSP00000359581.

PTM databases

PhosphoSiteiQ7LGA3.

Polymorphism databases

DMDMi68052326.

Proteomic databases

MaxQBiQ7LGA3.
PaxDbiQ7LGA3.
PRIDEiQ7LGA3.

Protocols and materials databases

DNASUi9653.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000370550; ENSP00000359581; ENSG00000153936. [Q7LGA3-1]
ENST00000370551; ENSP00000359582; ENSG00000153936. [Q7LGA3-3]
GeneIDi9653.
KEGGihsa:9653.
UCSCiuc001dmc.4. human. [Q7LGA3-1]
uc001dme.2. human. [Q7LGA3-2]

Organism-specific databases

CTDi9653.
GeneCardsiGC01P087380.
H-InvDBHIX0000755.
HGNCiHGNC:5193. HS2ST1.
HPAiHPA043069.
HPA043603.
MIMi604844. gene.
neXtProtiNX_Q7LGA3.
PharmGKBiPA29466.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG293591.
GeneTreeiENSGT00530000063408.
HOVERGENiHBG053202.
InParanoidiQ7LGA3.
KOiK02513.
OMAiLQQSEIW.
OrthoDBiEOG7PS1J6.
PhylomeDBiQ7LGA3.
TreeFamiTF315238.

Enzyme and pathway databases

BioCyciMetaCyc:ENSG00000153936-MONOMER.
ReactomeiREACT_121248. HS-GAG biosynthesis.

Miscellaneous databases

ChiTaRSiHS2ST1. human.
GeneWikiiHS2ST1.
GenomeRNAii9653.
NextBioi36237.
PROiQ7LGA3.
SOURCEiSearch...

Gene expression databases

BgeeiQ7LGA3.
CleanExiHS_HS2ST1.
ExpressionAtlasiQ7LGA3. baseline and differential.
GenevestigatoriQ7LGA3.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR007734. Heparan_SO4_2-O-STrfase.
IPR027417. P-loop_NTPase.
IPR005331. Sulfotransferase.
[Graphical view]
PANTHERiPTHR12129. PTHR12129. 1 hit.
PfamiPF03567. Sulfotransfer_2. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Human heparan sulfate 2-O-sulfotransferase."
    Habuchi H.
    Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Characterization of cDNA clones in size-fractionated cDNA libraries from human brain."
    Seki N., Ohira M., Nagase T., Ishikawa K., Miyajima N., Nakajima D., Nomura N., Ohara O.
    DNA Res. 4:345-349(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Placenta.
  4. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Brain, Ovary and Testis.
  7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiHS2ST_HUMAN
AccessioniPrimary (citable) accession number: Q7LGA3
Secondary accession number(s): D3DT22
, O75036, Q32NB5, Q8TAC5, Q9H441, Q9NUJ9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 21, 2005
Last sequence update: July 5, 2004
Last modified: March 4, 2015
This is version 100 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.