Q7LGA3 (HS2ST_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 81.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Heparan sulfate 2-O-sulfotransferase 1 Short name=2-O-sulfotransferase Short name=2OST EC=2.8.2.- | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 356 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Catalyzes the transfer of sulfate to the C2-position of selected hexuronic acid residues within the maturing heparan sulfate (HS). 2-O-sulfation within HS, particularly of iduronate residues, is essential for HS to participate in a variety of high-affinity ligand-binding interactions and signaling processes. Mediates 2-O-sulfation of both L-iduronyl and D-glucuronyl residues By similarity. |
| Subunit structure | Homotrimer. Interacts with the C5-epimerase GLCE By similarity. |
| Subcellular location | Golgi apparatus membrane; Single-pass type II membrane protein By similarity. |
| Post-translational modification | N-glycosylated By similarity. |
| Sequence similarities | Belongs to the sulfotransferase 3 family. |
| Sequence caution | The sequence BAA32293.2 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Golgi apparatus Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Signal-anchor Transmembrane Transmembrane helix |
| Molecular function | Transferase |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | carbohydrate metabolic process Traceable author statement. Source: Reactome glycosaminoglycan biosynthetic processTraceable author statement. Source: Reactome small molecule metabolic processTraceable author statement. Source: Reactome |
| Cellular_component | Golgi membrane Traceable author statement. Source: Reactome integral to membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular_function | sulfotransferase activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q7LGA3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q7LGA3-2) The sequence of this isoform differs from the canonical sequence as follows: 1-41: MGLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKL → MLFIKFIHLEVFSMP 282-356: GKKSHLRKTT...FYEKIYPKSN → APDTATPSHR...KCSRNGLSAV | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q7LGA3-3) The sequence of this isoform differs from the canonical sequence as follows: 230-356: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 356 | 356 | Heparan sulfate 2-O-sulfotransferase 1 | PRO_0000207674 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 11 | 11 | Cytoplasmic Potential | ||||||||
| Transmembrane | 12 – 28 | 17 | Helical; Signal-anchor for type II membrane protein; Potential | ||||||||
| Topological domain | 29 – 356 | 328 | Lumenal Potential | ||||||||
Sites | |||||||||||
| Active site | 140 | 1 | By similarity | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 108 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 127 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 201 ↔ 209 | By similarity | |||||||||
| Disulfide bond | 222 ↔ 228 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 41 | 41 | MGLLR…SRSKL → MLFIKFIHLEVFSMP in isoform 2. | VSP_014062 | |||||||
| Alternative sequence | 230 – 356 | 127 | Missing in isoform 3. | VSP_014063 | |||||||
| Alternative sequence | 282 – 356 | 75 | GKKSH…YPKSN → APDTATPSHRHGPICGSKSI SSLLVKVSPVCKDSHCLGKC SRNGLSAV in isoform 2. | VSP_014064 | |||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human heparan sulfate 2-O-sulfotransferase." Habuchi H. Submitted (JAN-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Characterization of cDNA clones in size-fractionated cDNA libraries from human brain." Seki N., Ohira M., Nagase T., Ishikawa K., Miyajima N., Nakajima D., Nomura N., Ohara O. DNA Res. 4:345-349(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Placenta. |
| [4] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Brain, Ovary and Testis. |
| [7] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB024568 mRNA. Translation: BAA89250.1. AB007917 mRNA. Translation: BAA32293.2. Different initiation. AK002179 mRNA. Translation: BAA92125.1. AL139139, AC093155 Genomic DNA. Translation: CAI19004.1. AL121989 Genomic DNA. Translation: CAC04187.1. CH471097 Genomic DNA. Translation: EAW73171.1. CH471097 Genomic DNA. Translation: EAW73172.1. BC025384 mRNA. Translation: AAH25384.1. BC025990 mRNA. Translation: AAH25990.1. BC108735 mRNA. Translation: AAI08736.1. |
| IPI | IPI00040900. IPI00549891. IPI00552241. |
| RefSeq | NP_001127964.1. NM_001134492.1. NP_036394.1. NM_012262.3. |
| UniGene | Hs.48823. |
3D structure databases | |
| ProteinModelPortal | Q7LGA3. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000359581. |
PTM databases | |
| PhosphoSite | Q7LGA3. |
Polymorphism databases | |
| DMDM | 68052326. |
Proteomic databases | |
| PaxDb | Q7LGA3. |
| PRIDE | Q7LGA3. |
Protocols and materials databases | |
| DNASU | 9653. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000370550; ENSP00000359581; ENSG00000153936. ENST00000370551; ENSP00000359582; ENSG00000153936. |
| GeneID | 9653. |
| KEGG | hsa:9653. |
| UCSC | uc001dmc.4. human. uc001dme.2. human. |
Organism-specific databases | |
| CTD | 9653. |
| GeneCards | GC01P087380. |
| H-InvDB | HIX0000755. |
| HGNC | HGNC:5193. HS2ST1. |
| HPA | HPA043069. HPA043603. |
| MIM | 604844. gene. |
| neXtProt | NX_Q7LGA3. |
| PharmGKB | PA29466. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG293591. |
| HOVERGEN | HBG053202. |
| InParanoid | Q7LGA3. |
| KO | K02513. |
| OMA | HAAECWE. |
| OrthoDB | EOG4VT5XH. |
| PhylomeDB | Q7LGA3. |
Enzyme and pathway databases | |
| Reactome | REACT_111217. Metabolism. REACT_116125. Disease. |
Gene expression databases | |
| ArrayExpress | Q7LGA3. |
| Bgee | Q7LGA3. |
| CleanEx | HS_HS2ST1. |
| Genevestigator | Q7LGA3. |
| GermOnline | ENSG00000153936. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR007734. Heparan_SO4_2-O-STrfase. IPR005331. Sulfotransferase. [Graphical view] |
| PANTHER | PTHR12129. PTHR12129. 1 hit. |
| Pfam | PF03567. Sulfotransfer_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 9653. |
| NextBio | 36237. |
| SOURCE | Search... |
Entry information
| Entry name | HS2ST_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q7LGA3 Secondary accession number(s): D3DT22 Q9NUJ9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
