Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Heparan sulfate 2-O-sulfotransferase 1

Gene

HS2ST1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Catalyzes the transfer of sulfate to the C2-position of selected hexuronic acid residues within the maturing heparan sulfate (HS). 2-O-sulfation within HS, particularly of iduronate residues, is essential for HS to participate in a variety of high-affinity ligand-binding interactions and signaling processes. Mediates 2-O-sulfation of both L-iduronyl and D-glucuronyl residues (By similarity).By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei140By similarity1

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Transferase

Enzyme and pathway databases

BioCyciMetaCyc:ENSG00000153936-MONOMER.
ReactomeiR-HSA-2022928. HS-GAG biosynthesis.

Names & Taxonomyi

Protein namesi
Recommended name:
Heparan sulfate 2-O-sulfotransferase 1 (EC:2.8.2.-)
Short name:
2-O-sulfotransferase
Short name:
2OST
Gene namesi
Name:HS2ST1
Synonyms:HS2ST, KIAA0448
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:5193. HS2ST1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 11CytoplasmicSequence analysisAdd BLAST11
Transmembranei12 – 28Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST17
Topological domaini29 – 356LumenalSequence analysisAdd BLAST328

GO - Cellular componenti

  • Golgi membrane Source: Reactome
  • integral component of membrane Source: UniProtKB-KW
  • membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi9653.
OpenTargetsiENSG00000153936.
ENSG00000267561.
PharmGKBiPA29466.

Polymorphism and mutation databases

BioMutaiHS2ST1.
DMDMi68052326.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002076741 – 356Heparan sulfate 2-O-sulfotransferase 1Add BLAST356

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi108N-linked (GlcNAc...)Sequence analysis1
Glycosylationi127N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi201 ↔ 209By similarity
Disulfide bondi222 ↔ 228By similarity

Post-translational modificationi

N-glycosylated.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

EPDiQ7LGA3.
MaxQBiQ7LGA3.
PaxDbiQ7LGA3.
PeptideAtlasiQ7LGA3.
PRIDEiQ7LGA3.

PTM databases

iPTMnetiQ7LGA3.
PhosphoSitePlusiQ7LGA3.

Expressioni

Gene expression databases

BgeeiENSG00000153936.
CleanExiHS_HS2ST1.
ExpressionAtlasiQ7LGA3. baseline and differential.
GenevisibleiQ7LGA3. HS.

Organism-specific databases

HPAiHPA043069.
HPA043603.

Interactioni

Subunit structurei

Homotrimer. Interacts with the C5-epimerase GLCE (By similarity).By similarity

Protein-protein interaction databases

BioGridi115011. 19 interactors.
IntActiQ7LGA3. 1 interactor.
STRINGi9606.ENSP00000359581.

Structurei

3D structure databases

ProteinModelPortaliQ7LGA3.
SMRiQ7LGA3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the sulfotransferase 3 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3922. Eukaryota.
ENOG410XTA1. LUCA.
GeneTreeiENSGT00530000063408.
HOVERGENiHBG053202.
InParanoidiQ7LGA3.
KOiK02513.
OMAiSEIRLEH.
OrthoDBiEOG091G0CSZ.
PhylomeDBiQ7LGA3.
TreeFamiTF315238.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR007734. Heparan_SO4_2-O-STrfase.
IPR027417. P-loop_NTPase.
IPR005331. Sulfotransferase.
[Graphical view]
PANTHERiPTHR12129. PTHR12129. 1 hit.
PfamiPF03567. Sulfotransfer_2. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7LGA3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGLLRIMMPP KLQLLAVVAF AVAMLFLENQ IQKLEESRSK LERAIARHEV
60 70 80 90 100
REIEQRHTMD GPRQDATLDE EEDMVIIYNR VPKTASTSFT NIAYDLCAKN
110 120 130 140 150
KYHVLHINTT KNNPVMSLQD QVRFVKNITS WKEMKPGFYH GHVSYLDFAK
160 170 180 190 200
FGVKKKPIYI NVIRDPIERL VSYYYFLRFG DDYRPGLRRR KQGDKKTFDE
210 220 230 240 250
CVAEGGSDCA PEKLWLQIPF FCGHSSECWN VGSRWAMDQA KYNLINEYFL
260 270 280 290 300
VGVTEELEDF IMLLEAALPR FFRGATELYR TGKKSHLRKT TEKKLPTKQT
310 320 330 340 350
IAKLQQSDIW KMENEFYEFA LEQFQFIRAH AVREKDGDLY ILAQNFFYEK

IYPKSN
Length:356
Mass (Da):41,881
Last modified:July 5, 2004 - v1
Checksum:i2F5BBDFC7DF50F78
GO
Isoform 2 (identifier: Q7LGA3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MGLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKL → MLFIKFIHLEVFSMP
     282-356: GKKSHLRKTT...FYEKIYPKSN → APDTATPSHR...KCSRNGLSAV

Note: No experimental confirmation available.
Show »
Length:303
Mass (Da):34,907
Checksum:i33F937D451024A45
GO
Isoform 3 (identifier: Q7LGA3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     230-356: Missing.

Note: No experimental confirmation available.
Show »
Length:229
Mass (Da):26,757
Checksum:iF953C9470254BE9D
GO

Sequence cautioni

The sequence BAA32293 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0140621 – 41MGLLR…SRSKL → MLFIKFIHLEVFSMP in isoform 2. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_014063230 – 356Missing in isoform 3. 1 PublicationAdd BLAST127
Alternative sequenceiVSP_014064282 – 356GKKSH…YPKSN → APDTATPSHRHGPICGSKSI SSLLVKVSPVCKDSHCLGKC SRNGLSAV in isoform 2. 1 PublicationAdd BLAST75

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB024568 mRNA. Translation: BAA89250.1.
AB007917 mRNA. Translation: BAA32293.2. Different initiation.
AK002179 mRNA. Translation: BAA92125.1.
AL139139, AC093155 Genomic DNA. Translation: CAI19004.1.
AL121989 Genomic DNA. Translation: CAC04187.1.
CH471097 Genomic DNA. Translation: EAW73171.1.
CH471097 Genomic DNA. Translation: EAW73172.1.
BC025384 mRNA. Translation: AAH25384.1.
BC025990 mRNA. Translation: AAH25990.1.
BC108735 mRNA. Translation: AAI08736.1.
CCDSiCCDS44171.1. [Q7LGA3-3]
CCDS711.1. [Q7LGA3-1]
RefSeqiNP_001127964.1. NM_001134492.1. [Q7LGA3-3]
NP_036394.1. NM_012262.3. [Q7LGA3-1]
UniGeneiHs.743280.

Genome annotation databases

EnsembliENST00000370550; ENSP00000359581; ENSG00000153936. [Q7LGA3-1]
ENST00000370551; ENSP00000359582; ENSG00000153936. [Q7LGA3-3]
GeneIDi9653.
KEGGihsa:9653.
UCSCiuc001dmc.5. human. [Q7LGA3-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB024568 mRNA. Translation: BAA89250.1.
AB007917 mRNA. Translation: BAA32293.2. Different initiation.
AK002179 mRNA. Translation: BAA92125.1.
AL139139, AC093155 Genomic DNA. Translation: CAI19004.1.
AL121989 Genomic DNA. Translation: CAC04187.1.
CH471097 Genomic DNA. Translation: EAW73171.1.
CH471097 Genomic DNA. Translation: EAW73172.1.
BC025384 mRNA. Translation: AAH25384.1.
BC025990 mRNA. Translation: AAH25990.1.
BC108735 mRNA. Translation: AAI08736.1.
CCDSiCCDS44171.1. [Q7LGA3-3]
CCDS711.1. [Q7LGA3-1]
RefSeqiNP_001127964.1. NM_001134492.1. [Q7LGA3-3]
NP_036394.1. NM_012262.3. [Q7LGA3-1]
UniGeneiHs.743280.

3D structure databases

ProteinModelPortaliQ7LGA3.
SMRiQ7LGA3.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115011. 19 interactors.
IntActiQ7LGA3. 1 interactor.
STRINGi9606.ENSP00000359581.

PTM databases

iPTMnetiQ7LGA3.
PhosphoSitePlusiQ7LGA3.

Polymorphism and mutation databases

BioMutaiHS2ST1.
DMDMi68052326.

Proteomic databases

EPDiQ7LGA3.
MaxQBiQ7LGA3.
PaxDbiQ7LGA3.
PeptideAtlasiQ7LGA3.
PRIDEiQ7LGA3.

Protocols and materials databases

DNASUi9653.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000370550; ENSP00000359581; ENSG00000153936. [Q7LGA3-1]
ENST00000370551; ENSP00000359582; ENSG00000153936. [Q7LGA3-3]
GeneIDi9653.
KEGGihsa:9653.
UCSCiuc001dmc.5. human. [Q7LGA3-1]

Organism-specific databases

CTDi9653.
DisGeNETi9653.
GeneCardsiHS2ST1.
H-InvDBHIX0000755.
HGNCiHGNC:5193. HS2ST1.
HPAiHPA043069.
HPA043603.
MIMi604844. gene.
neXtProtiNX_Q7LGA3.
OpenTargetsiENSG00000153936.
ENSG00000267561.
PharmGKBiPA29466.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3922. Eukaryota.
ENOG410XTA1. LUCA.
GeneTreeiENSGT00530000063408.
HOVERGENiHBG053202.
InParanoidiQ7LGA3.
KOiK02513.
OMAiSEIRLEH.
OrthoDBiEOG091G0CSZ.
PhylomeDBiQ7LGA3.
TreeFamiTF315238.

Enzyme and pathway databases

BioCyciMetaCyc:ENSG00000153936-MONOMER.
ReactomeiR-HSA-2022928. HS-GAG biosynthesis.

Miscellaneous databases

ChiTaRSiHS2ST1. human.
GeneWikiiHS2ST1.
GenomeRNAii9653.
PROiQ7LGA3.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000153936.
CleanExiHS_HS2ST1.
ExpressionAtlasiQ7LGA3. baseline and differential.
GenevisibleiQ7LGA3. HS.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR007734. Heparan_SO4_2-O-STrfase.
IPR027417. P-loop_NTPase.
IPR005331. Sulfotransferase.
[Graphical view]
PANTHERiPTHR12129. PTHR12129. 1 hit.
PfamiPF03567. Sulfotransfer_2. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiHS2ST_HUMAN
AccessioniPrimary (citable) accession number: Q7LGA3
Secondary accession number(s): D3DT22
, O75036, Q32NB5, Q8TAC5, Q9H441, Q9NUJ9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 21, 2005
Last sequence update: July 5, 2004
Last modified: November 30, 2016
This is version 116 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.