Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q7LDG7

- GRP2_HUMAN

UniProt

Q7LDG7 - GRP2_HUMAN

Protein

RAS guanyl-releasing protein 2

Gene

RASGRP2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 103 (01 Oct 2014)
      Sequence version 1 (05 Jul 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Functions as a calcium- and DAG-regulated nucleotide exchange factor specifically activating Rap through the exchange of bound GDP for GTP. May also activates other GTPases such as RRAS, RRAS2, NRAS, KRAS but not HRAS. Functions in aggregation of platelets and adhesion of T-lymphocytes and neutrophils probably through inside-out integrin activation. May function in the muscarinic acetylcholine receptor M1/CHRM1 signaling pathway.4 Publications

    Enzyme regulationi

    Isoform 1 and isoform 2 are differently regulated by calcium and DAG.1 Publication

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Calcium bindingi439 – 450121PROSITE-ProRule annotationAdd
    BLAST
    Calcium bindingi468 – 479122PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri498 – 54851Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. calcium ion binding Source: UniProtKB
    2. diacylglycerol binding Source: UniProtKB
    3. guanyl-nucleotide exchange factor activity Source: UniProtKB
    4. lipid binding Source: UniProtKB

    GO - Biological processi

    1. blood coagulation Source: Reactome
    2. platelet activation Source: Reactome
    3. positive regulation of GTPase activity Source: GOC
    4. Ras protein signal transduction Source: UniProtKB
    5. regulation of cell growth Source: UniProtKB
    6. regulation of small GTPase mediated signal transduction Source: InterPro
    7. signal transduction Source: UniProtKB

    Keywords - Molecular functioni

    Guanine-nucleotide releasing factor

    Keywords - Ligandi

    Calcium, Metal-binding, Zinc

    Enzyme and pathway databases

    ReactomeiREACT_15523. Integrin alphaIIb beta3 signaling.
    REACT_163994. FCERI mediated NF-kB activation.
    REACT_2202. Effects of PIP2 hydrolysis.
    REACT_23898. Rap1 signalling.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    RAS guanyl-releasing protein 2
    Alternative name(s):
    Calcium and DAG-regulated guanine nucleotide exchange factor I
    Short name:
    CalDAG-GEFI
    Cdc25-like protein
    Short name:
    hCDC25L
    F25B3.3 kinase-like protein
    Gene namesi
    Name:RASGRP2
    Synonyms:CDC25L, MCG7
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 11

    Organism-specific databases

    HGNCiHGNC:9879. RASGRP2.

    Subcellular locationi

    Cytoplasmcytosol. Cell membrane; Peripheral membrane protein. Cell junctionsynapsesynaptosome Curated. Cell projectionruffle membrane Curated; Peripheral membrane protein Curated
    Note: Found both in the cytosol and associated with membranes. Isoform 2 mainly localizes to the cell membrane. Enriched at juxtamembrane areas and membrane ruffles through association with F-actin. Localizes to the cell bodies and axons of striatal neurons By similarity.By similarity

    GO - Cellular componenti

    1. cell junction Source: UniProtKB-KW
    2. cytosol Source: UniProtKB
    3. neuron projection Source: UniProtKB-SubCell
    4. plasma membrane Source: UniProtKB
    5. ruffle membrane Source: UniProtKB-SubCell
    6. synapse Source: UniProtKB-KW

    Keywords - Cellular componenti

    Cell junction, Cell membrane, Cell projection, Cytoplasm, Membrane, Synapse, Synaptosome

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA34241.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 609609RAS guanyl-releasing protein 2PRO_0000315608Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei116 – 1161PhosphoserineBy similarity
    Modified residuei117 – 1171PhosphoserineBy similarity

    Post-translational modificationi

    Isoform 2 is palmitoylated and myristoylated while isoform 1.1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ7LDG7.
    PaxDbiQ7LDG7.
    PRIDEiQ7LDG7.

    Expressioni

    Tissue specificityi

    Detected in platelets, neutrophils and T lymphocytes (at protein level). Expressed in brain where it is enriched in the striatum. Also expressed in the hematopoietic system. Detected in heart, brain, lung, placenta, liver, skeletal muscle and kidney.5 Publications

    Developmental stagei

    Expressed in fetal brain, lung, liver and kidney.1 Publication

    Gene expression databases

    ArrayExpressiQ7LDG7.
    BgeeiQ7LDG7.
    CleanExiHS_RASGRP2.
    GenevestigatoriQ7LDG7.

    Organism-specific databases

    HPAiHPA015667.

    Interactioni

    Subunit structurei

    Forms a signaling complex with RAP1 and BRAF By similarity. Interacts with RAP1. Interacts with F-actin.By similarity2 Publications

    Protein-protein interaction databases

    BioGridi115529. 4 interactions.
    IntActiQ7LDG7. 3 interactions.
    MINTiMINT-1367716.
    STRINGi9606.ENSP00000338864.

    Structurei

    Secondary structure

    1
    609
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi420 – 43718
    Helixi448 – 4547
    Turni455 – 4573
    Helixi464 – 4674
    Helixi477 – 48610
    Beta strandi490 – 4923

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2MA2NMR-A417-497[»]
    ProteinModelPortaliQ7LDG7.
    SMRiQ7LDG7. Positions 7-550.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini4 – 126123N-terminal Ras-GEFPROSITE-ProRule annotationAdd
    BLAST
    Domaini154 – 387234Ras-GEFPROSITE-ProRule annotationAdd
    BLAST
    Domaini426 – 46136EF-hand 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini455 – 49036EF-hand 2PROSITE-ProRule annotationAdd
    BLAST

    Domaini

    The N-terminal Ras-GEF domain mediates association with F-actin.

    Sequence similaritiesi

    Belongs to the RASGRP family.Curated
    Contains 2 EF-hand domains.PROSITE-ProRule annotation
    Contains 1 N-terminal Ras-GEF domain.PROSITE-ProRule annotation
    Contains 1 phorbol-ester/DAG-type zinc finger.PROSITE-ProRule annotation
    Contains 1 Ras-GEF domain.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri498 – 54851Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiNOG256085.
    HOGENOMiHOG000293171.
    HOVERGENiHBG007513.
    InParanoidiQ7LDG7.
    KOiK12361.
    OMAiFPYLSAF.
    PhylomeDBiQ7LDG7.
    TreeFamiTF312918.

    Family and domain databases

    Gene3Di1.10.238.10. 1 hit.
    1.10.840.10. 1 hit.
    InterProiIPR011992. EF-hand-dom_pair.
    IPR018247. EF_Hand_1_Ca_BS.
    IPR002048. EF_hand_dom.
    IPR002219. Prot_Kinase_C-like_PE/DAG-bd.
    IPR000651. Ras-like_Gua-exchang_fac_N.
    IPR023578. Ras_GEF_dom.
    IPR001895. RasGRF_CDC25.
    [Graphical view]
    PfamiPF00130. C1_1. 1 hit.
    PF13202. EF-hand_5. 1 hit.
    PF00617. RasGEF. 1 hit.
    PF00618. RasGEF_N. 1 hit.
    [Graphical view]
    SMARTiSM00109. C1. 1 hit.
    SM00054. EFh. 2 hits.
    SM00147. RasGEF. 1 hit.
    SM00229. RasGEFN. 1 hit.
    [Graphical view]
    SUPFAMiSSF48366. SSF48366. 1 hit.
    PROSITEiPS00018. EF_HAND_1. 2 hits.
    PS50222. EF_HAND_2. 2 hits.
    PS50009. RASGEF_CAT. 1 hit.
    PS50212. RASGEF_NTER. 1 hit.
    PS00479. ZF_DAG_PE_1. 1 hit.
    PS50081. ZF_DAG_PE_2. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q7LDG7-1) [UniParc]FASTAAdd to Basket

    Also known as: CalDAG-GEFI, CalDAG-GEFIa

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAGTLDLDKG CTVEELLRGC IEAFDDSGKV RDPQLVRMFL MMHPWYIPSS    50
    QLAAKLLHIY QQSRKDNSNS LQVKTCHLVR YWISAFPAEF DLNPELAEQI 100
    KELKALLDQE GNRRHSSLID IDSVPTYKWK RQVTQRNPVG QKKRKMSLLF 150
    DHLEPMELAE HLTYLEYRSF CKILFQDYHS FVTHGCTVDN PVLERFISLF 200
    NSVSQWVQLM ILSKPTAPQR ALVITHFVHV AEKLLQLQNF NTLMAVVGGL 250
    SHSSISRLKE THSHVSPETI KLWEGLTELV TATGNYGNYR RRLAACVGFR 300
    FPILGVHLKD LVALQLALPD WLDPARTRLN GAKMKQLFSI LEELAMVTSL 350
    RPPVQANPDL LSLLTVSLDQ YQTEDELYQL SLQREPRSKS SPTSPTSCTP 400
    PPRPPVLEEW TSAAKPKLDQ ALVVEHIEKM VESVFRNFDV DGDGHISQEE 450
    FQIIRGNFPY LSAFGDLDQN QDGCISREEM VSYFLRSSSV LGGRMGFVHN 500
    FQESNSLRPV ACRHCKALIL GIYKQGLKCR ACGVNCHKQC KDRLSVECRR 550
    RAQSVSLEGS APSPSPMHSH HHRAFSFSLP RPGRRGSRPP EIREEEVQTV 600
    EDGVFDIHL 609
    Length:609
    Mass (Da):69,248
    Last modified:July 5, 2004 - v1
    Checksum:i8B1321F864D24BC7
    GO
    Isoform 2 (identifier: Q7LDG7-2) [UniParc]FASTAAdd to Basket

    Also known as: RasGRP2

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MGTQRLCGRGTQGWPGSSEQHVQEATSSAGLHSGVDELGVRSEPGGRLPERSLGPAHPAPAAM

    Show »
    Length:671
    Mass (Da):75,547
    Checksum:i67B7BD2B4F4AED4D
    GO
    Isoform 3 (identifier: Q7LDG7-3) [UniParc]FASTAAdd to Basket

    Also known as: CalDAG-GEFIb

    The sequence of this isoform differs from the canonical sequence as follows:
         125-125: P → CVGAEHRGLGGHSVSYTICA
         126-609: Missing.

    Note: The corresponding protein is not undetectable.

    Show »
    Length:144
    Mass (Da):16,203
    Checksum:i23E5F426383B4F9A
    GO
    Isoform 4 (identifier: Q7LDG7-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         590-590: P → PA

    Note: No experimental confirmation available.

    Show »
    Length:610
    Mass (Da):69,320
    Checksum:i612917B4711357F9
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti493 – 4931G → A.
    Corresponds to variant rs2301562 [ dbSNP | Ensembl ].
    VAR_038257

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MGTQRLCGRGTQGWPGSSEQ HVQEATSSAGLHSGVDELGV RSEPGGRLPERSLGPAHPAP AAM in isoform 2. 1 PublicationVSP_030574
    Alternative sequencei125 – 1251P → CVGAEHRGLGGHSVSYTICA in isoform 3. CuratedVSP_030575
    Alternative sequencei126 – 609484Missing in isoform 3. CuratedVSP_030576Add
    BLAST
    Alternative sequencei590 – 5901P → PA in isoform 4. 1 PublicationVSP_054132

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Y12336 mRNA. Translation: CAA73005.1.
    AF081194 mRNA. Translation: AAC79698.1.
    U78170 mRNA. Translation: AAD12741.1.
    AF043722 mRNA. Translation: AAF07219.1.
    AF043723 mRNA. Translation: AAF07220.1.
    AK092882 mRNA. Translation: BAG52620.1.
    AP001462 Genomic DNA. No translation available.
    CH471076 Genomic DNA. Translation: EAW74281.1.
    BC117151 mRNA. Translation: AAI17152.1.
    CCDSiCCDS31598.1. [Q7LDG7-1]
    RefSeqiNP_001092140.1. NM_001098670.1. [Q7LDG7-1]
    NP_001092141.1. NM_001098671.1. [Q7LDG7-1]
    NP_722541.1. NM_153819.1. [Q7LDG7-1]
    XP_006718475.1. XM_006718412.1. [Q7LDG7-1]
    UniGeneiHs.99491.

    Genome annotation databases

    EnsembliENST00000354024; ENSP00000338864; ENSG00000068831. [Q7LDG7-1]
    ENST00000377494; ENSP00000366714; ENSG00000068831. [Q7LDG7-4]
    ENST00000377497; ENSP00000366717; ENSG00000068831. [Q7LDG7-1]
    ENST00000394432; ENSP00000377953; ENSG00000068831. [Q7LDG7-1]
    GeneIDi10235.
    KEGGihsa:10235.
    UCSCiuc009ypu.3. human. [Q7LDG7-1]

    Polymorphism databases

    DMDMi74713056.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    RASGRP2base

    RASGRP2 mutation db

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Y12336 mRNA. Translation: CAA73005.1 .
    AF081194 mRNA. Translation: AAC79698.1 .
    U78170 mRNA. Translation: AAD12741.1 .
    AF043722 mRNA. Translation: AAF07219.1 .
    AF043723 mRNA. Translation: AAF07220.1 .
    AK092882 mRNA. Translation: BAG52620.1 .
    AP001462 Genomic DNA. No translation available.
    CH471076 Genomic DNA. Translation: EAW74281.1 .
    BC117151 mRNA. Translation: AAI17152.1 .
    CCDSi CCDS31598.1. [Q7LDG7-1 ]
    RefSeqi NP_001092140.1. NM_001098670.1. [Q7LDG7-1 ]
    NP_001092141.1. NM_001098671.1. [Q7LDG7-1 ]
    NP_722541.1. NM_153819.1. [Q7LDG7-1 ]
    XP_006718475.1. XM_006718412.1. [Q7LDG7-1 ]
    UniGenei Hs.99491.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2MA2 NMR - A 417-497 [» ]
    ProteinModelPortali Q7LDG7.
    SMRi Q7LDG7. Positions 7-550.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 115529. 4 interactions.
    IntActi Q7LDG7. 3 interactions.
    MINTi MINT-1367716.
    STRINGi 9606.ENSP00000338864.

    Polymorphism databases

    DMDMi 74713056.

    Proteomic databases

    MaxQBi Q7LDG7.
    PaxDbi Q7LDG7.
    PRIDEi Q7LDG7.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000354024 ; ENSP00000338864 ; ENSG00000068831 . [Q7LDG7-1 ]
    ENST00000377494 ; ENSP00000366714 ; ENSG00000068831 . [Q7LDG7-4 ]
    ENST00000377497 ; ENSP00000366717 ; ENSG00000068831 . [Q7LDG7-1 ]
    ENST00000394432 ; ENSP00000377953 ; ENSG00000068831 . [Q7LDG7-1 ]
    GeneIDi 10235.
    KEGGi hsa:10235.
    UCSCi uc009ypu.3. human. [Q7LDG7-1 ]

    Organism-specific databases

    CTDi 10235.
    GeneCardsi GC11M064494.
    HGNCi HGNC:9879. RASGRP2.
    HPAi HPA015667.
    MIMi 605577. gene.
    neXtProti NX_Q7LDG7.
    PharmGKBi PA34241.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG256085.
    HOGENOMi HOG000293171.
    HOVERGENi HBG007513.
    InParanoidi Q7LDG7.
    KOi K12361.
    OMAi FPYLSAF.
    PhylomeDBi Q7LDG7.
    TreeFami TF312918.

    Enzyme and pathway databases

    Reactomei REACT_15523. Integrin alphaIIb beta3 signaling.
    REACT_163994. FCERI mediated NF-kB activation.
    REACT_2202. Effects of PIP2 hydrolysis.
    REACT_23898. Rap1 signalling.

    Miscellaneous databases

    ChiTaRSi RASGRP2. human.
    GeneWikii RASGRP2.
    GenomeRNAii 10235.
    NextBioi 35462476.
    PROi Q7LDG7.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q7LDG7.
    Bgeei Q7LDG7.
    CleanExi HS_RASGRP2.
    Genevestigatori Q7LDG7.

    Family and domain databases

    Gene3Di 1.10.238.10. 1 hit.
    1.10.840.10. 1 hit.
    InterProi IPR011992. EF-hand-dom_pair.
    IPR018247. EF_Hand_1_Ca_BS.
    IPR002048. EF_hand_dom.
    IPR002219. Prot_Kinase_C-like_PE/DAG-bd.
    IPR000651. Ras-like_Gua-exchang_fac_N.
    IPR023578. Ras_GEF_dom.
    IPR001895. RasGRF_CDC25.
    [Graphical view ]
    Pfami PF00130. C1_1. 1 hit.
    PF13202. EF-hand_5. 1 hit.
    PF00617. RasGEF. 1 hit.
    PF00618. RasGEF_N. 1 hit.
    [Graphical view ]
    SMARTi SM00109. C1. 1 hit.
    SM00054. EFh. 2 hits.
    SM00147. RasGEF. 1 hit.
    SM00229. RasGEFN. 1 hit.
    [Graphical view ]
    SUPFAMi SSF48366. SSF48366. 1 hit.
    PROSITEi PS00018. EF_HAND_1. 2 hits.
    PS50222. EF_HAND_2. 2 hits.
    PS50009. RASGEF_CAT. 1 hit.
    PS50212. RASGEF_NTER. 1 hit.
    PS00479. ZF_DAG_PE_1. 1 hit.
    PS50081. ZF_DAG_PE_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The germinal centre kinase gene and a novel CDC25-like gene are located in the vicinity of the PYGM gene on 11q13."
      Kedra D., Seroussi E., Fransson I., Trifunovic J., Clark M., Lagercrantz J., Blennow E., Mehlin H., Dumanski J.
      Hum. Genet. 100:611-619(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
      Tissue: Frontal cortex.
    3. "Characterization of RasGRP2, a plasma membrane-targeted, dual specificity Ras/Rap exchange factor."
      Clyde-Smith J., Silins G., Gartside M., Grimmond S., Etheridge M., Apolloni A., Hayward N., Hancock J.F.
      J. Biol. Chem. 275:32260-32267(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, ENZYME REGULATION, SUBCELLULAR LOCATION, TOPOLOGY, PALMITOYLATION, MYRISTOYLATION, TISSUE SPECIFICITY.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Tissue: Spleen.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    8. "Activation of the Rap1 guanine nucleotide exchange gene, CalDAG-GEF I, in BXH-2 murine myeloid leukemia."
      Dupuy A.J., Morgan K., von Lintig F.C., Shen H., Acar H., Hasz D.E., Jenkins N.A., Copeland N.G., Boss G.R., Largaespada D.A.
      J. Biol. Chem. 276:11804-11811(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: ALTERNATIVE SPLICING (ISOFORM 3).
    9. "Rap1-mediated lymphocyte function-associated antigen-1 activation by the T cell antigen receptor is dependent on phospholipase C-gamma1."
      Katagiri K., Shimonaka M., Kinashi T.
      J. Biol. Chem. 279:11875-11881(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH RAP1.
    10. "F-actin-dependent translocation of the Rap1 GDP/GTP exchange factor RasGRP2."
      Caloca M.J., Zugaza J.L., Vicente-Manzanares M., Sanchez-Madrid F., Bustelo X.R.
      J. Biol. Chem. 279:20435-20446(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION, INTERACTION WITH F-ACTIN.
    11. "Essential role for Rap1 GTPase and its guanine exchange factor CalDAG-GEFI in LFA-1 but not VLA-4 integrin mediated human T-cell adhesion."
      Ghandour H., Cullere X., Alvarez A., Luscinskas F.W., Mayadas T.N.
      Blood 110:3682-3690(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION IN T-LYMPHOCYTES ADHESION, TISSUE SPECIFICITY.
    12. "A LAD-III syndrome is associated with defective expression of the Rap-1 activator CalDAG-GEFI in lymphocytes, neutrophils, and platelets."
      Pasvolsky R., Feigelson S.W., Kilic S.S., Simon A.J., Tal-Lapidot G., Grabovsky V., Crittenden J.R., Amariglio N., Safran M., Graybiel A.M., Rechavi G., Ben-Dor S., Etzioni A., Alon R.
      J. Exp. Med. 204:1571-1582(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION IN INTEGRIN ACTIVATION, TISSUE SPECIFICITY.
    13. Cited for: LACK OF INVOLVEMENT IN LAD3.
    14. "Leukocyte adhesion deficiency-III is caused by mutations in KINDLIN3 affecting integrin activation."
      Svensson L., Howarth K., McDowall A., Patzak I., Evans R., Ussar S., Moser M., Metin A., Fried M., Tomlinson I., Hogg N.
      Nat. Med. 15:306-312(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: LACK OF INVOLVEMENT IN LAD3.
    15. "A point mutation in KINDLIN3 ablates activation of three integrin subfamilies in humans."
      Malinin N.L., Zhang L., Choi J., Ciocea A., Razorenova O., Ma Y.-Q., Podrez E.A., Tosi M., Lennon D.P., Caplan A.I., Shurin S.B., Plow E.F., Byzova T.V.
      Nat. Med. 15:313-318(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: LACK OF INVOLVEMENT IN LAD3.

    Entry informationi

    Entry nameiGRP2_HUMAN
    AccessioniPrimary (citable) accession number: Q7LDG7
    Secondary accession number(s): A6NDC7, O00538, Q9UL65
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 15, 2008
    Last sequence update: July 5, 2004
    Last modified: October 1, 2014
    This is version 103 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 11
      Human chromosome 11: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3