Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

RAS guanyl-releasing protein 2

Gene

RASGRP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Functions as a calcium- and DAG-regulated nucleotide exchange factor specifically activating Rap through the exchange of bound GDP for GTP. May also activates other GTPases such as RRAS, RRAS2, NRAS, KRAS but not HRAS. Functions in aggregation of platelets and adhesion of T-lymphocytes and neutrophils probably through inside-out integrin activation. May function in the muscarinic acetylcholine receptor M1/CHRM1 signaling pathway.5 Publications

Enzyme regulationi

Isoform 1 and isoform 2 are differently regulated by calcium and DAG.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Calcium bindingi439 – 450121PROSITE-ProRule annotation1 PublicationAdd
BLAST
Calcium bindingi468 – 479122PROSITE-ProRule annotation1 PublicationAdd
BLAST
Zinc fingeri498 – 54851Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. calcium ion binding Source: UniProtKB
  2. diacylglycerol binding Source: UniProtKB
  3. guanyl-nucleotide exchange factor activity Source: UniProtKB
  4. lipid binding Source: UniProtKB

GO - Biological processi

  1. blood coagulation Source: Reactome
  2. cellular response to calcium ion Source: UniProtKB
  3. platelet activation Source: Reactome
  4. positive regulation of Rap GTPase activity Source: UniProtKB
  5. Ras protein signal transduction Source: UniProtKB
  6. regulation of cell growth Source: UniProtKB
  7. signal transduction Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Guanine-nucleotide releasing factor

Keywords - Ligandi

Calcium, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiREACT_15523. Integrin alphaIIb beta3 signaling.
REACT_163994. FCERI mediated NF-kB activation.
REACT_2202. Effects of PIP2 hydrolysis.
REACT_23898. Rap1 signalling.

Names & Taxonomyi

Protein namesi
Recommended name:
RAS guanyl-releasing protein 2
Alternative name(s):
Calcium and DAG-regulated guanine nucleotide exchange factor I
Short name:
CalDAG-GEFI
Cdc25-like protein
Short name:
hCDC25L
F25B3.3 kinase-like protein
Gene namesi
Name:RASGRP2
Synonyms:CDC25L, MCG7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:9879. RASGRP2.

Subcellular locationi

Cytoplasmcytosol. Cell membrane; Peripheral membrane protein. Cell junctionsynapsesynaptosome Curated. Cell projectionruffle membrane Curated; Peripheral membrane protein Curated
Note: Found both in the cytosol and associated with membranes. Isoform 2 mainly localizes to the cell membrane. Enriched at juxtamembrane areas and membrane ruffles through association with F-actin. Localizes to the cell bodies and axons of striatal neurons (By similarity).By similarity

GO - Cellular componenti

  1. cell junction Source: UniProtKB-KW
  2. cytosol Source: UniProtKB
  3. neuron projection Source: UniProtKB-SubCell
  4. plasma membrane Source: UniProtKB
  5. ruffle membrane Source: UniProtKB-SubCell
  6. synapse Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Membrane, Synapse, Synaptosome

Pathology & Biotechi

Involvement in diseasei

Bleeding disorder, platelet-type 18 (BDPLT18)1 Publication

The disease is caused by mutations affecting the gene represented in this entry.

Disease descriptionA disorder characterized by increased bleeding tendency due to platelet dysfunction. Clinical features include epistaxis, hematomas, bleeding after tooth extraction, and menorrhagia.

See also OMIM:615888
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti248 – 2481G → W in BDPLT18; prevents Rap1 activation upon calcium stimulation; reduces platelet adhesion and spreading. 1 Publication
VAR_071474

Keywords - Diseasei

Disease mutation

Organism-specific databases

MIMi615888. phenotype.
PharmGKBiPA34241.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 609609RAS guanyl-releasing protein 2PRO_0000315608Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei116 – 1161PhosphoserineBy similarity
Modified residuei117 – 1171PhosphoserineBy similarity

Post-translational modificationi

Isoform 2 is palmitoylated and myristoylated while isoform 1.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ7LDG7.
PaxDbiQ7LDG7.
PRIDEiQ7LDG7.

Expressioni

Tissue specificityi

Detected in platelets, neutrophils and T lymphocytes (at protein level). Expressed in brain where it is enriched in the striatum. Also expressed in the hematopoietic system. Detected in heart, brain, lung, placenta, liver, skeletal muscle and kidney.5 Publications

Developmental stagei

Expressed in fetal brain, lung, liver and kidney.1 Publication

Gene expression databases

BgeeiQ7LDG7.
CleanExiHS_RASGRP2.
ExpressionAtlasiQ7LDG7. baseline and differential.
GenevestigatoriQ7LDG7.

Organism-specific databases

HPAiHPA015667.

Interactioni

Subunit structurei

Forms a signaling complex with RAP1 and BRAF (By similarity). Interacts with RAP1. Interacts with F-actin.By similarity2 Publications

Protein-protein interaction databases

BioGridi115529. 4 interactions.
IntActiQ7LDG7. 3 interactions.
MINTiMINT-1367716.
STRINGi9606.ENSP00000338864.

Structurei

Secondary structure

1
609
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi420 – 43718Combined sources
Helixi448 – 4547Combined sources
Turni455 – 4573Combined sources
Helixi464 – 4674Combined sources
Helixi477 – 48610Combined sources
Beta strandi490 – 4923Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2MA2NMR-A417-497[»]
SMRiQ7LDG7. Positions 7-550.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini4 – 126123N-terminal Ras-GEFPROSITE-ProRule annotationAdd
BLAST
Domaini154 – 387234Ras-GEFPROSITE-ProRule annotationAdd
BLAST
Domaini426 – 46136EF-hand 1PROSITE-ProRule annotationAdd
BLAST
Domaini455 – 49036EF-hand 2PROSITE-ProRule annotationAdd
BLAST

Domaini

The N-terminal Ras-GEF domain mediates association with F-actin.

Sequence similaritiesi

Belongs to the RASGRP family.Curated
Contains 2 EF-hand domains.PROSITE-ProRule annotation
Contains 1 N-terminal Ras-GEF domain.PROSITE-ProRule annotation
Contains 1 phorbol-ester/DAG-type zinc finger.PROSITE-ProRule annotation
Contains 1 Ras-GEF domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri498 – 54851Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiNOG256085.
GeneTreeiENSGT00780000121847.
HOGENOMiHOG000293171.
HOVERGENiHBG007513.
InParanoidiQ7LDG7.
KOiK12361.
OMAiFPYLSAF.
OrthoDBiEOG72G16V.
PhylomeDBiQ7LDG7.
TreeFamiTF312918.

Family and domain databases

Gene3Di1.10.238.10. 1 hit.
1.10.840.10. 1 hit.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR002219. PE/DAG-bd.
IPR000651. Ras-like_Gua-exchang_fac_N.
IPR023578. Ras_GEF_dom.
IPR001895. RASGEF_cat_dom.
[Graphical view]
PfamiPF00130. C1_1. 1 hit.
PF13202. EF-hand_5. 1 hit.
PF00617. RasGEF. 1 hit.
PF00618. RasGEF_N. 1 hit.
[Graphical view]
SMARTiSM00109. C1. 1 hit.
SM00054. EFh. 2 hits.
SM00147. RasGEF. 1 hit.
SM00229. RasGEFN. 1 hit.
[Graphical view]
SUPFAMiSSF48366. SSF48366. 1 hit.
PROSITEiPS00018. EF_HAND_1. 2 hits.
PS50222. EF_HAND_2. 2 hits.
PS50009. RASGEF_CAT. 1 hit.
PS50212. RASGEF_NTER. 1 hit.
PS00479. ZF_DAG_PE_1. 1 hit.
PS50081. ZF_DAG_PE_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7LDG7-1) [UniParc]FASTAAdd to basket

Also known as: CalDAG-GEFI, CalDAG-GEFIa

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGTLDLDKG CTVEELLRGC IEAFDDSGKV RDPQLVRMFL MMHPWYIPSS
60 70 80 90 100
QLAAKLLHIY QQSRKDNSNS LQVKTCHLVR YWISAFPAEF DLNPELAEQI
110 120 130 140 150
KELKALLDQE GNRRHSSLID IDSVPTYKWK RQVTQRNPVG QKKRKMSLLF
160 170 180 190 200
DHLEPMELAE HLTYLEYRSF CKILFQDYHS FVTHGCTVDN PVLERFISLF
210 220 230 240 250
NSVSQWVQLM ILSKPTAPQR ALVITHFVHV AEKLLQLQNF NTLMAVVGGL
260 270 280 290 300
SHSSISRLKE THSHVSPETI KLWEGLTELV TATGNYGNYR RRLAACVGFR
310 320 330 340 350
FPILGVHLKD LVALQLALPD WLDPARTRLN GAKMKQLFSI LEELAMVTSL
360 370 380 390 400
RPPVQANPDL LSLLTVSLDQ YQTEDELYQL SLQREPRSKS SPTSPTSCTP
410 420 430 440 450
PPRPPVLEEW TSAAKPKLDQ ALVVEHIEKM VESVFRNFDV DGDGHISQEE
460 470 480 490 500
FQIIRGNFPY LSAFGDLDQN QDGCISREEM VSYFLRSSSV LGGRMGFVHN
510 520 530 540 550
FQESNSLRPV ACRHCKALIL GIYKQGLKCR ACGVNCHKQC KDRLSVECRR
560 570 580 590 600
RAQSVSLEGS APSPSPMHSH HHRAFSFSLP RPGRRGSRPP EIREEEVQTV

EDGVFDIHL
Length:609
Mass (Da):69,248
Last modified:July 5, 2004 - v1
Checksum:i8B1321F864D24BC7
GO
Isoform 2 (identifier: Q7LDG7-2) [UniParc]FASTAAdd to basket

Also known as: RasGRP2

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGTQRLCGRGTQGWPGSSEQHVQEATSSAGLHSGVDELGVRSEPGGRLPERSLGPAHPAPAAM

Show »
Length:671
Mass (Da):75,547
Checksum:i67B7BD2B4F4AED4D
GO
Isoform 3 (identifier: Q7LDG7-3) [UniParc]FASTAAdd to basket

Also known as: CalDAG-GEFIb

The sequence of this isoform differs from the canonical sequence as follows:
     125-125: P → CVGAEHRGLGGHSVSYTICA
     126-609: Missing.

Note: The corresponding protein is not undetectable.

Show »
Length:144
Mass (Da):16,203
Checksum:i23E5F426383B4F9A
GO
Isoform 4 (identifier: Q7LDG7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     590-590: P → PA

Note: No experimental confirmation available.

Show »
Length:610
Mass (Da):69,320
Checksum:i612917B4711357F9
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti248 – 2481G → W in BDPLT18; prevents Rap1 activation upon calcium stimulation; reduces platelet adhesion and spreading. 1 Publication
VAR_071474
Natural varianti493 – 4931G → A.
Corresponds to variant rs2301562 [ dbSNP | Ensembl ].
VAR_038257

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MGTQRLCGRGTQGWPGSSEQ HVQEATSSAGLHSGVDELGV RSEPGGRLPERSLGPAHPAP AAM in isoform 2. 1 PublicationVSP_030574
Alternative sequencei125 – 1251P → CVGAEHRGLGGHSVSYTICA in isoform 3. CuratedVSP_030575
Alternative sequencei126 – 609484Missing in isoform 3. CuratedVSP_030576Add
BLAST
Alternative sequencei590 – 5901P → PA in isoform 4. 1 PublicationVSP_054132

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y12336 mRNA. Translation: CAA73005.1.
AF081194 mRNA. Translation: AAC79698.1.
U78170 mRNA. Translation: AAD12741.1.
AF043722 mRNA. Translation: AAF07219.1.
AF043723 mRNA. Translation: AAF07220.1.
AK092882 mRNA. Translation: BAG52620.1.
AP001462 Genomic DNA. No translation available.
CH471076 Genomic DNA. Translation: EAW74281.1.
BC117151 mRNA. Translation: AAI17152.1.
CCDSiCCDS31598.1. [Q7LDG7-1]
RefSeqiNP_001092140.1. NM_001098670.1. [Q7LDG7-1]
NP_001092141.1. NM_001098671.1. [Q7LDG7-1]
NP_722541.1. NM_153819.1. [Q7LDG7-1]
XP_006718475.1. XM_006718412.1. [Q7LDG7-1]
UniGeneiHs.99491.

Genome annotation databases

EnsembliENST00000354024; ENSP00000338864; ENSG00000068831. [Q7LDG7-1]
ENST00000377494; ENSP00000366714; ENSG00000068831. [Q7LDG7-4]
ENST00000377497; ENSP00000366717; ENSG00000068831. [Q7LDG7-1]
ENST00000394432; ENSP00000377953; ENSG00000068831. [Q7LDG7-1]
GeneIDi10235.
KEGGihsa:10235.
UCSCiuc001oat.3. human.
uc009ypu.3. human. [Q7LDG7-1]

Polymorphism databases

DMDMi74713056.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

RASGRP2base

RASGRP2 mutation db

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y12336 mRNA. Translation: CAA73005.1.
AF081194 mRNA. Translation: AAC79698.1.
U78170 mRNA. Translation: AAD12741.1.
AF043722 mRNA. Translation: AAF07219.1.
AF043723 mRNA. Translation: AAF07220.1.
AK092882 mRNA. Translation: BAG52620.1.
AP001462 Genomic DNA. No translation available.
CH471076 Genomic DNA. Translation: EAW74281.1.
BC117151 mRNA. Translation: AAI17152.1.
CCDSiCCDS31598.1. [Q7LDG7-1]
RefSeqiNP_001092140.1. NM_001098670.1. [Q7LDG7-1]
NP_001092141.1. NM_001098671.1. [Q7LDG7-1]
NP_722541.1. NM_153819.1. [Q7LDG7-1]
XP_006718475.1. XM_006718412.1. [Q7LDG7-1]
UniGeneiHs.99491.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2MA2NMR-A417-497[»]
SMRiQ7LDG7. Positions 7-550.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115529. 4 interactions.
IntActiQ7LDG7. 3 interactions.
MINTiMINT-1367716.
STRINGi9606.ENSP00000338864.

Polymorphism databases

DMDMi74713056.

Proteomic databases

MaxQBiQ7LDG7.
PaxDbiQ7LDG7.
PRIDEiQ7LDG7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000354024; ENSP00000338864; ENSG00000068831. [Q7LDG7-1]
ENST00000377494; ENSP00000366714; ENSG00000068831. [Q7LDG7-4]
ENST00000377497; ENSP00000366717; ENSG00000068831. [Q7LDG7-1]
ENST00000394432; ENSP00000377953; ENSG00000068831. [Q7LDG7-1]
GeneIDi10235.
KEGGihsa:10235.
UCSCiuc001oat.3. human.
uc009ypu.3. human. [Q7LDG7-1]

Organism-specific databases

CTDi10235.
GeneCardsiGC11M064494.
HGNCiHGNC:9879. RASGRP2.
HPAiHPA015667.
MIMi605577. gene.
615888. phenotype.
neXtProtiNX_Q7LDG7.
PharmGKBiPA34241.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG256085.
GeneTreeiENSGT00780000121847.
HOGENOMiHOG000293171.
HOVERGENiHBG007513.
InParanoidiQ7LDG7.
KOiK12361.
OMAiFPYLSAF.
OrthoDBiEOG72G16V.
PhylomeDBiQ7LDG7.
TreeFamiTF312918.

Enzyme and pathway databases

ReactomeiREACT_15523. Integrin alphaIIb beta3 signaling.
REACT_163994. FCERI mediated NF-kB activation.
REACT_2202. Effects of PIP2 hydrolysis.
REACT_23898. Rap1 signalling.

Miscellaneous databases

GeneWikiiRASGRP2.
GenomeRNAii10235.
NextBioi35462476.
PROiQ7LDG7.
SOURCEiSearch...

Gene expression databases

BgeeiQ7LDG7.
CleanExiHS_RASGRP2.
ExpressionAtlasiQ7LDG7. baseline and differential.
GenevestigatoriQ7LDG7.

Family and domain databases

Gene3Di1.10.238.10. 1 hit.
1.10.840.10. 1 hit.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR002219. PE/DAG-bd.
IPR000651. Ras-like_Gua-exchang_fac_N.
IPR023578. Ras_GEF_dom.
IPR001895. RASGEF_cat_dom.
[Graphical view]
PfamiPF00130. C1_1. 1 hit.
PF13202. EF-hand_5. 1 hit.
PF00617. RasGEF. 1 hit.
PF00618. RasGEF_N. 1 hit.
[Graphical view]
SMARTiSM00109. C1. 1 hit.
SM00054. EFh. 2 hits.
SM00147. RasGEF. 1 hit.
SM00229. RasGEFN. 1 hit.
[Graphical view]
SUPFAMiSSF48366. SSF48366. 1 hit.
PROSITEiPS00018. EF_HAND_1. 2 hits.
PS50222. EF_HAND_2. 2 hits.
PS50009. RASGEF_CAT. 1 hit.
PS50212. RASGEF_NTER. 1 hit.
PS00479. ZF_DAG_PE_1. 1 hit.
PS50081. ZF_DAG_PE_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The germinal centre kinase gene and a novel CDC25-like gene are located in the vicinity of the PYGM gene on 11q13."
    Kedra D., Seroussi E., Fransson I., Trifunovic J., Clark M., Lagercrantz J., Blennow E., Mehlin H., Dumanski J.
    Hum. Genet. 100:611-619(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
  2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    Tissue: Frontal cortex.
  3. "Characterization of RasGRP2, a plasma membrane-targeted, dual specificity Ras/Rap exchange factor."
    Clyde-Smith J., Silins G., Gartside M., Grimmond S., Etheridge M., Apolloni A., Hayward N., Hancock J.F.
    J. Biol. Chem. 275:32260-32267(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, ENZYME REGULATION, SUBCELLULAR LOCATION, TOPOLOGY, PALMITOYLATION, MYRISTOYLATION, TISSUE SPECIFICITY.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Spleen.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  8. "Activation of the Rap1 guanine nucleotide exchange gene, CalDAG-GEF I, in BXH-2 murine myeloid leukemia."
    Dupuy A.J., Morgan K., von Lintig F.C., Shen H., Acar H., Hasz D.E., Jenkins N.A., Copeland N.G., Boss G.R., Largaespada D.A.
    J. Biol. Chem. 276:11804-11811(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: ALTERNATIVE SPLICING (ISOFORM 3).
  9. "Rap1-mediated lymphocyte function-associated antigen-1 activation by the T cell antigen receptor is dependent on phospholipase C-gamma1."
    Katagiri K., Shimonaka M., Kinashi T.
    J. Biol. Chem. 279:11875-11881(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH RAP1.
  10. "F-actin-dependent translocation of the Rap1 GDP/GTP exchange factor RasGRP2."
    Caloca M.J., Zugaza J.L., Vicente-Manzanares M., Sanchez-Madrid F., Bustelo X.R.
    J. Biol. Chem. 279:20435-20446(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, INTERACTION WITH F-ACTIN.
  11. "Essential role for Rap1 GTPase and its guanine exchange factor CalDAG-GEFI in LFA-1 but not VLA-4 integrin mediated human T-cell adhesion."
    Ghandour H., Cullere X., Alvarez A., Luscinskas F.W., Mayadas T.N.
    Blood 110:3682-3690(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN T-LYMPHOCYTES ADHESION, TISSUE SPECIFICITY.
  12. "A LAD-III syndrome is associated with defective expression of the Rap-1 activator CalDAG-GEFI in lymphocytes, neutrophils, and platelets."
    Pasvolsky R., Feigelson S.W., Kilic S.S., Simon A.J., Tal-Lapidot G., Grabovsky V., Crittenden J.R., Amariglio N., Safran M., Graybiel A.M., Rechavi G., Ben-Dor S., Etzioni A., Alon R.
    J. Exp. Med. 204:1571-1582(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN INTEGRIN ACTIVATION, TISSUE SPECIFICITY.
  13. Cited for: LACK OF INVOLVEMENT IN LAD3.
  14. "Leukocyte adhesion deficiency-III is caused by mutations in KINDLIN3 affecting integrin activation."
    Svensson L., Howarth K., McDowall A., Patzak I., Evans R., Ussar S., Moser M., Metin A., Fried M., Tomlinson I., Hogg N.
    Nat. Med. 15:306-312(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: LACK OF INVOLVEMENT IN LAD3.
  15. "A point mutation in KINDLIN3 ablates activation of three integrin subfamilies in humans."
    Malinin N.L., Zhang L., Choi J., Ciocea A., Razorenova O., Ma Y.-Q., Podrez E.A., Tosi M., Lennon D.P., Caplan A.I., Shurin S.B., Plow E.F., Byzova T.V.
    Nat. Med. 15:313-318(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: LACK OF INVOLVEMENT IN LAD3.
  16. Cited for: FUNCTION, INVOLVEMENT IN BDPLT18, VARIANT BDPLT18 TRP-248, CHARACTERIZATION OF VARIANT BDPLT18 TRP-248.
  17. "Structural analysis of autoinhibition in the Ras-specific exchange factor RasGRP1."
    Iwig J.S., Vercoulen Y., Das R., Barros T., Limnander A., Che Y., Pelton J.G., Wemmer D.E., Roose J.P., Kuriyan J.
    Elife 2:E00813-E00813(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: STRUCTURE BY NMR OF 417-497 IN COMPLEX WITH CALCIUM.

Entry informationi

Entry nameiGRP2_HUMAN
AccessioniPrimary (citable) accession number: Q7LDG7
Secondary accession number(s): A6NDC7, O00538, Q9UL65
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: July 5, 2004
Last modified: April 1, 2015
This is version 109 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

Defects in RASGRP2 were initially thought (PubMed:17576779) to be the cause of leukocyte adhesion deficiency type 3 (LAD3), a syndrome characterized by recurrent bacterial infections and major bleeding disorders. However, it was later shown (PubMed:19064721, PubMed:19234463 and PubMed:19234460) that it is not the case and that LAD3 is caused by defects in FERMT3 gene.1 Publication

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.