Q7LDG7 (GRP2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 88.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: RAS guanyl-releasing protein 2 Alternative name(s): Calcium and DAG-regulated guanine nucleotide exchange factor I Short name=CalDAG-GEFI Cdc25-like protein Short name=hCDC25L F25B3.3 kinase-like protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 609 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Functions as a calcium- and DAG-regulated nucleotide exchange factor specifically activating Rap through the exchange of bound GDP for GTP. May also activates other GTPases such as RRAS, RRAS2, NRAS, KRAS but not HRAS. Functions in aggregation of platelets and adhesion of T-lymphocytes and neutrophils probably through inside-out integrin activation. May function in the muscarinic acetylcholine receptor M1/CHRM1 signaling pathway. Ref.3 Ref.7 Ref.9 Ref.10 |
| Enzyme regulation | Isoform 1 and isoform 2 are differently regulated by calcium and DAG. Ref.3 |
| Subunit structure | Forms a signaling complex with RAP1 and BRAF By similarity. Interacts with RAP1. Interacts with F-actin. Ref.7 Ref.8 |
| Subcellular location | Cytoplasm › cytosol. Cell membrane; Peripheral membrane protein. Cell junction › synapse › synaptosome Potential. Cell projection › ruffle membrane; Peripheral membrane protein Potential. Note: Found both in the cytosol and associated with membranes. Isoform 2 mainly localizes to the cell membrane. Enriched at juxtamembrane areas and membrane ruffles through association with F-actin. Localizes to the cell bodies and axons of striatal neurons By similarity. Ref.3 Ref.8 |
| Tissue specificity | Detected in platelets, neutrophils and T lymphocytes (at protein level). Expressed in brain where it is enriched in the striatum. Also expressed in the hematopoietic system. Detected in heart, brain, lung, placenta, liver, skeletal muscle and kidney. Ref.1 Ref.2 Ref.3 Ref.9 Ref.10 |
| Developmental stage | Expressed in fetal brain, lung, liver and kidney. Ref.2 |
| Domain | The N-terminal Ras-GEF domain mediates association with F-actin. |
| Post-translational modification | Isoform 2 is palmitoylated and myristoylated while isoform 1. Ref.3 |
| Sequence similarities | Belongs to the RASGRP family. Contains 2 EF-hand domains. Contains 1 N-terminal Ras-GEF domain. Contains 1 phorbol-ester/DAG-type zinc finger. Contains 1 Ras-GEF domain. |
| Caution | Defects in RASGRP2 were initially thought (Ref.10) to be the cause of leukocyte adhesion deficiency type 3 (LAD3), a syndrome characterized by recurrent bacterial infections and major bleeding disorders. However, it was later shown (Ref.11, Ref.12 and Ref.13) that it is not the case and that LAD3 is caused by defects in FERMT3 gene. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q7LDG7-1) Also known as: CalDAG-GEFI; CalDAG-GEFIa; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q7LDG7-2) Also known as: RasGRP2; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MGTQRLCGRGTQGWPGSSEQHVQEATSSAGLHSGVDELGVRSEPGGRLPERSLGPAHPAPAAM | ||||||
| Isoform 3 (identifier: Q7LDG7-3) Also known as: CalDAG-GEFIb; The sequence of this isoform differs from the canonical sequence as follows: 125-125: P → CVGAEHRGLGGHSVSYTICA 126-609: Missing. | ||||||
| Note: The corresponding protein is not undetectable. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 609 | 609 | RAS guanyl-releasing protein 2 | PRO_0000315608 | |||||
Regions | |||||||||
| Domain | 4 – 126 | 123 | N-terminal Ras-GEF | ||||||
| Domain | 154 – 387 | 234 | Ras-GEF | ||||||
| Domain | 426 – 461 | 36 | EF-hand 1 | ||||||
| Domain | 455 – 490 | 36 | EF-hand 2 | ||||||
| Calcium binding | 439 – 450 | 12 | 1 Potential | ||||||
| Calcium binding | 468 – 479 | 12 | 2 Potential | ||||||
| Zinc finger | 498 – 548 | 51 | Phorbol-ester/DAG-type | ||||||
Amino acid modifications | |||||||||
| Modified residue | 116 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 117 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MGTQRLCGRGTQGWPGSSEQ HVQEATSSAGLHSGVDELGV RSEPGGRLPERSLGPAHPAP AAM in isoform 2. | VSP_030574 | |||||
| Alternative sequence | 125 | 1 | P → CVGAEHRGLGGHSVSYTICA in isoform 3. | VSP_030575 | |||||
| Alternative sequence | 126 – 609 | 484 | Missing in isoform 3. | VSP_030576 | |||||
| Natural variant | 493 | 1 | G → A. Corresponds to variant rs2301562 [ dbSNP | Ensembl ]. | VAR_038257 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The germinal centre kinase gene and a novel CDC25-like gene are located in the vicinity of the PYGM gene on 11q13." Kedra D., Seroussi E., Fransson I., Trifunovic J., Clark M., Lagercrantz J., Blennow E., Mehlin H., Dumanski J. Hum. Genet. 100:611-619(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. |
| [2] | "A Rap guanine nucleotide exchange factor enriched highly in the basal ganglia." Kawasaki H., Springett G.M., Toki S., Canales J.J., Harlan P., Blumenstiel J.P., Chen E.J., Bany I.A., Mochizuki N., Ashbacher A., Matsuda M., Housman D.E., Graybiel A.M. Proc. Natl. Acad. Sci. U.S.A. 95:13278-13283(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE. Tissue: Frontal cortex. |
| [3] | "Characterization of RasGRP2, a plasma membrane-targeted, dual specificity Ras/Rap exchange factor." Clyde-Smith J., Silins G., Gartside M., Grimmond S., Etheridge M., Apolloni A., Hayward N., Hancock J.F. J. Biol. Chem. 275:32260-32267(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, ENZYME REGULATION, SUBCELLULAR LOCATION, TOPOLOGY, PALMITOYLATION, MYRISTOYLATION, TISSUE SPECIFICITY. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [6] | "Activation of the Rap1 guanine nucleotide exchange gene, CalDAG-GEF I, in BXH-2 murine myeloid leukemia." Dupuy A.J., Morgan K., von Lintig F.C., Shen H., Acar H., Hasz D.E., Jenkins N.A., Copeland N.G., Boss G.R., Largaespada D.A. J. Biol. Chem. 276:11804-11811(2001) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORM 3). |
| [7] | "Rap1-mediated lymphocyte function-associated antigen-1 activation by the T cell antigen receptor is dependent on phospholipase C-gamma1." Katagiri K., Shimonaka M., Kinashi T. J. Biol. Chem. 279:11875-11881(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH RAP1. |
| [8] | "F-actin-dependent translocation of the Rap1 GDP/GTP exchange factor RasGRP2." Caloca M.J., Zugaza J.L., Vicente-Manzanares M., Sanchez-Madrid F., Bustelo X.R. J. Biol. Chem. 279:20435-20446(2004) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, INTERACTION WITH F-ACTIN. |
| [9] | "Essential role for Rap1 GTPase and its guanine exchange factor CalDAG-GEFI in LFA-1 but not VLA-4 integrin mediated human T-cell adhesion." Ghandour H., Cullere X., Alvarez A., Luscinskas F.W., Mayadas T.N. Blood 110:3682-3690(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN T-LYMPHOCYTES ADHESION, TISSUE SPECIFICITY. |
| [10] | "A LAD-III syndrome is associated with defective expression of the Rap-1 activator CalDAG-GEFI in lymphocytes, neutrophils, and platelets." Pasvolsky R., Feigelson S.W., Kilic S.S., Simon A.J., Tal-Lapidot G., Grabovsky V., Crittenden J.R., Amariglio N., Safran M., Graybiel A.M., Rechavi G., Ben-Dor S., Etzioni A., Alon R. J. Exp. Med. 204:1571-1582(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN INTEGRIN ACTIVATION, TISSUE SPECIFICITY. |
| [11] | "LAD-1/variant syndrome is caused by mutations in FERMT3." Kuijpers T.W., van de Vijver E., Weterman M.A.J., de Boer M., Tool A.T.J., van den Berg T.K., Moser M., Jakobs M.E., Seeger K., Sanal O., Uenal S., Cetin M., Roos D., Verhoeven A.J., Baas F. Blood 113:4740-4746(2009) [PubMed] [Europe PMC] [Abstract] Cited for: LACK OF INVOLVEMENT IN LAD3. |
| [12] | "Leukocyte adhesion deficiency-III is caused by mutations in KINDLIN3 affecting integrin activation." Svensson L., Howarth K., McDowall A., Patzak I., Evans R., Ussar S., Moser M., Metin A., Fried M., Tomlinson I., Hogg N. Nat. Med. 15:306-312(2009) [PubMed] [Europe PMC] [Abstract] Cited for: LACK OF INVOLVEMENT IN LAD3. |
| [13] | "A point mutation in KINDLIN3 ablates activation of three integrin subfamilies in humans." Malinin N.L., Zhang L., Choi J., Ciocea A., Razorenova O., Ma Y.-Q., Podrez E.A., Tosi M., Lennon D.P., Caplan A.I., Shurin S.B., Plow E.F., Byzova T.V. Nat. Med. 15:313-318(2009) [PubMed] [Europe PMC] [Abstract] Cited for: LACK OF INVOLVEMENT IN LAD3. |
| + | Additional computationally mapped references. |
Web resources
| RASGRP2base RASGRP2 mutation db |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | Y12336 mRNA. Translation: CAA73005.1. AF081194 mRNA. Translation: AAC79698.1. U78170 mRNA. Translation: AAD12741.1. AF043722 mRNA. Translation: AAF07219.1. AF043723 mRNA. Translation: AAF07220.1. CH471076 Genomic DNA. Translation: EAW74281.1. BC117151 mRNA. Translation: AAI17152.1. |
| IPI | IPI00329757. IPI00852607. IPI00854815. |
| RefSeq | NP_001092140.1. NM_001098670.1. NP_001092141.1. NM_001098671.1. NP_722541.1. NM_153819.1. |
| UniGene | Hs.99491. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1PTQ based on UniProtKB P28867. |
| ProteinModelPortal | Q7LDG7. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q7LDG7. 3 interactions. |
| MINT | MINT-1367716. |
| STRING | 9606.ENSP00000338864. |
Polymorphism databases | |
| DMDM | 74713056. |
Proteomic databases | |
| PaxDb | Q7LDG7. |
| PRIDE | Q7LDG7. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000354024; ENSP00000338864; ENSG00000068831. ENST00000377497; ENSP00000366717; ENSG00000068831. ENST00000394432; ENSP00000377953; ENSG00000068831. |
| GeneID | 10235. |
| KEGG | hsa:10235. |
| UCSC | uc009ypu.3. human. |
Organism-specific databases | |
| CTD | 10235. |
| GeneCards | GC11M064494. |
| HGNC | HGNC:9879. RASGRP2. |
| HPA | HPA015667. |
| MIM | 605577. gene. |
| neXtProt | NX_Q7LDG7. |
| PharmGKB | PA34241. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG256085. |
| HOGENOM | HOG000293171. |
| HOVERGEN | HBG007513. |
| InParanoid | Q7LDG7. |
| KO | K12361. |
| OrthoDB | EOG4TB49W. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | tcrpathway. TCR signaling in naive CD4+ T cells. cd8tcrpathway. TCR signaling in naive CD8+ T cells. |
| Reactome | REACT_111102. Signal Transduction. REACT_604. Hemostasis. REACT_6900. Immune System. |
Gene expression databases | |
| ArrayExpress | Q7LDG7. |
| Bgee | Q7LDG7. |
| CleanEx | HS_RASGRP2. |
| Genevestigator | Q7LDG7. |
Family and domain databases | |
| Gene3D | 1.10.238.10. 1 hit. 1.10.840.10. 1 hit. |
| InterPro | IPR011992. EF-hand-like_dom. IPR018247. EF_Hand_1_Ca_BS. IPR002048. EF_hand_dom. IPR002219. Prot_Kinase_C-like_PE/DAG-bd. IPR000651. Ras-like_Gua-exchang_fac_N. IPR008937. Ras_GEF. IPR023578. Ras_GEF_dom. IPR001895. RasGRF_CDC25. [Graphical view] |
| PANTHER | PTHR23113. PTHR23113. 1 hit. |
| Pfam | PF00130. C1_1. 1 hit. PF13202. EF_hand_3. 2 hits. PF00617. RasGEF. 1 hit. PF00618. RasGEF_N. 1 hit. [Graphical view] |
| SMART | SM00109. C1. 1 hit. SM00054. EFh. 2 hits. SM00147. RasGEF. 1 hit. SM00229. RasGEFN. 1 hit. [Graphical view] |
| SUPFAM | SSF48366. Ras_GEF. 1 hit. |
| PROSITE | PS00018. EF_HAND_1. 2 hits. PS50222. EF_HAND_2. 2 hits. PS00720. RASGEF. False negative. PS50009. RASGEF_CAT. 1 hit. PS50212. RASGEF_NTER. 1 hit. PS00479. ZF_DAG_PE_1. 1 hit. PS50081. ZF_DAG_PE_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | RASGRP2. human. |
| GenomeRNAi | 10235. |
| NextBio | 38762. |
| SOURCE | Search... |
Entry information
| Entry name | GRP2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q7LDG7 Secondary accession number(s): O00538, Q9UL65 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
