Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

RAS guanyl-releasing protein 2

Gene

RASGRP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Functions as a calcium- and DAG-regulated nucleotide exchange factor specifically activating Rap through the exchange of bound GDP for GTP. May also activates other GTPases such as RRAS, RRAS2, NRAS, KRAS but not HRAS. Functions in aggregation of platelets and adhesion of T-lymphocytes and neutrophils probably through inside-out integrin activation. May function in the muscarinic acetylcholine receptor M1/CHRM1 signaling pathway.5 Publications

Enzyme regulationi

Isoform 1 and isoform 2 are differently regulated by calcium and DAG.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Calcium bindingi439 – 4501PROSITE-ProRule annotation1 PublicationAdd BLAST12
Calcium bindingi468 – 4792PROSITE-ProRule annotation1 PublicationAdd BLAST12
Zinc fingeri498 – 548Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd BLAST51

GO - Molecular functioni

  • calcium ion binding Source: UniProtKB
  • diacylglycerol binding Source: UniProtKB
  • guanyl-nucleotide exchange factor activity Source: UniProtKB
  • lipid binding Source: UniProtKB

GO - Biological processi

  • cellular response to calcium ion Source: UniProtKB
  • positive regulation of GTPase activity Source: UniProtKB
  • Ras protein signal transduction Source: UniProtKB
  • regulation of cell growth Source: UniProtKB
  • signal transduction Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Guanine-nucleotide releasing factor

Keywords - Ligandi

Calcium, Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:ENSG00000100351-MONOMER.
ReactomeiR-HSA-114508. Effects of PIP2 hydrolysis.
R-HSA-2871837. FCERI mediated NF-kB activation.
R-HSA-354192. Integrin alphaIIb beta3 signaling.
R-HSA-392517. Rap1 signalling.

Names & Taxonomyi

Protein namesi
Recommended name:
RAS guanyl-releasing protein 2
Alternative name(s):
Calcium and DAG-regulated guanine nucleotide exchange factor I
Short name:
CalDAG-GEFI
Cdc25-like protein
Short name:
hCDC25L
F25B3.3 kinase-like protein
Gene namesi
Name:RASGRP2
Synonyms:CDC25L, MCG7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:9879. RASGRP2.

Subcellular locationi

GO - Cellular componenti

  • cell junction Source: UniProtKB-KW
  • cytosol Source: UniProtKB
  • neuron projection Source: UniProtKB-SubCell
  • plasma membrane Source: UniProtKB
  • ruffle membrane Source: UniProtKB-SubCell
  • synapse Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Membrane, Synapse, Synaptosome

Pathology & Biotechi

Involvement in diseasei

Bleeding disorder, platelet-type 18 (BDPLT18)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder characterized by increased bleeding tendency due to platelet dysfunction. Clinical features include epistaxis, hematomas, bleeding after tooth extraction, and menorrhagia.
See also OMIM:615888
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_071474248G → W in BDPLT18; prevents Rap1 activation upon calcium stimulation; reduces platelet adhesion and spreading. 1 PublicationCorresponds to variant rs587777529dbSNPEnsembl.1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi10235.
MalaCardsiRASGRP2.
MIMi615888. phenotype.
OpenTargetsiENSG00000068831.
PharmGKBiPA34241.

Polymorphism and mutation databases

BioMutaiRASGRP2.
DMDMi74713056.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003156081 – 609RAS guanyl-releasing protein 2Add BLAST609

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei116PhosphoserineBy similarity1
Modified residuei117PhosphoserineBy similarity1
Modified residuei147PhosphoserineBy similarity1
Modified residuei554PhosphoserineBy similarity1
Modified residuei576PhosphoserineBy similarity1

Post-translational modificationi

Isoform 2 is palmitoylated and myristoylated while isoform 1.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ7LDG7.
MaxQBiQ7LDG7.
PaxDbiQ7LDG7.
PeptideAtlasiQ7LDG7.
PRIDEiQ7LDG7.

PTM databases

iPTMnetiQ7LDG7.
PhosphoSitePlusiQ7LDG7.
SwissPalmiQ7LDG7.

Expressioni

Tissue specificityi

Detected in platelets, neutrophils and T lymphocytes (at protein level). Expressed in brain where it is enriched in the striatum. Also expressed in the hematopoietic system. Detected in heart, brain, lung, placenta, liver, skeletal muscle and kidney.5 Publications

Developmental stagei

Expressed in fetal brain, lung, liver and kidney.1 Publication

Gene expression databases

BgeeiENSG00000068831.
CleanExiHS_RASGRP2.
ExpressionAtlasiQ7LDG7. baseline and differential.
GenevisibleiQ7LDG7. HS.

Organism-specific databases

HPAiHPA015667.

Interactioni

Subunit structurei

Forms a signaling complex with RAP1 and BRAF (By similarity). Interacts with RAP1. Interacts with F-actin.By similarity2 Publications

Protein-protein interaction databases

BioGridi115529. 2 interactors.
IntActiQ7LDG7. 3 interactors.
MINTiMINT-1367716.
STRINGi9606.ENSP00000338864.

Structurei

Secondary structure

1609
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi420 – 437Combined sources18
Helixi448 – 454Combined sources7
Turni455 – 457Combined sources3
Helixi464 – 467Combined sources4
Helixi477 – 486Combined sources10
Beta strandi490 – 492Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2MA2NMR-A417-497[»]
ProteinModelPortaliQ7LDG7.
SMRiQ7LDG7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini4 – 126N-terminal Ras-GEFPROSITE-ProRule annotationAdd BLAST123
Domaini154 – 387Ras-GEFPROSITE-ProRule annotationAdd BLAST234
Domaini426 – 461EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini455 – 490EF-hand 2PROSITE-ProRule annotationAdd BLAST36

Domaini

The N-terminal Ras-GEF domain mediates association with F-actin.

Sequence similaritiesi

Belongs to the RASGRP family.Curated
Contains 2 EF-hand domains.PROSITE-ProRule annotation
Contains 1 N-terminal Ras-GEF domain.PROSITE-ProRule annotation
Contains 1 phorbol-ester/DAG-type zinc finger.PROSITE-ProRule annotation
Contains 1 Ras-GEF domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri498 – 548Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd BLAST51

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG3417. Eukaryota.
ENOG410XR96. LUCA.
GeneTreeiENSGT00850000132267.
HOGENOMiHOG000293171.
HOVERGENiHBG007513.
InParanoidiQ7LDG7.
KOiK12361.
OMAiQWIQLMV.
OrthoDBiEOG091G03RN.
PhylomeDBiQ7LDG7.
TreeFamiTF312918.

Family and domain databases

CDDicd00029. C1. 1 hit.
cd00051. EFh. 1 hit.
cd00155. RasGEF. 1 hit.
cd06224. REM. 1 hit.
Gene3Di1.10.238.10. 1 hit.
1.10.840.10. 1 hit.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR002219. PE/DAG-bd.
IPR000651. Ras-like_Gua-exchang_fac_N.
IPR023578. Ras_GEF_dom.
IPR001895. RASGEF_cat_dom.
[Graphical view]
PfamiPF00130. C1_1. 1 hit.
PF13202. EF-hand_5. 1 hit.
PF00617. RasGEF. 1 hit.
PF00618. RasGEF_N. 1 hit.
[Graphical view]
SMARTiSM00109. C1. 1 hit.
SM00054. EFh. 2 hits.
SM00147. RasGEF. 1 hit.
SM00229. RasGEFN. 1 hit.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
SSF48366. SSF48366. 1 hit.
PROSITEiPS00018. EF_HAND_1. 2 hits.
PS50222. EF_HAND_2. 2 hits.
PS50009. RASGEF_CAT. 1 hit.
PS50212. RASGEF_NTER. 1 hit.
PS00479. ZF_DAG_PE_1. 1 hit.
PS50081. ZF_DAG_PE_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7LDG7-1) [UniParc]FASTAAdd to basket
Also known as: CalDAG-GEFI, CalDAG-GEFIa

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGTLDLDKG CTVEELLRGC IEAFDDSGKV RDPQLVRMFL MMHPWYIPSS
60 70 80 90 100
QLAAKLLHIY QQSRKDNSNS LQVKTCHLVR YWISAFPAEF DLNPELAEQI
110 120 130 140 150
KELKALLDQE GNRRHSSLID IDSVPTYKWK RQVTQRNPVG QKKRKMSLLF
160 170 180 190 200
DHLEPMELAE HLTYLEYRSF CKILFQDYHS FVTHGCTVDN PVLERFISLF
210 220 230 240 250
NSVSQWVQLM ILSKPTAPQR ALVITHFVHV AEKLLQLQNF NTLMAVVGGL
260 270 280 290 300
SHSSISRLKE THSHVSPETI KLWEGLTELV TATGNYGNYR RRLAACVGFR
310 320 330 340 350
FPILGVHLKD LVALQLALPD WLDPARTRLN GAKMKQLFSI LEELAMVTSL
360 370 380 390 400
RPPVQANPDL LSLLTVSLDQ YQTEDELYQL SLQREPRSKS SPTSPTSCTP
410 420 430 440 450
PPRPPVLEEW TSAAKPKLDQ ALVVEHIEKM VESVFRNFDV DGDGHISQEE
460 470 480 490 500
FQIIRGNFPY LSAFGDLDQN QDGCISREEM VSYFLRSSSV LGGRMGFVHN
510 520 530 540 550
FQESNSLRPV ACRHCKALIL GIYKQGLKCR ACGVNCHKQC KDRLSVECRR
560 570 580 590 600
RAQSVSLEGS APSPSPMHSH HHRAFSFSLP RPGRRGSRPP EIREEEVQTV

EDGVFDIHL
Length:609
Mass (Da):69,248
Last modified:July 5, 2004 - v1
Checksum:i8B1321F864D24BC7
GO
Isoform 2 (identifier: Q7LDG7-2) [UniParc]FASTAAdd to basket
Also known as: RasGRP2

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGTQRLCGRGTQGWPGSSEQHVQEATSSAGLHSGVDELGVRSEPGGRLPERSLGPAHPAPAAM

Show »
Length:671
Mass (Da):75,547
Checksum:i67B7BD2B4F4AED4D
GO
Isoform 3 (identifier: Q7LDG7-3) [UniParc]FASTAAdd to basket
Also known as: CalDAG-GEFIb

The sequence of this isoform differs from the canonical sequence as follows:
     125-125: P → CVGAEHRGLGGHSVSYTICA
     126-609: Missing.

Note: The corresponding protein is not undetectable.
Show »
Length:144
Mass (Da):16,203
Checksum:i23E5F426383B4F9A
GO
Isoform 4 (identifier: Q7LDG7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     590-590: P → PA

Note: No experimental confirmation available.
Show »
Length:610
Mass (Da):69,320
Checksum:i612917B4711357F9
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_071474248G → W in BDPLT18; prevents Rap1 activation upon calcium stimulation; reduces platelet adhesion and spreading. 1 PublicationCorresponds to variant rs587777529dbSNPEnsembl.1
Natural variantiVAR_038257493G → A.Corresponds to variant rs2301562dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0305741M → MGTQRLCGRGTQGWPGSSEQ HVQEATSSAGLHSGVDELGV RSEPGGRLPERSLGPAHPAP AAM in isoform 2. 1 Publication1
Alternative sequenceiVSP_030575125P → CVGAEHRGLGGHSVSYTICA in isoform 3. Curated1
Alternative sequenceiVSP_030576126 – 609Missing in isoform 3. CuratedAdd BLAST484
Alternative sequenceiVSP_054132590P → PA in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y12336 mRNA. Translation: CAA73005.1.
AF081194 mRNA. Translation: AAC79698.1.
U78170 mRNA. Translation: AAD12741.1.
AF043722 mRNA. Translation: AAF07219.1.
AF043723 mRNA. Translation: AAF07220.1.
AK092882 mRNA. Translation: BAG52620.1.
AP001462 Genomic DNA. No translation available.
CH471076 Genomic DNA. Translation: EAW74281.1.
BC117151 mRNA. Translation: AAI17152.1.
CCDSiCCDS31598.1. [Q7LDG7-1]
RefSeqiNP_001092140.1. NM_001098670.1. [Q7LDG7-1]
NP_001092141.1. NM_001098671.1. [Q7LDG7-1]
NP_001305327.1. NM_001318398.1.
NP_722541.1. NM_153819.1. [Q7LDG7-1]
XP_011543022.1. XM_011544720.1. [Q7LDG7-4]
XP_011543023.1. XM_011544721.1. [Q7LDG7-4]
XP_011543024.1. XM_011544722.1. [Q7LDG7-4]
XP_011543025.1. XM_011544723.2. [Q7LDG7-4]
XP_016872573.1. XM_017017084.1. [Q7LDG7-4]
UniGeneiHs.99491.

Genome annotation databases

EnsembliENST00000354024; ENSP00000338864; ENSG00000068831. [Q7LDG7-1]
ENST00000377494; ENSP00000366714; ENSG00000068831. [Q7LDG7-4]
ENST00000377497; ENSP00000366717; ENSG00000068831. [Q7LDG7-1]
ENST00000394432; ENSP00000377953; ENSG00000068831. [Q7LDG7-1]
GeneIDi10235.
KEGGihsa:10235.
UCSCiuc001oau.4. human. [Q7LDG7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

RASGRP2base

RASGRP2 mutation db

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y12336 mRNA. Translation: CAA73005.1.
AF081194 mRNA. Translation: AAC79698.1.
U78170 mRNA. Translation: AAD12741.1.
AF043722 mRNA. Translation: AAF07219.1.
AF043723 mRNA. Translation: AAF07220.1.
AK092882 mRNA. Translation: BAG52620.1.
AP001462 Genomic DNA. No translation available.
CH471076 Genomic DNA. Translation: EAW74281.1.
BC117151 mRNA. Translation: AAI17152.1.
CCDSiCCDS31598.1. [Q7LDG7-1]
RefSeqiNP_001092140.1. NM_001098670.1. [Q7LDG7-1]
NP_001092141.1. NM_001098671.1. [Q7LDG7-1]
NP_001305327.1. NM_001318398.1.
NP_722541.1. NM_153819.1. [Q7LDG7-1]
XP_011543022.1. XM_011544720.1. [Q7LDG7-4]
XP_011543023.1. XM_011544721.1. [Q7LDG7-4]
XP_011543024.1. XM_011544722.1. [Q7LDG7-4]
XP_011543025.1. XM_011544723.2. [Q7LDG7-4]
XP_016872573.1. XM_017017084.1. [Q7LDG7-4]
UniGeneiHs.99491.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2MA2NMR-A417-497[»]
ProteinModelPortaliQ7LDG7.
SMRiQ7LDG7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115529. 2 interactors.
IntActiQ7LDG7. 3 interactors.
MINTiMINT-1367716.
STRINGi9606.ENSP00000338864.

PTM databases

iPTMnetiQ7LDG7.
PhosphoSitePlusiQ7LDG7.
SwissPalmiQ7LDG7.

Polymorphism and mutation databases

BioMutaiRASGRP2.
DMDMi74713056.

Proteomic databases

EPDiQ7LDG7.
MaxQBiQ7LDG7.
PaxDbiQ7LDG7.
PeptideAtlasiQ7LDG7.
PRIDEiQ7LDG7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000354024; ENSP00000338864; ENSG00000068831. [Q7LDG7-1]
ENST00000377494; ENSP00000366714; ENSG00000068831. [Q7LDG7-4]
ENST00000377497; ENSP00000366717; ENSG00000068831. [Q7LDG7-1]
ENST00000394432; ENSP00000377953; ENSG00000068831. [Q7LDG7-1]
GeneIDi10235.
KEGGihsa:10235.
UCSCiuc001oau.4. human. [Q7LDG7-1]

Organism-specific databases

CTDi10235.
DisGeNETi10235.
GeneCardsiRASGRP2.
HGNCiHGNC:9879. RASGRP2.
HPAiHPA015667.
MalaCardsiRASGRP2.
MIMi605577. gene.
615888. phenotype.
neXtProtiNX_Q7LDG7.
OpenTargetsiENSG00000068831.
PharmGKBiPA34241.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3417. Eukaryota.
ENOG410XR96. LUCA.
GeneTreeiENSGT00850000132267.
HOGENOMiHOG000293171.
HOVERGENiHBG007513.
InParanoidiQ7LDG7.
KOiK12361.
OMAiQWIQLMV.
OrthoDBiEOG091G03RN.
PhylomeDBiQ7LDG7.
TreeFamiTF312918.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000100351-MONOMER.
ReactomeiR-HSA-114508. Effects of PIP2 hydrolysis.
R-HSA-2871837. FCERI mediated NF-kB activation.
R-HSA-354192. Integrin alphaIIb beta3 signaling.
R-HSA-392517. Rap1 signalling.

Miscellaneous databases

GeneWikiiRASGRP2.
GenomeRNAii10235.
PROiQ7LDG7.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000068831.
CleanExiHS_RASGRP2.
ExpressionAtlasiQ7LDG7. baseline and differential.
GenevisibleiQ7LDG7. HS.

Family and domain databases

CDDicd00029. C1. 1 hit.
cd00051. EFh. 1 hit.
cd00155. RasGEF. 1 hit.
cd06224. REM. 1 hit.
Gene3Di1.10.238.10. 1 hit.
1.10.840.10. 1 hit.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR002219. PE/DAG-bd.
IPR000651. Ras-like_Gua-exchang_fac_N.
IPR023578. Ras_GEF_dom.
IPR001895. RASGEF_cat_dom.
[Graphical view]
PfamiPF00130. C1_1. 1 hit.
PF13202. EF-hand_5. 1 hit.
PF00617. RasGEF. 1 hit.
PF00618. RasGEF_N. 1 hit.
[Graphical view]
SMARTiSM00109. C1. 1 hit.
SM00054. EFh. 2 hits.
SM00147. RasGEF. 1 hit.
SM00229. RasGEFN. 1 hit.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
SSF48366. SSF48366. 1 hit.
PROSITEiPS00018. EF_HAND_1. 2 hits.
PS50222. EF_HAND_2. 2 hits.
PS50009. RASGEF_CAT. 1 hit.
PS50212. RASGEF_NTER. 1 hit.
PS00479. ZF_DAG_PE_1. 1 hit.
PS50081. ZF_DAG_PE_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiGRP2_HUMAN
AccessioniPrimary (citable) accession number: Q7LDG7
Secondary accession number(s): A6NDC7, O00538, Q9UL65
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: July 5, 2004
Last modified: November 30, 2016
This is version 127 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

Defects in RASGRP2 were initially thought (PubMed:17576779) to be the cause of leukocyte adhesion deficiency type 3 (LAD3), a syndrome characterized by recurrent bacterial infections and major bleeding disorders. However, it was later shown (PubMed:19064721, PubMed:19234463 and PubMed:19234460) that it is not the case and that LAD3 is caused by defects in FERMT3 gene.1 Publication

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.