Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Basic leucine zipper and W2 domain-containing protein 1

Gene

BZW1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Enhances histone H4 gene transcription but does not seem to bind DNA directly.1 Publication

GO - Molecular functioni

  • poly(A) RNA binding Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Transcription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Basic leucine zipper and W2 domain-containing protein 1
Alternative name(s):
Protein Orf
Gene namesi
Name:BZW1
Synonyms:BZAP45, KIAA0005
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:18380. BZW1.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • membrane Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38535.

Polymorphism and mutation databases

BioMutaiBZW1.
DMDMi74738534.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 419419Basic leucine zipper and W2 domain-containing protein 1PRO_0000254609Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionineCombined sources
Modified residuei411 – 4111PhosphoserineCombined sources
Modified residuei413 – 4131PhosphoserineCombined sources

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ7L1Q6.
MaxQBiQ7L1Q6.
PaxDbiQ7L1Q6.
PRIDEiQ7L1Q6.
TopDownProteomicsiQ7L1Q6-1. [Q7L1Q6-1]
Q7L1Q6-2. [Q7L1Q6-2]

PTM databases

iPTMnetiQ7L1Q6.
PhosphoSiteiQ7L1Q6.
SwissPalmiQ7L1Q6.

Expressioni

Developmental stagei

Expressed in day 3 embryo.1 Publication

Gene expression databases

BgeeiQ7L1Q6.
CleanExiHS_BZW1.
ExpressionAtlasiQ7L1Q6. baseline and differential.
GenevisibleiQ7L1Q6. HS.

Organism-specific databases

HPAiHPA047288.
HPA053272.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
PSTPIP1O435862EBI-1046727,EBI-1050964

Protein-protein interaction databases

BioGridi115042. 36 interactions.
IntActiQ7L1Q6. 7 interactions.
MINTiMINT-4828524.
STRINGi9606.ENSP00000394316.

Structurei

3D structure databases

ProteinModelPortaliQ7L1Q6.
SMRiQ7L1Q6. Positions 321-409.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini247 – 414168W2PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the BZW family.Curated
Contains 1 W2 domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG2297. Eukaryota.
ENOG410XR08. LUCA.
GeneTreeiENSGT00390000012561.
HOGENOMiHOG000252932.
HOVERGENiHBG080940.
InParanoidiQ7L1Q6.
OMAiIAYLIQA.
PhylomeDBiQ7L1Q6.
TreeFamiTF324313.

Family and domain databases

Gene3Di1.25.40.180. 1 hit.
InterProiIPR016024. ARM-type_fold.
IPR016021. MIF4-like.
IPR003307. W2_domain.
[Graphical view]
PfamiPF02020. W2. 1 hit.
[Graphical view]
SMARTiSM00515. eIF5C. 1 hit.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.
PROSITEiPS51363. W2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7L1Q6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNNQKQQKPT LSGQRFKTRK RDEKERFDPT QFQDCIIQGL TETGTDLEAV
60 70 80 90 100
AKFLDASGAK LDYRRYAETL FDILVAGGML APGGTLADDM MRTDVCVFAA
110 120 130 140 150
QEDLETMQAF AQVFNKLIRR YKYLEKGFED EVKKLLLFLK GFSESERNKL
160 170 180 190 200
AMLTGVLLAN GTLNASILNS LYNENLVKEG VSAAFAVKLF KSWINEKDIN
210 220 230 240 250
AVAASLRKVS MDNRLMELFP ANKQSVEHFT KYFTEAGLKE LSEYVRNQQT
260 270 280 290 300
IGARKELQKE LQEQMSRGDP FKDIILYVKE EMKKNNIPEP VVIGIVWSSV
310 320 330 340 350
MSTVEWNKKE ELVAEQAIKH LKQYSPLLAA FTTQGQSELT LLLKIQEYCY
360 370 380 390 400
DNIHFMKAFQ KIVVLFYKAE VLSEEPILKW YKDAHVAKGK SVFLEQMKKF
410
VEWLKNAEEE SESEAEEGD
Length:419
Mass (Da):48,043
Last modified:July 5, 2004 - v1
Checksum:i9E952D52F5796F60
GO
Isoform 2 (identifier: Q7L1Q6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     286-351: Missing.

Note: No experimental confirmation available.
Show »
Length:353
Mass (Da):40,539
Checksum:i1BD26FB298F41F56
GO
Isoform 3 (identifier: Q7L1Q6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MYGAPGAPAQSASVTVVRSLRRPPPQATGVSFM

Note: No experimental confirmation available.
Show »
Length:451
Mass (Da):51,282
Checksum:i654A82C361BECEB7
GO
Isoform 4 (identifier: Q7L1Q6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MVSFM

Note: No experimental confirmation available.
Show »
Length:423
Mass (Da):48,508
Checksum:iCCE2BA486ED06D43
GO

Sequence cautioni

The sequence BAA02795.2 differs from that shown. Reason: Erroneous initiation. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MYGAPGAPAQSASVTVVRSL RRPPPQATGVSFM in isoform 3. 1 PublicationVSP_043568
Alternative sequencei1 – 11M → MVSFM in isoform 4. 1 PublicationVSP_043569
Alternative sequencei286 – 35166Missing in isoform 2. 1 PublicationVSP_021266Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D13630 mRNA. Translation: BAA02795.2. Different initiation.
AK297227 mRNA. Translation: BAG59710.1.
AK301511 mRNA. Translation: BAG63019.1.
AC007163 Genomic DNA. Translation: AAX93286.1.
BC001804 mRNA. Translation: AAH01804.1.
BC026303 mRNA. Translation: AAH26303.1.
Z70221 mRNA. Translation: CAA94180.1.
CCDSiCCDS56154.1. [Q7L1Q6-4]
CCDS56155.1. [Q7L1Q6-3]
CCDS56156.1. [Q7L1Q6-1]
RefSeqiNP_001193996.1. NM_001207067.1. [Q7L1Q6-1]
NP_001193997.1. NM_001207068.1. [Q7L1Q6-3]
NP_001193998.1. NM_001207069.1. [Q7L1Q6-4]
NP_055485.2. NM_014670.3. [Q7L1Q6-2]
UniGeneiHs.355983.
Hs.736074.

Genome annotation databases

EnsembliENST00000409226; ENSP00000386837; ENSG00000082153. [Q7L1Q6-4]
ENST00000409600; ENSP00000386474; ENSG00000082153. [Q7L1Q6-1]
ENST00000452790; ENSP00000394316; ENSG00000082153. [Q7L1Q6-3]
GeneIDi9689.
KEGGihsa:9689.
UCSCiuc002uwc.4. human. [Q7L1Q6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D13630 mRNA. Translation: BAA02795.2. Different initiation.
AK297227 mRNA. Translation: BAG59710.1.
AK301511 mRNA. Translation: BAG63019.1.
AC007163 Genomic DNA. Translation: AAX93286.1.
BC001804 mRNA. Translation: AAH01804.1.
BC026303 mRNA. Translation: AAH26303.1.
Z70221 mRNA. Translation: CAA94180.1.
CCDSiCCDS56154.1. [Q7L1Q6-4]
CCDS56155.1. [Q7L1Q6-3]
CCDS56156.1. [Q7L1Q6-1]
RefSeqiNP_001193996.1. NM_001207067.1. [Q7L1Q6-1]
NP_001193997.1. NM_001207068.1. [Q7L1Q6-3]
NP_001193998.1. NM_001207069.1. [Q7L1Q6-4]
NP_055485.2. NM_014670.3. [Q7L1Q6-2]
UniGeneiHs.355983.
Hs.736074.

3D structure databases

ProteinModelPortaliQ7L1Q6.
SMRiQ7L1Q6. Positions 321-409.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115042. 36 interactions.
IntActiQ7L1Q6. 7 interactions.
MINTiMINT-4828524.
STRINGi9606.ENSP00000394316.

PTM databases

iPTMnetiQ7L1Q6.
PhosphoSiteiQ7L1Q6.
SwissPalmiQ7L1Q6.

Polymorphism and mutation databases

BioMutaiBZW1.
DMDMi74738534.

Proteomic databases

EPDiQ7L1Q6.
MaxQBiQ7L1Q6.
PaxDbiQ7L1Q6.
PRIDEiQ7L1Q6.
TopDownProteomicsiQ7L1Q6-1. [Q7L1Q6-1]
Q7L1Q6-2. [Q7L1Q6-2]

Protocols and materials databases

DNASUi9689.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000409226; ENSP00000386837; ENSG00000082153. [Q7L1Q6-4]
ENST00000409600; ENSP00000386474; ENSG00000082153. [Q7L1Q6-1]
ENST00000452790; ENSP00000394316; ENSG00000082153. [Q7L1Q6-3]
GeneIDi9689.
KEGGihsa:9689.
UCSCiuc002uwc.4. human. [Q7L1Q6-1]

Organism-specific databases

CTDi9689.
GeneCardsiBZW1.
HGNCiHGNC:18380. BZW1.
HPAiHPA047288.
HPA053272.
neXtProtiNX_Q7L1Q6.
PharmGKBiPA38535.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2297. Eukaryota.
ENOG410XR08. LUCA.
GeneTreeiENSGT00390000012561.
HOGENOMiHOG000252932.
HOVERGENiHBG080940.
InParanoidiQ7L1Q6.
OMAiIAYLIQA.
PhylomeDBiQ7L1Q6.
TreeFamiTF324313.

Miscellaneous databases

ChiTaRSiBZW1. human.
GeneWikiiBZW1.
GenomeRNAii9689.
PROiQ7L1Q6.

Gene expression databases

BgeeiQ7L1Q6.
CleanExiHS_BZW1.
ExpressionAtlasiQ7L1Q6. baseline and differential.
GenevisibleiQ7L1Q6. HS.

Family and domain databases

Gene3Di1.25.40.180. 1 hit.
InterProiIPR016024. ARM-type_fold.
IPR016021. MIF4-like.
IPR003307. W2_domain.
[Graphical view]
PfamiPF02020. W2. 1 hit.
[Graphical view]
SMARTiSM00515. eIF5C. 1 hit.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.
PROSITEiPS51363. W2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1."
    Nomura N., Miyajima N., Sazuka T., Tanaka A., Kawarabayasi Y., Sato S., Nagase T., Seki N., Ishikawa K., Tabata S.
    DNA Res. 1:27-35(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Bone marrow.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
    Tissue: Brain and Synovium.
  3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain and Eye.
  5. "Characterization of different mRNA types expressed in human brain."
    Dmitrenko V.V., Garifulin O.M., Kavsan V.M.
    Submitted (MAR-1996) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-74.
    Tissue: Fetal brain.
  6. "Purification and functional analysis of a novel leucine-zipper/nucleotide-fold protein, BZAP45, stimulating cell cycle regulated histone H4 gene transcription."
    Mitra P., Vaughan P.S., Stein J.L., Stein G.S., van Wijnen A.J.
    Biochemistry 40:10693-10699(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 6-15, DEVELOPMENTAL STAGE, FUNCTION.
  7. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-411 AND SER-413, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. "A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
    Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
    Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-411, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. "Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography."
    Han G., Ye M., Zhou H., Jiang X., Feng S., Jiang X., Tian R., Wan D., Zou H., Gu J.
    Proteomics 8:1346-1361(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-411 AND SER-413, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  11. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  12. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-411, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  13. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-411, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  14. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  15. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-411, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  16. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  17. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiBZW1_HUMAN
AccessioniPrimary (citable) accession number: Q7L1Q6
Secondary accession number(s): B4DLZ8
, B4DWF7, Q14281, Q15394, Q9BUY0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: July 5, 2004
Last modified: June 8, 2016
This is version 110 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.