Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytochrome c oxidase assembly protein COX15 homolog

Gene

COX15

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May be involved in the biosynthesis of heme A.1 Publication

Pathwayi

GO - Molecular functioni

  1. cytochrome-c oxidase activity Source: UniProtKB
  2. oxidoreductase activity, acting on the CH-CH group of donors Source: InterPro

GO - Biological processi

  1. cellular respiration Source: HGNC
  2. heme a biosynthetic process Source: HGNC
  3. heme biosynthetic process Source: Reactome
  4. hydrogen ion transmembrane transport Source: BHF-UCL
  5. mitochondrial electron transport, cytochrome c to oxygen Source: HGNC
  6. oxidation-reduction process Source: UniProtKB
  7. porphyrin-containing compound metabolic process Source: Reactome
  8. respiratory chain complex IV assembly Source: HGNC
  9. respiratory gaseous exchange Source: UniProtKB
  10. small molecule metabolic process Source: Reactome
Complete GO annotation...

Enzyme and pathway databases

ReactomeiREACT_9465. Heme biosynthesis.
UniPathwayiUPA00269; UER00713.

Names & Taxonomyi

Protein namesi
Recommended name:
Cytochrome c oxidase assembly protein COX15 homolog
Gene namesi
Name:COX15
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:2263. COX15.

Subcellular locationi

  1. Mitochondrion membrane 1 Publication; Multi-pass membrane protein 1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei68 – 8821HelicalSequence AnalysisAdd
BLAST
Transmembranei154 – 17118HelicalSequence AnalysisAdd
BLAST
Transmembranei184 – 20421HelicalSequence AnalysisAdd
BLAST
Transmembranei227 – 24721HelicalSequence AnalysisAdd
BLAST
Transmembranei269 – 28921HelicalSequence AnalysisAdd
BLAST
Transmembranei324 – 34421HelicalSequence AnalysisAdd
BLAST
Transmembranei357 – 37721HelicalSequence AnalysisAdd
BLAST
Transmembranei382 – 40221HelicalSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. cytochrome complex Source: BHF-UCL
  2. integral component of membrane Source: UniProtKB-KW
  3. mitochondrial inner membrane Source: Reactome
  4. mitochondrial respiratory chain Source: UniProtKB
  5. mitochondrion Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Membrane, Mitochondrion

Pathology & Biotechi

Involvement in diseasei

Cardioencephalomyopathy, fatal infantile, due to cytochrome c oxidase deficiency 2 (CEMCOX2)2 Publications

The disease is caused by mutations affecting the gene represented in this entry.

Disease descriptionAn infantile disorder, with a rapidly progressive fatal course, characterized by cytochrome c oxidase deficiency. Clinical features include microcephaly, encephalopathy, hypertrophic cardiomyopathy, persistent lactic acidosis, respiratory distress, hypotonia and seizures. Postmortem cardiac muscle studies show marked complex IV deficiency. Complex IV activity is only slightly decreased in the skeletal muscle.

See also OMIM:615119
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti217 – 2171R → W in CEMCOX2 and LS. 3 Publications
Corresponds to variant rs28939711 [ dbSNP | Ensembl ].
VAR_019596
Leigh syndrome (LS)2 Publications

The disease is caused by mutations affecting the gene represented in this entry.

Disease descriptionAn early-onset progressive neurodegenerative disorder characterized by the presence of focal, bilateral lesions in one or more areas of the central nervous system including the brainstem, thalamus, basal ganglia, cerebellum and spinal cord. Clinical features depend on which areas of the central nervous system are involved and include subacute onset of psychomotor retardation, hypotonia, ataxia, weakness, vision loss, eye movement abnormalities, seizures, and dysphagia.

See also OMIM:256000
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti217 – 2171R → W in CEMCOX2 and LS. 3 Publications
Corresponds to variant rs28939711 [ dbSNP | Ensembl ].
VAR_019596
Natural varianti344 – 3441S → P in LS. 1 Publication
VAR_033117

Keywords - Diseasei

Disease mutation, Leigh syndrome

Organism-specific databases

MIMi256000. phenotype.
615119. phenotype.
Orphaneti1561. Fatal infantile cytochrome C oxidase deficiency.
70474. Leigh syndrome with cardiomyopathy.
PharmGKBiPA26779.

Polymorphism and mutation databases

BioMutaiCOX15.
DMDMi51315906.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 410410Cytochrome c oxidase assembly protein COX15 homologPRO_0000183931Add
BLAST

Proteomic databases

MaxQBiQ7KZN9.
PaxDbiQ7KZN9.
PRIDEiQ7KZN9.

PTM databases

PhosphoSiteiQ7KZN9.

Expressioni

Tissue specificityi

Predominantly found in tissues characterized by high rates of oxidative phosphorylation (OxPhos), including muscle, heart, and brain.1 Publication

Gene expression databases

BgeeiQ7KZN9.
CleanExiHS_COX15.
ExpressionAtlasiQ7KZN9. baseline and differential.
GenevestigatoriQ7KZN9.

Organism-specific databases

HPAiHPA037727.
HPA037728.

Interactioni

Protein-protein interaction databases

BioGridi107747. 13 interactions.
IntActiQ7KZN9. 11 interactions.
STRINGi9606.ENSP00000016171.

Structurei

3D structure databases

ProteinModelPortaliQ7KZN9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the COX15/CtaA family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG1612.
GeneTreeiENSGT00390000002223.
HOVERGENiHBG051086.
InParanoidiQ7KZN9.
KOiK02259.
OMAiTALIYIV.
OrthoDBiEOG7X9G74.
PhylomeDBiQ7KZN9.
TreeFamiTF105073.

Family and domain databases

HAMAPiMF_01665. HemeA_synth_type2.
InterProiIPR003780. COX15/CtaA_fam.
IPR023754. HemeA_Synthase_type2.
IPR009003. Trypsin-like_Pept_dom.
[Graphical view]
PfamiPF02628. COX15-CtaA. 1 hit.
[Graphical view]
SUPFAMiSSF50494. SSF50494. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7KZN9-1) [UniParc]FASTAAdd to basket

Also known as: COX15.1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQRLLFPPLR ALKGRQYLPL LAPRAAPRAQ CDCIRRPLRP GQYSTISEVA
60 70 80 90 100
LQSGRGTVSL PSKAAERVVG RWLLVCSGTV AGAVILGGVT RLTESGLSMV
110 120 130 140 150
DWHLIKEMKP PTSQEEWEAE FQRYQQFPEF KILNHDMTLT EFKFIWYMEY
160 170 180 190 200
SHRMWGRLVG LVYILPAAYF WRKGWLSRGM KGRVLALCGL VCFQGLLGWY
210 220 230 240 250
MVKSGLEEKS DSHDIPRVSQ YRLAAHLGSA LVLYCASLWT SLSLLLPPHK
260 270 280 290 300
LPETHQLLQL RRFAHGTAGL VFLTALSGAF VAGLDAGLVY NSFPKMGESW
310 320 330 340 350
IPEDLFTFSP ILRNVFENPT MVQFDHRILG ITSVTAITVL YFLSRRIPLP
360 370 380 390 400
RRTKMAAVTL LALAYTQVGL GISTLLMYVP TPLAATHQSG SLALLTGALW
410
LMNELRRVPK
Length:410
Mass (Da):46,030
Last modified:July 5, 2004 - v1
Checksum:i98E9FD9D1D28EFC0
GO
Isoform 2 (identifier: Q7KZN9-2) [UniParc]FASTAAdd to basket

Also known as: COX15.2

The sequence of this isoform differs from the canonical sequence as follows:
     368-410: VGLGISTLLMYVPTPLAATHQSGSLALLTGALWLMNELRRVPK → GPVLFNFTFKISDLDEGIRNI

Show »
Length:388
Mass (Da):43,835
Checksum:i92A2DAEF334460BB
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti28 – 281R → K in AAD08639 (PubMed:9878253).Curated
Sequence conflicti28 – 281R → K in AAD08646 (PubMed:9878253).Curated
Sequence conflicti93 – 931T → A in CAD97781 (Ref. 3) Curated
Isoform 2 (identifier: Q7KZN9-2)
Sequence conflicti374 – 3741F → L in AAD08646 (PubMed:9878253).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti217 – 2171R → W in CEMCOX2 and LS. 3 Publications
Corresponds to variant rs28939711 [ dbSNP | Ensembl ].
VAR_019596
Natural varianti344 – 3441S → P in LS. 1 Publication
VAR_033117

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei368 – 41043VGLGI…RRVPK → GPVLFNFTFKISDLDEGIRN I in isoform 2. 1 PublicationVSP_011281Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF026850 mRNA. Translation: AAD08639.1.
AF044323 mRNA. Translation: AAD08646.1.
BT007129 mRNA. Translation: AAP35793.1.
AK291654 mRNA. Translation: BAF84343.1.
BX537557 mRNA. Translation: CAD97781.1.
AL133353 Genomic DNA. Translation: CAB88197.1.
AL133353 Genomic DNA. Translation: CAB88198.1.
CH471066 Genomic DNA. Translation: EAW49857.1.
BC002382 mRNA. Translation: AAH02382.3.
BC013403 mRNA. Translation: AAH13403.1.
BC078161 mRNA. Translation: AAH78161.1.
CCDSiCCDS7481.1. [Q7KZN9-2]
CCDS7482.1. [Q7KZN9-1]
RefSeqiNP_004367.2. NM_004376.5. [Q7KZN9-2]
NP_510870.1. NM_078470.4. [Q7KZN9-1]
UniGeneiHs.28326.

Genome annotation databases

EnsembliENST00000016171; ENSP00000016171; ENSG00000014919. [Q7KZN9-1]
ENST00000370483; ENSP00000359514; ENSG00000014919. [Q7KZN9-2]
GeneIDi1355.
KEGGihsa:1355.
UCSCiuc001kqb.4. human. [Q7KZN9-1]
uc001kqc.4. human. [Q7KZN9-2]

Polymorphism and mutation databases

BioMutaiCOX15.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF026850 mRNA. Translation: AAD08639.1.
AF044323 mRNA. Translation: AAD08646.1.
BT007129 mRNA. Translation: AAP35793.1.
AK291654 mRNA. Translation: BAF84343.1.
BX537557 mRNA. Translation: CAD97781.1.
AL133353 Genomic DNA. Translation: CAB88197.1.
AL133353 Genomic DNA. Translation: CAB88198.1.
CH471066 Genomic DNA. Translation: EAW49857.1.
BC002382 mRNA. Translation: AAH02382.3.
BC013403 mRNA. Translation: AAH13403.1.
BC078161 mRNA. Translation: AAH78161.1.
CCDSiCCDS7481.1. [Q7KZN9-2]
CCDS7482.1. [Q7KZN9-1]
RefSeqiNP_004367.2. NM_004376.5. [Q7KZN9-2]
NP_510870.1. NM_078470.4. [Q7KZN9-1]
UniGeneiHs.28326.

3D structure databases

ProteinModelPortaliQ7KZN9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107747. 13 interactions.
IntActiQ7KZN9. 11 interactions.
STRINGi9606.ENSP00000016171.

PTM databases

PhosphoSiteiQ7KZN9.

Polymorphism and mutation databases

BioMutaiCOX15.
DMDMi51315906.

Proteomic databases

MaxQBiQ7KZN9.
PaxDbiQ7KZN9.
PRIDEiQ7KZN9.

Protocols and materials databases

DNASUi1355.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000016171; ENSP00000016171; ENSG00000014919. [Q7KZN9-1]
ENST00000370483; ENSP00000359514; ENSG00000014919. [Q7KZN9-2]
GeneIDi1355.
KEGGihsa:1355.
UCSCiuc001kqb.4. human. [Q7KZN9-1]
uc001kqc.4. human. [Q7KZN9-2]

Organism-specific databases

CTDi1355.
GeneCardsiGC10M101461.
HGNCiHGNC:2263. COX15.
HPAiHPA037727.
HPA037728.
MIMi256000. phenotype.
603646. gene.
615119. phenotype.
neXtProtiNX_Q7KZN9.
Orphaneti1561. Fatal infantile cytochrome C oxidase deficiency.
70474. Leigh syndrome with cardiomyopathy.
PharmGKBiPA26779.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG1612.
GeneTreeiENSGT00390000002223.
HOVERGENiHBG051086.
InParanoidiQ7KZN9.
KOiK02259.
OMAiTALIYIV.
OrthoDBiEOG7X9G74.
PhylomeDBiQ7KZN9.
TreeFamiTF105073.

Enzyme and pathway databases

UniPathwayiUPA00269; UER00713.
ReactomeiREACT_9465. Heme biosynthesis.

Miscellaneous databases

ChiTaRSiCOX15. human.
GeneWikiiCOX15.
GenomeRNAii1355.
NextBioi5487.
PROiQ7KZN9.
SOURCEiSearch...

Gene expression databases

BgeeiQ7KZN9.
CleanExiHS_COX15.
ExpressionAtlasiQ7KZN9. baseline and differential.
GenevestigatoriQ7KZN9.

Family and domain databases

HAMAPiMF_01665. HemeA_synth_type2.
InterProiIPR003780. COX15/CtaA_fam.
IPR023754. HemeA_Synthase_type2.
IPR009003. Trypsin-like_Pept_dom.
[Graphical view]
PfamiPF02628. COX15-CtaA. 1 hit.
[Graphical view]
SUPFAMiSSF50494. SSF50494. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification and characterization of human cDNAs specific to BCS1, PET112, SCO1, COX15, and COX11, five genes involved in the formation and function of the mitochondrial respiratory chain."
    Petruzzella V., Tiranti V., Fernandez P., Ianna P., Carrozzo R., Zeviani M.
    Genomics 54:494-504(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  2. "Mutations in COX15 produce a defect in the mitochondrial heme biosynthetic pathway, causing early-onset fatal hypertrophic cardiomyopathy."
    Antonicka H., Mattman A., Carlson C.G., Glerum D.M., Hoffbuhr K.C., Leary S.C., Kennaway N.G., Shoubridge E.A.
    Am. J. Hum. Genet. 72:101-114(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, VARIANT CEMCOX2 TRP-217.
  3. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Placenta.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Endometrial tumor.
  6. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Muscle and Skin.
  9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  10. "Functional and genetic studies demonstrate that mutation in the COX15 gene can cause Leigh syndrome."
    Oquendo C.E., Antonicka H., Shoubridge E.A., Reardon W., Brown G.K.
    J. Med. Genet. 41:540-544(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT LS TRP-217.
  11. "Novel mutations in COX15 in a long surviving Leigh syndrome patient with cytochrome c oxidase deficiency."
    Bugiani M., Tiranti V., Farina L., Uziel G., Zeviani M.
    J. Med. Genet. 42:E28-E28(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT LS PRO-344.
  12. Cited for: VARIANT CEMCOX2 TRP-217.

Entry informationi

Entry nameiCOX15_HUMAN
AccessioniPrimary (citable) accession number: Q7KZN9
Secondary accession number(s): A8K6I9
, O60556, O75878, Q5TD00, Q5TD01, Q7Z3Q3, Q9NTN0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: July 5, 2004
Last modified: April 29, 2015
This is version 112 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.