SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q7KZN9

- COX15_HUMAN

UniProt

Q7KZN9 - COX15_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Cytochrome c oxidase assembly protein COX15 homolog

Gene
COX15
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

May be involved in the biosynthesis of heme A.1 Publication

Pathwayi

GO - Molecular functioni

  1. cytochrome-c oxidase activity Source: UniProtKB
  2. oxidoreductase activity, acting on the CH-CH group of donors Source: InterPro

GO - Biological processi

  1. cellular respiration Source: HGNC
  2. heme a biosynthetic process Source: HGNC
  3. heme biosynthetic process Source: Reactome
  4. hydrogen ion transmembrane transport Source: GOC
  5. mitochondrial electron transport, cytochrome c to oxygen Source: HGNC
  6. oxidation-reduction process Source: UniProtKB
  7. porphyrin-containing compound metabolic process Source: Reactome
  8. respiratory chain complex IV assembly Source: HGNC
  9. respiratory gaseous exchange Source: UniProtKB
  10. small molecule metabolic process Source: Reactome
Complete GO annotation...

Enzyme and pathway databases

ReactomeiREACT_9465. Heme biosynthesis.
UniPathwayiUPA00269; UER00713.

Names & Taxonomyi

Protein namesi
Recommended name:
Cytochrome c oxidase assembly protein COX15 homolog
Gene namesi
Name:COX15
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 10

Organism-specific databases

HGNCiHGNC:2263. COX15.

Subcellular locationi

Mitochondrion membrane; Multi-pass membrane protein 1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei68 – 8821Helical; Reviewed predictionAdd
BLAST
Transmembranei154 – 17118Helical; Reviewed predictionAdd
BLAST
Transmembranei184 – 20421Helical; Reviewed predictionAdd
BLAST
Transmembranei227 – 24721Helical; Reviewed predictionAdd
BLAST
Transmembranei269 – 28921Helical; Reviewed predictionAdd
BLAST
Transmembranei324 – 34421Helical; Reviewed predictionAdd
BLAST
Transmembranei357 – 37721Helical; Reviewed predictionAdd
BLAST
Transmembranei382 – 40221Helical; Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. mitochondrial inner membrane Source: Reactome
  3. mitochondrial respiratory chain Source: UniProtKB
  4. mitochondrion Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Membrane, Mitochondrion

Pathology & Biotechi

Involvement in diseasei

Cardioencephalomyopathy, fatal infantile, due to cytochrome c oxidase deficiency 2 (CEMCOX2) [MIM:615119]: An infantile disorder, with a rapidly progressive fatal course, characterized by cytochrome c oxidase deficiency. Clinical features include microcephaly, encephalopathy, hypertrophic cardiomyopathy, persistent lactic acidosis, respiratory distress, hypotonia and seizures. Postmortem cardiac muscle studies show marked complex IV deficiency. Complex IV activity is only slightly decreased in the skeletal muscle.
Note: The disease is caused by mutations affecting the gene represented in this entry.2 Publications
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti217 – 2171R → W in CEMCOX2 and LS. 3 Publications
Corresponds to variant rs28939711 [ dbSNP | Ensembl ].
VAR_019596
Leigh syndrome (LS) [MIM:256000]: An early-onset progressive neurodegenerative disorder characterized by the presence of focal, bilateral lesions in one or more areas of the central nervous system including the brainstem, thalamus, basal ganglia, cerebellum and spinal cord. Clinical features depend on which areas of the central nervous system are involved and include subacute onset of psychomotor retardation, hypotonia, ataxia, weakness, vision loss, eye movement abnormalities, seizures, and dysphagia.
Note: The disease is caused by mutations affecting the gene represented in this entry.2 Publications
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti217 – 2171R → W in CEMCOX2 and LS. 3 Publications
Corresponds to variant rs28939711 [ dbSNP | Ensembl ].
VAR_019596
Natural varianti344 – 3441S → P in LS. 1 Publication
VAR_033117

Keywords - Diseasei

Disease mutation, Leigh syndrome

Organism-specific databases

MIMi256000. phenotype.
615119. phenotype.
Orphaneti1561. Fatal infantile cytochrome C oxidase deficiency.
70474. Leigh syndrome with cardiomyopathy.
PharmGKBiPA26779.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 410410Cytochrome c oxidase assembly protein COX15 homologUniRule annotationPRO_0000183931Add
BLAST

Proteomic databases

MaxQBiQ7KZN9.
PaxDbiQ7KZN9.
PRIDEiQ7KZN9.

PTM databases

PhosphoSiteiQ7KZN9.

Expressioni

Tissue specificityi

Predominantly found in tissues characterized by high rates of oxidative phosphorylation (OxPhos), including muscle, heart, and brain.1 Publication

Gene expression databases

ArrayExpressiQ7KZN9.
BgeeiQ7KZN9.
CleanExiHS_COX15.
GenevestigatoriQ7KZN9.

Organism-specific databases

HPAiHPA037727.
HPA037728.

Interactioni

Protein-protein interaction databases

BioGridi107747. 14 interactions.
IntActiQ7KZN9. 11 interactions.
STRINGi9606.ENSP00000016171.

Structurei

3D structure databases

ProteinModelPortaliQ7KZN9.

Family & Domainsi

Sequence similaritiesi

Belongs to the COX15/CtaA family.

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG1612.
HOVERGENiHBG051086.
InParanoidiQ7KZN9.
KOiK02259.
OMAiLSMVTWK.
OrthoDBiEOG7X9G74.
PhylomeDBiQ7KZN9.
TreeFamiTF105073.

Family and domain databases

HAMAPiMF_01665. HemeA_synth_type2.
InterProiIPR003780. COX15/CtaA_fam.
IPR023754. HemeA_Synthase_type2.
IPR009003. Trypsin-like_Pept_dom.
[Graphical view]
PfamiPF02628. COX15-CtaA. 1 hit.
[Graphical view]
SUPFAMiSSF50494. SSF50494. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q7KZN9-1) [UniParc]FASTAAdd to Basket

Also known as: COX15.1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MQRLLFPPLR ALKGRQYLPL LAPRAAPRAQ CDCIRRPLRP GQYSTISEVA    50
LQSGRGTVSL PSKAAERVVG RWLLVCSGTV AGAVILGGVT RLTESGLSMV 100
DWHLIKEMKP PTSQEEWEAE FQRYQQFPEF KILNHDMTLT EFKFIWYMEY 150
SHRMWGRLVG LVYILPAAYF WRKGWLSRGM KGRVLALCGL VCFQGLLGWY 200
MVKSGLEEKS DSHDIPRVSQ YRLAAHLGSA LVLYCASLWT SLSLLLPPHK 250
LPETHQLLQL RRFAHGTAGL VFLTALSGAF VAGLDAGLVY NSFPKMGESW 300
IPEDLFTFSP ILRNVFENPT MVQFDHRILG ITSVTAITVL YFLSRRIPLP 350
RRTKMAAVTL LALAYTQVGL GISTLLMYVP TPLAATHQSG SLALLTGALW 400
LMNELRRVPK 410
Length:410
Mass (Da):46,030
Last modified:July 5, 2004 - v1
Checksum:i98E9FD9D1D28EFC0
GO
Isoform 2 (identifier: Q7KZN9-2) [UniParc]FASTAAdd to Basket

Also known as: COX15.2

The sequence of this isoform differs from the canonical sequence as follows:
     368-410: VGLGISTLLMYVPTPLAATHQSGSLALLTGALWLMNELRRVPK → GPVLFNFTFKISDLDEGIRNI

Show »
Length:388
Mass (Da):43,835
Checksum:i92A2DAEF334460BB
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti217 – 2171R → W in CEMCOX2 and LS. 3 Publications
Corresponds to variant rs28939711 [ dbSNP | Ensembl ].
VAR_019596
Natural varianti344 – 3441S → P in LS. 1 Publication
VAR_033117

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei368 – 41043VGLGI…RRVPK → GPVLFNFTFKISDLDEGIRN I in isoform 2. VSP_011281Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti28 – 281R → K in AAD08639. 1 Publication
Sequence conflicti28 – 281R → K in AAD08646. 1 Publication
Sequence conflicti93 – 931T → A in CAD97781. 1 Publication
Isoform 2 (identifier: Q7KZN9-2)
Sequence conflicti374 – 3741F → L in AAD08646. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF026850 mRNA. Translation: AAD08639.1.
AF044323 mRNA. Translation: AAD08646.1.
BT007129 mRNA. Translation: AAP35793.1.
AK291654 mRNA. Translation: BAF84343.1.
BX537557 mRNA. Translation: CAD97781.1.
AL133353 Genomic DNA. Translation: CAB88197.1.
AL133353 Genomic DNA. Translation: CAB88198.1.
CH471066 Genomic DNA. Translation: EAW49857.1.
BC002382 mRNA. Translation: AAH02382.3.
BC013403 mRNA. Translation: AAH13403.1.
BC078161 mRNA. Translation: AAH78161.1.
CCDSiCCDS7481.1. [Q7KZN9-2]
CCDS7482.1. [Q7KZN9-1]
RefSeqiNP_004367.2. NM_004376.5. [Q7KZN9-2]
NP_510870.1. NM_078470.4. [Q7KZN9-1]
UniGeneiHs.28326.

Genome annotation databases

EnsembliENST00000016171; ENSP00000016171; ENSG00000014919. [Q7KZN9-1]
ENST00000370483; ENSP00000359514; ENSG00000014919. [Q7KZN9-2]
GeneIDi1355.
KEGGihsa:1355.
UCSCiuc001kqb.4. human. [Q7KZN9-1]
uc001kqc.4. human. [Q7KZN9-2]

Polymorphism databases

DMDMi51315906.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF026850 mRNA. Translation: AAD08639.1 .
AF044323 mRNA. Translation: AAD08646.1 .
BT007129 mRNA. Translation: AAP35793.1 .
AK291654 mRNA. Translation: BAF84343.1 .
BX537557 mRNA. Translation: CAD97781.1 .
AL133353 Genomic DNA. Translation: CAB88197.1 .
AL133353 Genomic DNA. Translation: CAB88198.1 .
CH471066 Genomic DNA. Translation: EAW49857.1 .
BC002382 mRNA. Translation: AAH02382.3 .
BC013403 mRNA. Translation: AAH13403.1 .
BC078161 mRNA. Translation: AAH78161.1 .
CCDSi CCDS7481.1. [Q7KZN9-2 ]
CCDS7482.1. [Q7KZN9-1 ]
RefSeqi NP_004367.2. NM_004376.5. [Q7KZN9-2 ]
NP_510870.1. NM_078470.4. [Q7KZN9-1 ]
UniGenei Hs.28326.

3D structure databases

ProteinModelPortali Q7KZN9.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 107747. 14 interactions.
IntActi Q7KZN9. 11 interactions.
STRINGi 9606.ENSP00000016171.

PTM databases

PhosphoSitei Q7KZN9.

Polymorphism databases

DMDMi 51315906.

Proteomic databases

MaxQBi Q7KZN9.
PaxDbi Q7KZN9.
PRIDEi Q7KZN9.

Protocols and materials databases

DNASUi 1355.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000016171 ; ENSP00000016171 ; ENSG00000014919 . [Q7KZN9-1 ]
ENST00000370483 ; ENSP00000359514 ; ENSG00000014919 . [Q7KZN9-2 ]
GeneIDi 1355.
KEGGi hsa:1355.
UCSCi uc001kqb.4. human. [Q7KZN9-1 ]
uc001kqc.4. human. [Q7KZN9-2 ]

Organism-specific databases

CTDi 1355.
GeneCardsi GC10M101461.
HGNCi HGNC:2263. COX15.
HPAi HPA037727.
HPA037728.
MIMi 256000. phenotype.
603646. gene.
615119. phenotype.
neXtProti NX_Q7KZN9.
Orphaneti 1561. Fatal infantile cytochrome C oxidase deficiency.
70474. Leigh syndrome with cardiomyopathy.
PharmGKBi PA26779.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG1612.
HOVERGENi HBG051086.
InParanoidi Q7KZN9.
KOi K02259.
OMAi LSMVTWK.
OrthoDBi EOG7X9G74.
PhylomeDBi Q7KZN9.
TreeFami TF105073.

Enzyme and pathway databases

UniPathwayi UPA00269 ; UER00713 .
Reactomei REACT_9465. Heme biosynthesis.

Miscellaneous databases

ChiTaRSi COX15. human.
GeneWikii COX15.
GenomeRNAii 1355.
NextBioi 5487.
PROi Q7KZN9.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q7KZN9.
Bgeei Q7KZN9.
CleanExi HS_COX15.
Genevestigatori Q7KZN9.

Family and domain databases

HAMAPi MF_01665. HemeA_synth_type2.
InterProi IPR003780. COX15/CtaA_fam.
IPR023754. HemeA_Synthase_type2.
IPR009003. Trypsin-like_Pept_dom.
[Graphical view ]
Pfami PF02628. COX15-CtaA. 1 hit.
[Graphical view ]
SUPFAMi SSF50494. SSF50494. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification and characterization of human cDNAs specific to BCS1, PET112, SCO1, COX15, and COX11, five genes involved in the formation and function of the mitochondrial respiratory chain."
    Petruzzella V., Tiranti V., Fernandez P., Ianna P., Carrozzo R., Zeviani M.
    Genomics 54:494-504(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  2. "Mutations in COX15 produce a defect in the mitochondrial heme biosynthetic pathway, causing early-onset fatal hypertrophic cardiomyopathy."
    Antonicka H., Mattman A., Carlson C.G., Glerum D.M., Hoffbuhr K.C., Leary S.C., Kennaway N.G., Shoubridge E.A.
    Am. J. Hum. Genet. 72:101-114(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, VARIANT CEMCOX2 TRP-217.
  3. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Placenta.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Endometrial tumor.
  6. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Muscle and Skin.
  9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  10. "Functional and genetic studies demonstrate that mutation in the COX15 gene can cause Leigh syndrome."
    Oquendo C.E., Antonicka H., Shoubridge E.A., Reardon W., Brown G.K.
    J. Med. Genet. 41:540-544(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT LS TRP-217.
  11. "Novel mutations in COX15 in a long surviving Leigh syndrome patient with cytochrome c oxidase deficiency."
    Bugiani M., Tiranti V., Farina L., Uziel G., Zeviani M.
    J. Med. Genet. 42:E28-E28(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT LS PRO-344.
  12. Cited for: VARIANT CEMCOX2 TRP-217.

Entry informationi

Entry nameiCOX15_HUMAN
AccessioniPrimary (citable) accession number: Q7KZN9
Secondary accession number(s): A8K6I9
, O60556, O75878, Q5TD00, Q5TD01, Q7Z3Q3, Q9NTN0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: July 5, 2004
Last modified: September 3, 2014
This is version 107 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi