Q7KZN9 (COX15_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 94.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Cytochrome c oxidase assembly protein COX15 homolog | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 410 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May be involved in the biosynthesis of heme A. Ref.2 |
| Pathway | Porphyrin metabolism; heme A biosynthesis; heme A from heme O: step 1/1. |
| Subcellular location | |
| Tissue specificity | Predominantly found in tissues characterized by high rates of oxidative phosphorylation (OxPhos), including muscle, heart, and brain. Ref.1 |
| Involvement in disease | Mitochondrial complex IV deficiency (MT-C4D) [MIM:220110]: A disorder of the mitochondrial respiratory chain with heterogeneous clinical manifestations, ranging from isolated myopathy to severe multisystem disease affecting several tissues and organs. Features include hypertrophic cardiomyopathy, hepatomegaly and liver dysfunction, hypotonia, muscle weakness, exercise intolerance, developmental delay, delayed motor development and mental retardation. Some affected individuals manifest a fatal hypertrophic cardiomyopathy resulting in neonatal death. A subset of patients manifest Leigh syndrome. Leigh syndrome (LS) [MIM:256000]: An early-onset progressive neurodegenerative disorder characterized by the presence of focal, bilateral lesions in one or more areas of the central nervous system including the brainstem, thalamus, basal ganglia, cerebellum and spinal cord. Clinical features depend on which areas of the central nervous system are involved and include subacute onset of psychomotor retardation, hypotonia, ataxia, weakness, vision loss, eye movement abnormalities, seizures, and dysphagia. |
| Sequence similarities | Belongs to the COX15/CtaA family. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q7KZN9-1) Also known as: COX15.1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q7KZN9-2) Also known as: COX15.2; The sequence of this isoform differs from the canonical sequence as follows: 368-410: VGLGISTLLMYVPTPLAATHQSGSLALLTGALWLMNELRRVPK → GPVLFNFTFKISDLDEGIRNI |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 410 | 410 | Cytochrome c oxidase assembly protein COX15 homolog | PRO_0000183931 | |||||
Regions | |||||||||
| Transmembrane | 68 – 88 | 21 | Helical; Potential | ||||||
| Transmembrane | 154 – 171 | 18 | Helical; Potential | ||||||
| Transmembrane | 184 – 204 | 21 | Helical; Potential | ||||||
| Transmembrane | 227 – 247 | 21 | Helical; Potential | ||||||
| Transmembrane | 269 – 289 | 21 | Helical; Potential | ||||||
| Transmembrane | 324 – 344 | 21 | Helical; Potential | ||||||
| Transmembrane | 357 – 377 | 21 | Helical; Potential | ||||||
| Transmembrane | 382 – 402 | 21 | Helical; Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 368 – 410 | 43 | VGLGI…RRVPK → GPVLFNFTFKISDLDEGIRN I in isoform 2. | VSP_011281 | |||||
| Natural variant | 217 | 1 | R → W in MT-C4D and LS. Ref.2 Ref.10 Corresponds to variant rs28939711 [ dbSNP | Ensembl ]. | VAR_019596 | |||||
| Natural variant | 344 | 1 | S → P in LS. Ref.11 | VAR_033117 | |||||
Experimental info | |||||||||
| Sequence conflict | 28 | 1 | R → K in AAD08639. Ref.1 | ||||||
| Sequence conflict | 28 | 1 | R → K in AAD08646. Ref.1 | ||||||
| Sequence conflict | 93 | 1 | T → A in CAD97781. Ref.3 | ||||||
| Isoform 2: | |||||||||
| Sequence conflict | 374 | 1 | F → L in AAD08646. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification and characterization of human cDNAs specific to BCS1, PET112, SCO1, COX15, and COX11, five genes involved in the formation and function of the mitochondrial respiratory chain." Petruzzella V., Tiranti V., Fernandez P., Ianna P., Carrozzo R., Zeviani M. Genomics 54:494-504(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [2] | "Mutations in COX15 produce a defect in the mitochondrial heme biosynthetic pathway, causing early-onset fatal hypertrophic cardiomyopathy." Antonicka H., Mattman A., Carlson C.G., Glerum D.M., Hoffbuhr K.C., Leary S.C., Kennaway N.G., Shoubridge E.A. Am. J. Hum. Genet. 72:101-114(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, VARIANT MT-C4D TRP-217. |
| [3] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Placenta. |
| [5] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Endometrial tumor. |
| [6] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Muscle and Skin. |
| [9] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [10] | "Functional and genetic studies demonstrate that mutation in the COX15 gene can cause Leigh syndrome." Oquendo C.E., Antonicka H., Shoubridge E.A., Reardon W., Brown G.K. J. Med. Genet. 41:540-544(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT LS TRP-217. |
| [11] | "Novel mutations in COX15 in a long surviving Leigh syndrome patient with cytochrome c oxidase deficiency." Bugiani M., Tiranti V., Farina L., Uziel G., Zeviani M. J. Med. Genet. 42:E28-E28(2005) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT LS PRO-344. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF026850 mRNA. Translation: AAD08639.1. AF044323 mRNA. Translation: AAD08646.1. BT007129 mRNA. Translation: AAP35793.1. AK291654 mRNA. Translation: BAF84343.1. BX537557 mRNA. Translation: CAD97781.1. AL133353 Genomic DNA. Translation: CAB88197.1. AL133353 Genomic DNA. Translation: CAB88198.1. CH471066 Genomic DNA. Translation: EAW49857.1. BC002382 mRNA. Translation: AAH02382.3. BC013403 mRNA. Translation: AAH13403.1. BC078161 mRNA. Translation: AAH78161.1. |
| IPI | IPI00419869. IPI00455190. |
| RefSeq | NP_004367.2. NM_004376.5. NP_510870.1. NM_078470.4. |
| UniGene | Hs.28326. |
3D structure databases | |
| ProteinModelPortal | Q7KZN9. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q7KZN9. 1 interaction. |
| STRING | 9606.ENSP00000016171. |
PTM databases | |
| PhosphoSite | Q7KZN9. |
Polymorphism databases | |
| DMDM | 51315906. |
Proteomic databases | |
| PaxDb | Q7KZN9. |
| PRIDE | Q7KZN9. |
Protocols and materials databases | |
| DNASU | 1355. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000016171; ENSP00000016171; ENSG00000014919. ENST00000370483; ENSP00000359514; ENSG00000014919. |
| GeneID | 1355. |
| KEGG | hsa:1355. |
| UCSC | uc001kqb.4. human. uc001kqc.4. human. |
Organism-specific databases | |
| CTD | 1355. |
| GeneCards | GC10M101461. |
| HGNC | HGNC:2263. COX15. |
| HPA | HPA037727. HPA037728. |
| MIM | 220110. phenotype. 256000. phenotype. 603646. gene. |
| neXtProt | NX_Q7KZN9. |
| Orphanet | 1561. Fatal infantile cytochrome C oxidase deficiency. 70474. Leigh syndrome with cardiomyopathy. |
| PharmGKB | PA26779. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG1612. |
| HOVERGEN | HBG051086. |
| InParanoid | Q7KZN9. |
| KO | K02259. |
| OMA | KTIFWWE. |
| PhylomeDB | Q7KZN9. |
Enzyme and pathway databases | |
| UniPathway | UPA00269; UER00713. |
Gene expression databases | |
| ArrayExpress | Q7KZN9. |
| Bgee | Q7KZN9. |
| CleanEx | HS_COX15. |
| Genevestigator | Q7KZN9. |
| GermOnline | ENSG00000014919. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR003780. HemeA_syn. IPR023754. HemeA_Synthase_type2. IPR009003. Trypsin-like_Pept_dom. [Graphical view] |
| Pfam | PF02628. COX15-CtaA. 1 hit. [Graphical view] |
| SUPFAM | SSF50494. Pept_Ser_Cys. 1 hit. |
| ProtoNet | Search... |
Other | |
| ChiTaRS | COX15. human. |
| GenomeRNAi | 1355. |
| NextBio | 5487. |
| SOURCE | Search... |
Entry information
| Entry name | COX15_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q7KZN9 Secondary accession number(s): A8K6I9 Q9NTN0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
