Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q7KZN9

- COX15_HUMAN

UniProt

Q7KZN9 - COX15_HUMAN

Protein

Cytochrome c oxidase assembly protein COX15 homolog

Gene

COX15

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 108 (01 Oct 2014)
      Sequence version 1 (05 Jul 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May be involved in the biosynthesis of heme A.1 Publication

    Pathwayi

    GO - Molecular functioni

    1. cytochrome-c oxidase activity Source: UniProtKB
    2. oxidoreductase activity, acting on the CH-CH group of donors Source: InterPro

    GO - Biological processi

    1. cellular respiration Source: HGNC
    2. heme a biosynthetic process Source: HGNC
    3. heme biosynthetic process Source: Reactome
    4. hydrogen ion transmembrane transport Source: GOC
    5. mitochondrial electron transport, cytochrome c to oxygen Source: HGNC
    6. oxidation-reduction process Source: UniProtKB
    7. porphyrin-containing compound metabolic process Source: Reactome
    8. respiratory chain complex IV assembly Source: HGNC
    9. respiratory gaseous exchange Source: UniProtKB
    10. small molecule metabolic process Source: Reactome

    Enzyme and pathway databases

    ReactomeiREACT_9465. Heme biosynthesis.
    UniPathwayiUPA00269; UER00713.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cytochrome c oxidase assembly protein COX15 homolog
    Gene namesi
    Name:COX15
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 10

    Organism-specific databases

    HGNCiHGNC:2263. COX15.

    Subcellular locationi

    Mitochondrion membrane 1 Publication; Multi-pass membrane protein 1 Publication

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. mitochondrial inner membrane Source: Reactome
    3. mitochondrial respiratory chain Source: UniProtKB
    4. mitochondrion Source: BHF-UCL

    Keywords - Cellular componenti

    Membrane, Mitochondrion

    Pathology & Biotechi

    Involvement in diseasei

    Cardioencephalomyopathy, fatal infantile, due to cytochrome c oxidase deficiency 2 (CEMCOX2) [MIM:615119]: An infantile disorder, with a rapidly progressive fatal course, characterized by cytochrome c oxidase deficiency. Clinical features include microcephaly, encephalopathy, hypertrophic cardiomyopathy, persistent lactic acidosis, respiratory distress, hypotonia and seizures. Postmortem cardiac muscle studies show marked complex IV deficiency. Complex IV activity is only slightly decreased in the skeletal muscle.2 Publications
    Note: The disease is caused by mutations affecting the gene represented in this entry.
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti217 – 2171R → W in CEMCOX2 and LS. 3 Publications
    Corresponds to variant rs28939711 [ dbSNP | Ensembl ].
    VAR_019596
    Leigh syndrome (LS) [MIM:256000]: An early-onset progressive neurodegenerative disorder characterized by the presence of focal, bilateral lesions in one or more areas of the central nervous system including the brainstem, thalamus, basal ganglia, cerebellum and spinal cord. Clinical features depend on which areas of the central nervous system are involved and include subacute onset of psychomotor retardation, hypotonia, ataxia, weakness, vision loss, eye movement abnormalities, seizures, and dysphagia.2 Publications
    Note: The disease is caused by mutations affecting the gene represented in this entry.
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti217 – 2171R → W in CEMCOX2 and LS. 3 Publications
    Corresponds to variant rs28939711 [ dbSNP | Ensembl ].
    VAR_019596
    Natural varianti344 – 3441S → P in LS. 1 Publication
    VAR_033117

    Keywords - Diseasei

    Disease mutation, Leigh syndrome

    Organism-specific databases

    MIMi256000. phenotype.
    615119. phenotype.
    Orphaneti1561. Fatal infantile cytochrome C oxidase deficiency.
    70474. Leigh syndrome with cardiomyopathy.
    PharmGKBiPA26779.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 410410Cytochrome c oxidase assembly protein COX15 homologPRO_0000183931Add
    BLAST

    Proteomic databases

    MaxQBiQ7KZN9.
    PaxDbiQ7KZN9.
    PRIDEiQ7KZN9.

    PTM databases

    PhosphoSiteiQ7KZN9.

    Expressioni

    Tissue specificityi

    Predominantly found in tissues characterized by high rates of oxidative phosphorylation (OxPhos), including muscle, heart, and brain.1 Publication

    Gene expression databases

    ArrayExpressiQ7KZN9.
    BgeeiQ7KZN9.
    CleanExiHS_COX15.
    GenevestigatoriQ7KZN9.

    Organism-specific databases

    HPAiHPA037727.
    HPA037728.

    Interactioni

    Protein-protein interaction databases

    BioGridi107747. 14 interactions.
    IntActiQ7KZN9. 11 interactions.
    STRINGi9606.ENSP00000016171.

    Structurei

    3D structure databases

    ProteinModelPortaliQ7KZN9.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei68 – 8821HelicalSequence AnalysisAdd
    BLAST
    Transmembranei154 – 17118HelicalSequence AnalysisAdd
    BLAST
    Transmembranei184 – 20421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei227 – 24721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei269 – 28921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei324 – 34421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei357 – 37721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei382 – 40221HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the COX15/CtaA family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG1612.
    HOVERGENiHBG051086.
    InParanoidiQ7KZN9.
    KOiK02259.
    OMAiLSMVTWK.
    OrthoDBiEOG7X9G74.
    PhylomeDBiQ7KZN9.
    TreeFamiTF105073.

    Family and domain databases

    HAMAPiMF_01665. HemeA_synth_type2.
    InterProiIPR003780. COX15/CtaA_fam.
    IPR023754. HemeA_Synthase_type2.
    IPR009003. Trypsin-like_Pept_dom.
    [Graphical view]
    PfamiPF02628. COX15-CtaA. 1 hit.
    [Graphical view]
    SUPFAMiSSF50494. SSF50494. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q7KZN9-1) [UniParc]FASTAAdd to Basket

    Also known as: COX15.1

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MQRLLFPPLR ALKGRQYLPL LAPRAAPRAQ CDCIRRPLRP GQYSTISEVA    50
    LQSGRGTVSL PSKAAERVVG RWLLVCSGTV AGAVILGGVT RLTESGLSMV 100
    DWHLIKEMKP PTSQEEWEAE FQRYQQFPEF KILNHDMTLT EFKFIWYMEY 150
    SHRMWGRLVG LVYILPAAYF WRKGWLSRGM KGRVLALCGL VCFQGLLGWY 200
    MVKSGLEEKS DSHDIPRVSQ YRLAAHLGSA LVLYCASLWT SLSLLLPPHK 250
    LPETHQLLQL RRFAHGTAGL VFLTALSGAF VAGLDAGLVY NSFPKMGESW 300
    IPEDLFTFSP ILRNVFENPT MVQFDHRILG ITSVTAITVL YFLSRRIPLP 350
    RRTKMAAVTL LALAYTQVGL GISTLLMYVP TPLAATHQSG SLALLTGALW 400
    LMNELRRVPK 410
    Length:410
    Mass (Da):46,030
    Last modified:July 5, 2004 - v1
    Checksum:i98E9FD9D1D28EFC0
    GO
    Isoform 2 (identifier: Q7KZN9-2) [UniParc]FASTAAdd to Basket

    Also known as: COX15.2

    The sequence of this isoform differs from the canonical sequence as follows:
         368-410: VGLGISTLLMYVPTPLAATHQSGSLALLTGALWLMNELRRVPK → GPVLFNFTFKISDLDEGIRNI

    Show »
    Length:388
    Mass (Da):43,835
    Checksum:i92A2DAEF334460BB
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti28 – 281R → K in AAD08639. (PubMed:9878253)Curated
    Sequence conflicti28 – 281R → K in AAD08646. (PubMed:9878253)Curated
    Sequence conflicti93 – 931T → A in CAD97781. 1 PublicationCurated
    Isoform 2 (identifier: Q7KZN9-2)
    Sequence conflicti374 – 3741F → L in AAD08646. (PubMed:9878253)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti217 – 2171R → W in CEMCOX2 and LS. 3 Publications
    Corresponds to variant rs28939711 [ dbSNP | Ensembl ].
    VAR_019596
    Natural varianti344 – 3441S → P in LS. 1 Publication
    VAR_033117

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei368 – 41043VGLGI…RRVPK → GPVLFNFTFKISDLDEGIRN I in isoform 2. 1 PublicationVSP_011281Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF026850 mRNA. Translation: AAD08639.1.
    AF044323 mRNA. Translation: AAD08646.1.
    BT007129 mRNA. Translation: AAP35793.1.
    AK291654 mRNA. Translation: BAF84343.1.
    BX537557 mRNA. Translation: CAD97781.1.
    AL133353 Genomic DNA. Translation: CAB88197.1.
    AL133353 Genomic DNA. Translation: CAB88198.1.
    CH471066 Genomic DNA. Translation: EAW49857.1.
    BC002382 mRNA. Translation: AAH02382.3.
    BC013403 mRNA. Translation: AAH13403.1.
    BC078161 mRNA. Translation: AAH78161.1.
    CCDSiCCDS7481.1. [Q7KZN9-2]
    CCDS7482.1. [Q7KZN9-1]
    RefSeqiNP_004367.2. NM_004376.5. [Q7KZN9-2]
    NP_510870.1. NM_078470.4. [Q7KZN9-1]
    UniGeneiHs.28326.

    Genome annotation databases

    EnsembliENST00000016171; ENSP00000016171; ENSG00000014919. [Q7KZN9-1]
    ENST00000370483; ENSP00000359514; ENSG00000014919. [Q7KZN9-2]
    GeneIDi1355.
    KEGGihsa:1355.
    UCSCiuc001kqb.4. human. [Q7KZN9-1]
    uc001kqc.4. human. [Q7KZN9-2]

    Polymorphism databases

    DMDMi51315906.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF026850 mRNA. Translation: AAD08639.1 .
    AF044323 mRNA. Translation: AAD08646.1 .
    BT007129 mRNA. Translation: AAP35793.1 .
    AK291654 mRNA. Translation: BAF84343.1 .
    BX537557 mRNA. Translation: CAD97781.1 .
    AL133353 Genomic DNA. Translation: CAB88197.1 .
    AL133353 Genomic DNA. Translation: CAB88198.1 .
    CH471066 Genomic DNA. Translation: EAW49857.1 .
    BC002382 mRNA. Translation: AAH02382.3 .
    BC013403 mRNA. Translation: AAH13403.1 .
    BC078161 mRNA. Translation: AAH78161.1 .
    CCDSi CCDS7481.1. [Q7KZN9-2 ]
    CCDS7482.1. [Q7KZN9-1 ]
    RefSeqi NP_004367.2. NM_004376.5. [Q7KZN9-2 ]
    NP_510870.1. NM_078470.4. [Q7KZN9-1 ]
    UniGenei Hs.28326.

    3D structure databases

    ProteinModelPortali Q7KZN9.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 107747. 14 interactions.
    IntActi Q7KZN9. 11 interactions.
    STRINGi 9606.ENSP00000016171.

    PTM databases

    PhosphoSitei Q7KZN9.

    Polymorphism databases

    DMDMi 51315906.

    Proteomic databases

    MaxQBi Q7KZN9.
    PaxDbi Q7KZN9.
    PRIDEi Q7KZN9.

    Protocols and materials databases

    DNASUi 1355.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000016171 ; ENSP00000016171 ; ENSG00000014919 . [Q7KZN9-1 ]
    ENST00000370483 ; ENSP00000359514 ; ENSG00000014919 . [Q7KZN9-2 ]
    GeneIDi 1355.
    KEGGi hsa:1355.
    UCSCi uc001kqb.4. human. [Q7KZN9-1 ]
    uc001kqc.4. human. [Q7KZN9-2 ]

    Organism-specific databases

    CTDi 1355.
    GeneCardsi GC10M101461.
    HGNCi HGNC:2263. COX15.
    HPAi HPA037727.
    HPA037728.
    MIMi 256000. phenotype.
    603646. gene.
    615119. phenotype.
    neXtProti NX_Q7KZN9.
    Orphaneti 1561. Fatal infantile cytochrome C oxidase deficiency.
    70474. Leigh syndrome with cardiomyopathy.
    PharmGKBi PA26779.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG1612.
    HOVERGENi HBG051086.
    InParanoidi Q7KZN9.
    KOi K02259.
    OMAi LSMVTWK.
    OrthoDBi EOG7X9G74.
    PhylomeDBi Q7KZN9.
    TreeFami TF105073.

    Enzyme and pathway databases

    UniPathwayi UPA00269 ; UER00713 .
    Reactomei REACT_9465. Heme biosynthesis.

    Miscellaneous databases

    ChiTaRSi COX15. human.
    GeneWikii COX15.
    GenomeRNAii 1355.
    NextBioi 5487.
    PROi Q7KZN9.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q7KZN9.
    Bgeei Q7KZN9.
    CleanExi HS_COX15.
    Genevestigatori Q7KZN9.

    Family and domain databases

    HAMAPi MF_01665. HemeA_synth_type2.
    InterProi IPR003780. COX15/CtaA_fam.
    IPR023754. HemeA_Synthase_type2.
    IPR009003. Trypsin-like_Pept_dom.
    [Graphical view ]
    Pfami PF02628. COX15-CtaA. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50494. SSF50494. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Identification and characterization of human cDNAs specific to BCS1, PET112, SCO1, COX15, and COX11, five genes involved in the formation and function of the mitochondrial respiratory chain."
      Petruzzella V., Tiranti V., Fernandez P., Ianna P., Carrozzo R., Zeviani M.
      Genomics 54:494-504(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    2. "Mutations in COX15 produce a defect in the mitochondrial heme biosynthetic pathway, causing early-onset fatal hypertrophic cardiomyopathy."
      Antonicka H., Mattman A., Carlson C.G., Glerum D.M., Hoffbuhr K.C., Leary S.C., Kennaway N.G., Shoubridge E.A.
      Am. J. Hum. Genet. 72:101-114(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, VARIANT CEMCOX2 TRP-217.
    3. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
      Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
      Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Placenta.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Endometrial tumor.
    6. "The DNA sequence and comparative analysis of human chromosome 10."
      Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
      , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
      Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Muscle and Skin.
    9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    10. "Functional and genetic studies demonstrate that mutation in the COX15 gene can cause Leigh syndrome."
      Oquendo C.E., Antonicka H., Shoubridge E.A., Reardon W., Brown G.K.
      J. Med. Genet. 41:540-544(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT LS TRP-217.
    11. "Novel mutations in COX15 in a long surviving Leigh syndrome patient with cytochrome c oxidase deficiency."
      Bugiani M., Tiranti V., Farina L., Uziel G., Zeviani M.
      J. Med. Genet. 42:E28-E28(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT LS PRO-344.
    12. Cited for: VARIANT CEMCOX2 TRP-217.

    Entry informationi

    Entry nameiCOX15_HUMAN
    AccessioniPrimary (citable) accession number: Q7KZN9
    Secondary accession number(s): A8K6I9
    , O60556, O75878, Q5TD00, Q5TD01, Q7Z3Q3, Q9NTN0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 16, 2004
    Last sequence update: July 5, 2004
    Last modified: October 1, 2014
    This is version 108 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 10
      Human chromosome 10: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3