Q7KZ85 (SPT6H_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 98.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Transcription elongation factor SPT6 Short name=hSPT6 Alternative name(s): Tat-cotransactivator 2 protein Short name=Tat-CT2 protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1726 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acts to stimulate transcriptional elongation by RNA polymerase II. Ref.6 Ref.7 |
| Subunit structure | Interacts with RNA polymerase II and the DRB sensitivity-inducing factor complex (DSIF complex), which is composed of SUPT5H and SUPT4H1. Interacts with human cytomegalovirus/HHV-5 protein UL69. Ref.7 Ref.16 |
| Subcellular location | Nucleus Probable. |
| Tissue specificity | Ubiquitously expressed. |
| Sequence similarities | Belongs to the SPT6 family. Contains 1 S1 motif domain. Contains 1 SH2 domain. |
| Sequence caution | The sequence AAB18949.1 differs from that shown. Reason: Frameshift at position 988. The sequence AAC50821.1 differs from that shown. Reason: Erroneous initiation. The sequence AAH33074.1 differs from that shown. Reason: Erroneous initiation. The sequence BAA11479.2 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q7KZ85-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q7KZ85-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1181: Missing. 1182-1211: ESYDQAIRNDETGLWQCPFCQQDNFPELSE → MPSRGTRPEDSSVLIPTDNSTPHKEDLSSK | ||||||
| Isoform 3 (identifier: Q7KZ85-3) The sequence of this isoform differs from the canonical sequence as follows: 617-1616: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.15 | ||||||
| Chain | 2 – 1726 | 1725 | Transcription elongation factor SPT6 | PRO_0000072171 | |||||
Regions | |||||||||
| Domain | 1213 – 1282 | 70 | S1 motif | ||||||
| Domain | 1325 – 1431 | 107 | SH2 | ||||||
| Compositional bias | 6 – 250 | 245 | Asp/Glu-rich | ||||||
| Compositional bias | 1525 – 1528 | 4 | Poly-Ser | ||||||
| Compositional bias | 1654 – 1657 | 4 | Poly-Ser | ||||||
Amino acid modifications | |||||||||
| Modified residue | 2 | 1 | N-acetylserine Ref.15 | ||||||
| Modified residue | 7 | 1 | Phosphoserine Ref.15 | ||||||
| Modified residue | 12 | 1 | Phosphoserine Ref.15 | ||||||
| Modified residue | 73 | 1 | Phosphoserine Ref.11 | ||||||
| Modified residue | 75 | 1 | Phosphoserine Ref.11 | ||||||
| Modified residue | 78 | 1 | Phosphoserine Ref.11 | ||||||
| Modified residue | 125 | 1 | Phosphoserine Ref.8 Ref.13 Ref.15 | ||||||
| Modified residue | 267 | 1 | Phosphoserine Ref.10 | ||||||
| Modified residue | 743 | 1 | N6-acetyllysine Ref.12 | ||||||
| Modified residue | 1523 | 1 | Phosphothreonine Ref.10 Ref.13 | ||||||
| Modified residue | 1532 | 1 | Phosphothreonine Ref.11 Ref.13 | ||||||
| Modified residue | 1535 | 1 | Phosphoserine Ref.9 Ref.10 Ref.11 Ref.15 | ||||||
| Modified residue | 1539 | 1 | Phosphothreonine Ref.9 Ref.10 Ref.11 | ||||||
| Modified residue | 1676 | 1 | N6-acetyllysine Ref.12 | ||||||
| Modified residue | 1697 | 1 | Phosphothreonine Ref.11 Ref.13 | ||||||
| Modified residue | 1701 | 1 | Phosphoserine Ref.10 Ref.11 Ref.13 | ||||||
| Modified residue | 1703 | 1 | Phosphoserine Ref.10 Ref.11 Ref.13 | ||||||
| Modified residue | 1718 | 1 | Phosphothreonine Ref.9 Ref.10 Ref.11 Ref.13 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 1181 | 1181 | Missing in isoform 2. | VSP_011505 | |||||
| Alternative sequence | 617 – 1616 | 1000 | Missing in isoform 3. | VSP_011507 | |||||
| Alternative sequence | 1182 – 1211 | 30 | ESYDQ…PELSE → MPSRGTRPEDSSVLIPTDNS TPHKEDLSSK in isoform 2. | VSP_011506 | |||||
Experimental info | |||||||||
| Sequence conflict | 61 – 73 | 13 | DDDED…EDEGS → ATAPGHPKLSEGR in AAC50821. Ref.1 | ||||||
| Sequence conflict | 100 – 109 | 10 | DFDLIEENLG → LEDDDFLLNE in AAH33074. Ref.4 | ||||||
| Sequence conflict | 988 – 994 | 7 | YVCGLGP → VCLWPGT Ref.1 | ||||||
| Sequence conflict | 1545 | 1 | L → P in AAH17105. Ref.4 | ||||||
| Sequence conflict | 1627 | 1 | S → I in AAH17105. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification and analysis of the human and murine putative chromatin structure regulator SUPT6H and Supt6h." Chiang P.-W., Wang S., Smithivas P., Song W.-J., Ramamoorthy S., Hillman J., Puett S., Van Keuren M.L., Crombez E., Kumar A., Glover T.W., Miller D.E., Tsai C.-H., Blackburn C.C., Chen X.-N., Sun Z., Cheng J.-F., Korenberg J.R., Kurnit D.M. Genomics 34:328-333(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Prediction of the coding sequences of unidentified human genes. V. The coding sequences of 40 new genes (KIAA0161-KIAA0200) deduced by analysis of cDNA clones from human cell line KG-1." Nagase T., Seki N., Ishikawa K., Tanaka A., Nomura N. DNA Res. 3:17-24(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Bone marrow. |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3). Tissue: Cervix, Lung, Melanoma, Placenta and Testis. |
| [5] | Yu W., Gibbs R.A. Submitted (JUN-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1460-1726 (ISOFORMS 1/2). Tissue: Brain. |
| [6] | "Role of the human homolog of the yeast transcription factor SPT5 in HIV-1 Tat-activation." Wu-Baer F., Lane W.S., Gaynor R.B. J. Mol. Biol. 277:179-197(1998) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [7] | "Human Spt6 stimulates transcription elongation by RNA polymerase II in vitro." Endoh M., Zhu W., Hasegawa J., Watanabe H., Kim D.-K., Aida M., Inukai N., Narita T., Yamada T., Furuya A., Sato H., Yamaguchi Y., Mandal S.S., Reinberg D., Wada T., Handa H. Mol. Cell. Biol. 24:3324-3336(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH THE DSIF COMPLEX AND RNA POLYMERASE II. |
| [8] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-125, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1535; THR-1539 AND THR-1718, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-267; THR-1523; SER-1535; THR-1539; SER-1701; SER-1703 AND THR-1718, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [11] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-73; SER-75; SER-78; THR-1532; SER-1535; THR-1539; THR-1697; SER-1701; SER-1703 AND THR-1718, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [12] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-743 AND LYS-1676, MASS SPECTROMETRY. |
| [13] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-125; THR-1523; THR-1532; THR-1697; SER-1701; SER-1703 AND THR-1718, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [14] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [15] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT SER-2, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-7; SER-12; SER-125 AND SER-1535, MASS SPECTROMETRY, CLEAVAGE OF INITIATOR METHIONINE. |
| [16] | "The cellular protein SPT6 is required for efficient replication of human cytomegalovirus." Cygnar D., Hagemeier S., Kronemann D., Bresnahan W.A. J. Virol. 86:2011-2020(2012) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH HHV-5 PROTEIN UL69. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U38623 mRNA. Translation: AAC99996.1. U38658 mRNA. Translation: AAB18949.1. Frameshift. U46691 mRNA. Translation: AAC50821.1. Different initiation. D79984 mRNA. Translation: BAA11479.2. Different initiation. CH471159 Genomic DNA. Translation: EAW51117.1. BC003692 mRNA. Translation: AAH03692.1. BC003696 mRNA. Translation: AAH03696.1. BC017105 mRNA. Translation: AAH17105.1. BC033074 mRNA. Translation: AAH33074.1. Different initiation. BC073963 mRNA. Translation: AAH73963.1. BC136522 mRNA. Translation: AAI36523.1. BC136524 mRNA. Translation: AAI36525.1. BC150268 mRNA. Translation: AAI50269.1. AF070532 mRNA. Translation: AAC28631.1. |
| IPI | IPI00430770. IPI00456683. IPI00784161. |
| RefSeq | NP_003161.2. NM_003170.3. |
| UniGene | Hs.250429. |
3D structure databases | |
| ProteinModelPortal | Q7KZ85. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-42615N. |
| IntAct | Q7KZ85. 7 interactions. |
| MINT | MINT-1491202. |
PTM databases | |
| PhosphoSite | Q7KZ85. |
Polymorphism databases | |
| DMDM | 51701986. |
Proteomic databases | |
| PaxDb | Q7KZ85. |
| PeptideAtlas | Q7KZ85. |
| PRIDE | Q7KZ85. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000314616; ENSP00000319104; ENSG00000109111. ENST00000347486; ENSP00000338143; ENSG00000109111. |
| GeneID | 6830. |
| KEGG | hsa:6830. |
| UCSC | uc002hby.3. human. |
Organism-specific databases | |
| CTD | 6830. |
| GeneCards | GC17P026989. |
| HGNC | HGNC:11470. SUPT6H. |
| HPA | CAB012416. |
| MIM | 601333. gene. |
| neXtProt | NX_Q7KZ85. |
| PharmGKB | PA36256. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG2183. |
| HOVERGEN | HBG093994. |
| InParanoid | Q7KZ85. |
| KO | K11292. |
| OMA | EADWIYR. |
Gene expression databases | |
| Bgee | Q7KZ85. |
| Genevestigator | Q7KZ85. |
| GermOnline | ENSG00000109111. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.10.150.310. 1 hit. 1.10.3500.10. 2 hits. 2.40.50.140. 1 hit. 3.30.420.140. 1 hit. 3.30.505.10. 1 hit. |
| InterPro | IPR012340. NA-bd_OB-fold. IPR003029. Rbsml_prot_S1_RNA-bd_dom. IPR022967. RNA-binding_domain_S1. IPR000980. SH2. IPR023323. Tex-like_dom. IPR023097. Tex_RuvX-like_dom. IPR017072. TF_Spt6. IPR006641. YqgF/RNaseH-like_dom. [Graphical view] |
| PANTHER | PTHR10145. PTHR10145. 1 hit. |
| Pfam | PF00575. S1. 1 hit. PF00017. SH2. 1 hit. [Graphical view] |
| PIRSF | PIRSF036947. Spt6. 1 hit. |
| SMART | SM00316. S1. 1 hit. SM00252. SH2. 1 hit. SM00732. YqgFc. 1 hit. [Graphical view] |
| SUPFAM | SSF50249. Nucleic_acid_OB. 1 hit. |
| PROSITE | PS50126. S1. 1 hit. PS50001. SH2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | SUPT6H. human. |
| GenomeRNAi | 6830. |
| NextBio | 26667. |
| PMAP-CutDB | Q7KZ85. |
| SOURCE | Search... |
Entry information
| Entry name | SPT6H_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q7KZ85 Secondary accession number(s): A7E2B4 Q9BTI2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
