Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q7KN62

- TERA_DROME

UniProt

Q7KN62 - TERA_DROME

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Transitional endoplasmic reticulum ATPase TER94

Gene

TER94

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Necessary for the fragmentation of Golgi stacks during mitosis and for their reassembly after mitosis. Involved in the formation of the transitional endoplasmic reticulum (tER). The transfer of membranes from the endoplasmic reticulum to the Golgi apparatus occurs via 50-70 nm transition vesicles which derive from part-rough, part-smooth transitional elements of the endoplasmic reticulum (tER). Vesicle budding from the tER is an ATP-dependent process. Involved in the ubiquitin-proteasome system. Important for oskar mRNA localization and/or anchoring during oogenesis. Involved in germ cell formation.2 Publications

Catalytic activityi

ATP + H2O = ADP + phosphate.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei345 – 3451ATPBy similarity
Binding sitei381 – 3811ATPBy similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi244 – 2507ATPBy similarity

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. hydrolase activity Source: UniProtKB-KW

GO - Biological processi

  1. ATP catabolic process Source: FlyBase
  2. cellular response to virus Source: FlyBase
  3. dendrite morphogenesis Source: FlyBase
  4. endoplasmic reticulum membrane fusion Source: FlyBase
  5. endoplasmic reticulum organization Source: FlyBase
  6. ER-associated ubiquitin-dependent protein catabolic process Source: FlyBase
  7. Golgi organization Source: FlyBase
  8. microtubule cytoskeleton organization Source: FlyBase
  9. oogenesis Source: UniProtKB-KW
  10. pole cell formation Source: FlyBase
  11. positive regulation of neuron apoptotic process Source: FlyBase
  12. positive regulation of proteasomal ubiquitin-dependent protein catabolic process Source: FlyBase
  13. positive regulation of viral entry into host cell Source: FlyBase
  14. proteolysis Source: FlyBase
  15. regulation of neuron apoptotic process Source: FlyBase
  16. regulation of pole plasm oskar mRNA localization Source: FlyBase
  17. transport Source: UniProtKB-KW
  18. ubiquitin-dependent protein catabolic process Source: FlyBase
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Hydrolase

Keywords - Biological processi

Differentiation, Oogenesis, Transport, Ubl conjugation pathway

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Transitional endoplasmic reticulum ATPase TER94 (EC:3.6.4.6)
Alternative name(s):
Valosin-containing protein homolog
Gene namesi
Name:TER94
Synonyms:VCP
ORF Names:CG2331
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
ProteomesiUP000000803: Chromosome 2R

Organism-specific databases

FlyBaseiFBgn0261014. TER94.

Subcellular locationi

Cytoplasm. Nucleus
Note: Component of the meiotic nuage, also named P granule, a germ-cell-specific organelle required to repress transposon activity during meiosis.

GO - Cellular componenti

  1. cytoplasm Source: FlyBase
  2. fusome Source: FlyBase
  3. lipid particle Source: FlyBase
  4. microtubule associated complex Source: FlyBase
  5. nucleus Source: UniProtKB-KW
  6. P granule Source: FlyBase
  7. proteasome complex Source: FlyBase
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi437 – 4371E → A in ter94-26-8; arrests early in oogenesis. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 801801Transitional endoplasmic reticulum ATPase TER94PRO_0000347178Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei716 – 7161Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ7KN62.
PRIDEiQ7KN62.

Expressioni

Tissue specificityi

Present in the mushroom bodies of the protocerebrum and in the glomeruli of the antennal lobe. Present in nurse cells, oocytes and sperm bundles (at protein level).3 Publications

Developmental stagei

Present in egg, pupa and imago but not larva (at protein level).1 Publication

Gene expression databases

BgeeiQ7KN62.

Interactioni

Subunit structurei

Homohexamer. Interacts with tud, vas, papi and AGO3.3 Publications

Protein-protein interaction databases

BioGridi61868. 79 interactions.
IntActiQ7KN62. 5 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ7KN62.
SMRiQ7KN62. Positions 14-761.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the AAA ATPase family.Curated

Phylogenomic databases

eggNOGiCOG0464.
GeneTreeiENSGT00740000115575.
InParanoidiQ7KN62.
KOiK13525.
OMAiHACADIK.
OrthoDBiEOG7H4DSW.
PhylomeDBiQ7KN62.

Family and domain databases

Gene3Di3.10.330.10. 1 hit.
3.40.50.300. 2 hits.
InterProiIPR003593. AAA+_ATPase.
IPR005938. AAA_ATPase_CDC48.
IPR009010. Asp_de-COase-like_dom.
IPR003959. ATPase_AAA_core.
IPR003960. ATPase_AAA_CS.
IPR004201. Cdc48_dom2.
IPR029067. CDC48_domain_2-like.
IPR003338. CDC4_N-term_subdom.
IPR027417. P-loop_NTPase.
IPR015415. Vps4_C.
[Graphical view]
PfamiPF00004. AAA. 2 hits.
PF02933. CDC48_2. 1 hit.
PF02359. CDC48_N. 1 hit.
PF09336. Vps4_C. 1 hit.
[Graphical view]
SMARTiSM00382. AAA. 2 hits.
SM01072. CDC48_2. 1 hit.
SM01073. CDC48_N. 1 hit.
[Graphical view]
SUPFAMiSSF50692. SSF50692. 1 hit.
SSF52540. SSF52540. 2 hits.
SSF54585. SSF54585. 1 hit.
TIGRFAMsiTIGR01243. CDC48. 1 hit.
PROSITEiPS00674. AAA. 2 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform A (identifier: Q7KN62-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MADSKGEDLA TAILKRKDRP NRLIVEEAQN DDNSVVSLSQ AKMDELQLFR
60 70 80 90 100
GDTVILKGKR RKETVCIVLS DDTCPDEKIR MNRVVRNNLC VHLSDVVSVQ
110 120 130 140 150
SCPDVKYGKR VRILPIDEST EGVTGNLFEI YLKPYFLEAY RPIHMGDNFI
160 170 180 190 200
VRAAMRPIEF KVVLTDPEPY CIVAPETVIF CDGDPIKREE EEESLNAVGY
210 220 230 240 250
DDIGGCRKQL AQIKEMVELP LRHPSLFKAI GVKPPRGILM YGPPGTGKTL
260 270 280 290 300
IARAVANETG AFFFLINGPE IMSKLAGESE SNLRKAFEEA EKNSPAIIFI
310 320 330 340 350
DEIDAIAPKR DKTHGEVERR IVSQLLTLMD GMKKSSHLIV MAATNRPNSI
360 370 380 390 400
DPALRRFGRF DREIDIGIPD ATGRLEVLRI HTKNMKLHDD VDLEQIAAES
410 420 430 440 450
HGHVGADLAS LCSEAALQQI REKMDLIDLE DDKIDAEVLA SLAVTMENFR
460 470 480 490 500
YAMTKSSPSA LRETVVEVPN TTWTDIGGLE SVKKELQELV QYPVEHPDKF
510 520 530 540 550
LKFGMQPSRG VLFYGPPGCG KTLLAKAIAN ECQANFISVK GPELLTMWFG
560 570 580 590 600
ESEANVRDIF DKARSAAPCV LFFDELDSIA KARGGNVGDA GGAADRVINQ
610 620 630 640 650
ILTEMDGMGA KKNVFIIGAT NRPDIIDPAI LRPGRLDQLI YIPLPDDKSR
660 670 680 690 700
EAILKANLRK SPLAKEVDLT YIAKVTQGFS GADLTEICQR ACKLAIRQAI
710 720 730 740 750
EAEIRREKER AENQNSAMDM DEDDPVPEIT SAHFEEAMKF ARRSVSDNDI
760 770 780 790 800
RKYEMFAQTL QQSRGFGQNF RFPGQTGNTS GSGNNLPVNS PGDNGDDDLY

S
Length:801
Mass (Da):88,859
Last modified:October 3, 2006 - v1
Checksum:iECF8F173B3B10B07
GO
Isoform D (identifier: Q7KN62-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: Missing.

Note: No experimental confirmation available.

Show »
Length:759
Mass (Da):84,250
Checksum:i3C3B83366776697E
GO
Isoform C (identifier: Q7KN62-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-6: MADSKG → MDHDGDTRDFMRGYHSEQDEKMKPKDSFDKR

Note: No experimental confirmation available.

Show »
Length:826
Mass (Da):92,055
Checksum:iB6D5F85ECE7BCA33
GO

Sequence cautioni

The sequence AAF17568.1 differs from that shown. Reason: Frameshift at positions 136, 142, 757 and 761.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti524 – 5241L → P in AAF17568. (PubMed:10656772)Curated
Sequence conflicti563 – 5642AR → GP in AAF17568. (PubMed:10656772)Curated
Sequence conflicti582 – 5843ARG → SRC in AAF17568. (PubMed:10656772)Curated
Sequence conflicti590 – 5912AG → C in AAF17568. (PubMed:10656772)Curated
Sequence conflicti661 – 6622SP → FA in AAF17568. (PubMed:10656772)Curated
Sequence conflicti662 – 6621P → A in AAC27447. (PubMed:9639875)Curated
Sequence conflicti720 – 7201Missing in AAF17568. (PubMed:10656772)Curated
Sequence conflicti735 – 7351E → Q in AAC27447. (PubMed:9639875)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4242Missing in isoform D. CuratedVSP_035052Add
BLAST
Alternative sequencei1 – 66MADSKG → MDHDGDTRDFMRGYHSEQDE KMKPKDSFDKR in isoform C. CuratedVSP_035053

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF047037 mRNA. Translation: AAC27447.1.
AF202034 mRNA. Translation: AAF17568.1. Frameshift.
AE013599 Genomic DNA. Translation: ABV53745.1.
AE013599 Genomic DNA. Translation: ABV53746.1.
AE013599 Genomic DNA. Translation: AAF58863.1.
AF132553 mRNA. Translation: AAD27852.1.
RefSeqiNP_001097249.1. NM_001103779.2. [Q7KN62-3]
NP_001097250.1. NM_001103780.2. [Q7KN62-2]
NP_477369.1. NM_058021.4. [Q7KN62-1]
UniGeneiDm.2968.

Genome annotation databases

EnsemblMetazoaiFBtr0088391; FBpp0087479; FBgn0261014. [Q7KN62-1]
GeneIDi36040.
KEGGidme:Dmel_CG2331.
UCSCiCG2331-RA. d. melanogaster. [Q7KN62-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF047037 mRNA. Translation: AAC27447.1 .
AF202034 mRNA. Translation: AAF17568.1 . Frameshift.
AE013599 Genomic DNA. Translation: ABV53745.1 .
AE013599 Genomic DNA. Translation: ABV53746.1 .
AE013599 Genomic DNA. Translation: AAF58863.1 .
AF132553 mRNA. Translation: AAD27852.1 .
RefSeqi NP_001097249.1. NM_001103779.2. [Q7KN62-3 ]
NP_001097250.1. NM_001103780.2. [Q7KN62-2 ]
NP_477369.1. NM_058021.4. [Q7KN62-1 ]
UniGenei Dm.2968.

3D structure databases

ProteinModelPortali Q7KN62.
SMRi Q7KN62. Positions 14-761.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 61868. 79 interactions.
IntActi Q7KN62. 5 interactions.

Proteomic databases

PaxDbi Q7KN62.
PRIDEi Q7KN62.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

EnsemblMetazoai FBtr0088391 ; FBpp0087479 ; FBgn0261014 . [Q7KN62-1 ]
GeneIDi 36040.
KEGGi dme:Dmel_CG2331.
UCSCi CG2331-RA. d. melanogaster. [Q7KN62-1 ]

Organism-specific databases

CTDi 36040.
FlyBasei FBgn0261014. TER94.

Phylogenomic databases

eggNOGi COG0464.
GeneTreei ENSGT00740000115575.
InParanoidi Q7KN62.
KOi K13525.
OMAi HACADIK.
OrthoDBi EOG7H4DSW.
PhylomeDBi Q7KN62.

Miscellaneous databases

GenomeRNAii 36040.
NextBioi 796507.
PROi Q7KN62.

Gene expression databases

Bgeei Q7KN62.

Family and domain databases

Gene3Di 3.10.330.10. 1 hit.
3.40.50.300. 2 hits.
InterProi IPR003593. AAA+_ATPase.
IPR005938. AAA_ATPase_CDC48.
IPR009010. Asp_de-COase-like_dom.
IPR003959. ATPase_AAA_core.
IPR003960. ATPase_AAA_CS.
IPR004201. Cdc48_dom2.
IPR029067. CDC48_domain_2-like.
IPR003338. CDC4_N-term_subdom.
IPR027417. P-loop_NTPase.
IPR015415. Vps4_C.
[Graphical view ]
Pfami PF00004. AAA. 2 hits.
PF02933. CDC48_2. 1 hit.
PF02359. CDC48_N. 1 hit.
PF09336. Vps4_C. 1 hit.
[Graphical view ]
SMARTi SM00382. AAA. 2 hits.
SM01072. CDC48_2. 1 hit.
SM01073. CDC48_N. 1 hit.
[Graphical view ]
SUPFAMi SSF50692. SSF50692. 1 hit.
SSF52540. SSF52540. 2 hits.
SSF54585. SSF54585. 1 hit.
TIGRFAMsi TIGR01243. CDC48. 1 hit.
PROSITEi PS00674. AAA. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "TER94, a Drosophila homolog of the membrane fusion protein CDC48/p97, is accumulated in nonproliferating cells: in the reproductive organs and in the brain of the imago."
    Pinter M., Jekely G., Szepesi R.J., Farkas A., Theopold U., Meyer H.E., Lindholm D., Nassel D.R., Hultmark D., Friedrich P.
    Insect Biochem. Mol. Biol. 28:91-98(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), PROTEIN SEQUENCE OF 163-176; 214-220; 229-245; 294-308; 456-479; 485-499; 503-520; 563-580; 613-632; 666-687; 694-707 AND 740-748, DEVELOPMENTAL STAGE, TISSUE SPECIFICITY.
    Strain: Canton-S.
  2. "Membrane fusion proteins are required for oskar mRNA localization in the Drosophila egg chamber."
    Ruden D.M., Sollars V., Wang X., Mori D., Alterman M., Lu X.
    Dev. Biol. 218:314-325(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), TISSUE SPECIFICITY, MUTAGENESIS OF GLU-437.
  3. "The genome sequence of Drosophila melanogaster."
    Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D.
    , Zhang Q., Chen L.X., Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M., Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J., Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.
    Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: Berkeley.
  4. Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING.
    Strain: Berkeley.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A).
    Strain: Berkeley.
    Tissue: Ovary.
  6. "Identification of TER94, an AAA ATPase protein, as a Bam-dependent component of the Drosophila fusome."
    Leon A., McKearin D.
    Mol. Biol. Cell 10:3825-3834(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, SUBUNIT, SUBCELLULAR LOCATION.
  7. "RNA interference of valosin-containing protein (VCP/p97) reveals multiple cellular roles linked to ubiquitin/proteasome-dependent proteolysis."
    Wojcik C., Yano M., DeMartino G.N.
    J. Cell Sci. 117:281-292(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  8. "An integrated chemical, mass spectrometric and computational strategy for (quantitative) phosphoproteomics: application to Drosophila melanogaster Kc167 cells."
    Bodenmiller B., Mueller L.N., Pedrioli P.G.A., Pflieger D., Juenger M.A., Eng J.K., Aebersold R., Tao W.A.
    Mol. Biosyst. 3:275-286(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-716, IDENTIFICATION BY MASS SPECTROMETRY.
  9. "Isolation of new polar granule components in Drosophila reveals P body and ER associated proteins."
    Thomson T., Liu N., Arkov A., Lehmann R., Lasko P.
    Mech. Dev. 125:865-873(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH TUD AND VAS, SUBCELLULAR LOCATION.
  10. "PAPI, a novel TUDOR-domain protein, complexes with AGO3, ME31B and TRAL in the nuage to silence transposition."
    Liu L., Qi H., Wang J., Lin H.
    Development 138:1863-1873(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH PAPI AND AGO3.

Entry informationi

Entry nameiTERA_DROME
AccessioniPrimary (citable) accession number: Q7KN62
Secondary accession number(s): A8DY85
, A8DY86, O76279, Q9U463
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: October 3, 2006
Last modified: October 29, 2014
This is version 92 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3