Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transitional endoplasmic reticulum ATPase TER94

Gene

TER94

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Necessary for the fragmentation of Golgi stacks during mitosis and for their reassembly after mitosis. Involved in the formation of the transitional endoplasmic reticulum (tER). The transfer of membranes from the endoplasmic reticulum to the Golgi apparatus occurs via 50-70 nm transition vesicles which derive from part-rough, part-smooth transitional elements of the endoplasmic reticulum (tER). Vesicle budding from the tER is an ATP-dependent process. Involved in the ubiquitin-proteasome system. Important for oskar mRNA localization and/or anchoring during oogenesis. Involved in germ cell formation.2 Publications

Catalytic activityi

ATP + H2O = ADP + phosphate.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei345ATPBy similarity1
Binding sitei381ATPBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi244 – 250ATPBy similarity7
Nucleotide bindingi518 – 523ATPBy similarity6

GO - Molecular functioni

GO - Biological processi

  • autophagosome maturation Source: FlyBase
  • cellular response to virus Source: FlyBase
  • dendrite morphogenesis Source: FlyBase
  • endoplasmic reticulum membrane fusion Source: FlyBase
  • endoplasmic reticulum organization Source: FlyBase
  • Golgi organization Source: FlyBase
  • lysosome organization Source: FlyBase
  • microtubule cytoskeleton organization Source: FlyBase
  • muscle cell cellular homeostasis Source: FlyBase
  • oogenesis Source: UniProtKB-KW
  • pole cell formation Source: FlyBase
  • positive regulation of neuron apoptotic process Source: FlyBase
  • positive regulation of proteasomal ubiquitin-dependent protein catabolic process Source: FlyBase
  • positive regulation of viral entry into host cell Source: FlyBase
  • proteolysis Source: FlyBase
  • regulation of neuron apoptotic process Source: FlyBase
  • regulation of pole plasm oskar mRNA localization Source: FlyBase
  • transport Source: UniProtKB-KW
  • ubiquitin-dependent protein catabolic process Source: FlyBase
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Hydrolase

Keywords - Biological processi

Differentiation, Oogenesis, Transport, Ubl conjugation pathway

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-DME-110320. Translesion Synthesis by POLH.
R-DME-532668. N-glycan trimming in the ER and Calnexin/Calreticulin cycle.
R-DME-5358346. Hedgehog ligand biogenesis.
R-DME-5689896. Ovarian tumor domain proteases.
R-DME-6798695. Neutrophil degranulation.

Names & Taxonomyi

Protein namesi
Recommended name:
Transitional endoplasmic reticulum ATPase TER94 (EC:3.6.4.6)
Alternative name(s):
Valosin-containing protein homolog
Gene namesi
Name:TER94
Synonyms:VCP
ORF Names:CG2331
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome 2R

Organism-specific databases

FlyBaseiFBgn0261014. TER94.

Subcellular locationi

  • Cytoplasm 1 Publication
  • Nucleus 1 Publication

  • Note: Component of the meiotic nuage, also named P granule, a germ-cell-specific organelle required to repress transposon activity during meiosis (PubMed:18590813).1 Publication

GO - Cellular componenti

  • autolysosome Source: FlyBase
  • cytoplasm Source: FlyBase
  • fusome Source: FlyBase
  • lipid particle Source: FlyBase
  • microtubule associated complex Source: FlyBase
  • nuclear membrane Source: FlyBase
  • nucleus Source: FlyBase
  • P granule Source: FlyBase
  • plasma membrane Source: FlyBase
  • proteasome complex Source: FlyBase
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi437E → A in ter94-26-8; arrests early in oogenesis. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003471781 – 801Transitional endoplasmic reticulum ATPase TER94Add BLAST801

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei716Phosphoserine1 Publication1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ7KN62.
PRIDEiQ7KN62.

PTM databases

iPTMnetiQ7KN62.

Expressioni

Tissue specificityi

Present in the mushroom bodies of the protocerebrum and in the glomeruli of the antennal lobe. Present in nurse cells, oocytes and sperm bundles (at protein level).3 Publications

Developmental stagei

Present in egg, pupa and imago but not larva (at protein level).1 Publication

Gene expression databases

BgeeiFBgn0261014.
ExpressionAtlasiQ7KN62. baseline.
GenevisibleiQ7KN62. DM.

Interactioni

Subunit structurei

Homohexamer. Interacts with tud, vas, papi and AGO3.3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Ptp52FA1ZAB35EBI-224053,EBI-3410206

Protein-protein interaction databases

BioGridi61868. 80 interactors.
DIPiDIP-52184N.
IntActiQ7KN62. 6 interactors.
STRINGi7227.FBpp0111818.

Structurei

Secondary structure

1801
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi22 – 27Combined sources6
Beta strandi35 – 38Combined sources4
Helixi40 – 46Combined sources7
Beta strandi53 – 57Combined sources5
Beta strandi63 – 70Combined sources8
Beta strandi78 – 81Combined sources4
Helixi83 – 88Combined sources6
Beta strandi96 – 101Combined sources6
Beta strandi109 – 115Combined sources7
Helixi127 – 130Combined sources4
Helixi132 – 136Combined sources5
Turni137 – 139Combined sources3
Beta strandi142 – 144Combined sources3
Beta strandi148 – 153Combined sources6
Beta strandi156 – 172Combined sources17
Beta strandi178 – 180Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4RV0X-ray2.00A/C/E/G20-186[»]
ProteinModelPortaliQ7KN62.
SMRiQ7KN62.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the AAA ATPase family.Curated

Phylogenomic databases

eggNOGiKOG0730. Eukaryota.
COG0464. LUCA.
GeneTreeiENSGT00860000133780.
InParanoidiQ7KN62.
KOiK13525.
OMAiICIILND.
OrthoDBiEOG091G024K.
PhylomeDBiQ7KN62.

Family and domain databases

Gene3Di3.10.330.10. 1 hit.
3.40.50.300. 2 hits.
InterProiIPR003593. AAA+_ATPase.
IPR005938. AAA_ATPase_CDC48.
IPR009010. Asp_de-COase-like_dom.
IPR003959. ATPase_AAA_core.
IPR003960. ATPase_AAA_CS.
IPR004201. Cdc48_dom2.
IPR029067. CDC48_domain_2-like.
IPR003338. CDC4_N-term_subdom.
IPR027417. P-loop_NTPase.
IPR015415. Vps4_C.
[Graphical view]
PfamiPF00004. AAA. 2 hits.
PF02933. CDC48_2. 1 hit.
PF02359. CDC48_N. 1 hit.
PF09336. Vps4_C. 1 hit.
[Graphical view]
SMARTiSM00382. AAA. 2 hits.
SM01072. CDC48_2. 1 hit.
SM01073. CDC48_N. 1 hit.
[Graphical view]
SUPFAMiSSF50692. SSF50692. 1 hit.
SSF52540. SSF52540. 2 hits.
SSF54585. SSF54585. 1 hit.
TIGRFAMsiTIGR01243. CDC48. 1 hit.
PROSITEiPS00674. AAA. 2 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform A (identifier: Q7KN62-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MADSKGEDLA TAILKRKDRP NRLIVEEAQN DDNSVVSLSQ AKMDELQLFR
60 70 80 90 100
GDTVILKGKR RKETVCIVLS DDTCPDEKIR MNRVVRNNLC VHLSDVVSVQ
110 120 130 140 150
SCPDVKYGKR VRILPIDEST EGVTGNLFEI YLKPYFLEAY RPIHMGDNFI
160 170 180 190 200
VRAAMRPIEF KVVLTDPEPY CIVAPETVIF CDGDPIKREE EEESLNAVGY
210 220 230 240 250
DDIGGCRKQL AQIKEMVELP LRHPSLFKAI GVKPPRGILM YGPPGTGKTL
260 270 280 290 300
IARAVANETG AFFFLINGPE IMSKLAGESE SNLRKAFEEA EKNSPAIIFI
310 320 330 340 350
DEIDAIAPKR DKTHGEVERR IVSQLLTLMD GMKKSSHLIV MAATNRPNSI
360 370 380 390 400
DPALRRFGRF DREIDIGIPD ATGRLEVLRI HTKNMKLHDD VDLEQIAAES
410 420 430 440 450
HGHVGADLAS LCSEAALQQI REKMDLIDLE DDKIDAEVLA SLAVTMENFR
460 470 480 490 500
YAMTKSSPSA LRETVVEVPN TTWTDIGGLE SVKKELQELV QYPVEHPDKF
510 520 530 540 550
LKFGMQPSRG VLFYGPPGCG KTLLAKAIAN ECQANFISVK GPELLTMWFG
560 570 580 590 600
ESEANVRDIF DKARSAAPCV LFFDELDSIA KARGGNVGDA GGAADRVINQ
610 620 630 640 650
ILTEMDGMGA KKNVFIIGAT NRPDIIDPAI LRPGRLDQLI YIPLPDDKSR
660 670 680 690 700
EAILKANLRK SPLAKEVDLT YIAKVTQGFS GADLTEICQR ACKLAIRQAI
710 720 730 740 750
EAEIRREKER AENQNSAMDM DEDDPVPEIT SAHFEEAMKF ARRSVSDNDI
760 770 780 790 800
RKYEMFAQTL QQSRGFGQNF RFPGQTGNTS GSGNNLPVNS PGDNGDDDLY

S
Length:801
Mass (Da):88,859
Last modified:October 3, 2006 - v1
Checksum:iECF8F173B3B10B07
GO
Isoform D (identifier: Q7KN62-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: Missing.

Note: No experimental confirmation available.
Show »
Length:759
Mass (Da):84,250
Checksum:i3C3B83366776697E
GO
Isoform C (identifier: Q7KN62-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-6: MADSKG → MDHDGDTRDFMRGYHSEQDEKMKPKDSFDKR

Note: No experimental confirmation available.
Show »
Length:826
Mass (Da):92,055
Checksum:iB6D5F85ECE7BCA33
GO

Sequence cautioni

The sequence AAF17568 differs from that shown. Reason: Frameshift at positions 136, 142, 757 and 761.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti524L → P in AAF17568 (PubMed:10656772).Curated1
Sequence conflicti563 – 564AR → GP in AAF17568 (PubMed:10656772).Curated2
Sequence conflicti582 – 584ARG → SRC in AAF17568 (PubMed:10656772).Curated3
Sequence conflicti590 – 591AG → C in AAF17568 (PubMed:10656772).Curated2
Sequence conflicti661 – 662SP → FA in AAF17568 (PubMed:10656772).Curated2
Sequence conflicti662P → A in AAC27447 (PubMed:9639875).Curated1
Sequence conflicti720Missing in AAF17568 (PubMed:10656772).Curated1
Sequence conflicti735E → Q in AAC27447 (PubMed:9639875).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0350521 – 42Missing in isoform D. CuratedAdd BLAST42
Alternative sequenceiVSP_0350531 – 6MADSKG → MDHDGDTRDFMRGYHSEQDE KMKPKDSFDKR in isoform C. Curated6

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF047037 mRNA. Translation: AAC27447.1.
AF202034 mRNA. Translation: AAF17568.1. Frameshift.
AE013599 Genomic DNA. Translation: ABV53745.1.
AE013599 Genomic DNA. Translation: ABV53746.1.
AE013599 Genomic DNA. Translation: AAF58863.1.
AF132553 mRNA. Translation: AAD27852.1.
RefSeqiNP_001097249.1. NM_001103779.2. [Q7KN62-3]
NP_001097250.1. NM_001103780.2. [Q7KN62-2]
NP_477369.1. NM_058021.4. [Q7KN62-1]
UniGeneiDm.2968.

Genome annotation databases

EnsemblMetazoaiFBtr0088391; FBpp0087479; FBgn0261014. [Q7KN62-1]
GeneIDi36040.
KEGGidme:Dmel_CG2331.
UCSCiCG2331-RA. d. melanogaster. [Q7KN62-1]
CG2331-RC. d. melanogaster.
CG2331-RD. d. melanogaster.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF047037 mRNA. Translation: AAC27447.1.
AF202034 mRNA. Translation: AAF17568.1. Frameshift.
AE013599 Genomic DNA. Translation: ABV53745.1.
AE013599 Genomic DNA. Translation: ABV53746.1.
AE013599 Genomic DNA. Translation: AAF58863.1.
AF132553 mRNA. Translation: AAD27852.1.
RefSeqiNP_001097249.1. NM_001103779.2. [Q7KN62-3]
NP_001097250.1. NM_001103780.2. [Q7KN62-2]
NP_477369.1. NM_058021.4. [Q7KN62-1]
UniGeneiDm.2968.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4RV0X-ray2.00A/C/E/G20-186[»]
ProteinModelPortaliQ7KN62.
SMRiQ7KN62.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi61868. 80 interactors.
DIPiDIP-52184N.
IntActiQ7KN62. 6 interactors.
STRINGi7227.FBpp0111818.

PTM databases

iPTMnetiQ7KN62.

Proteomic databases

PaxDbiQ7KN62.
PRIDEiQ7KN62.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiFBtr0088391; FBpp0087479; FBgn0261014. [Q7KN62-1]
GeneIDi36040.
KEGGidme:Dmel_CG2331.
UCSCiCG2331-RA. d. melanogaster. [Q7KN62-1]
CG2331-RC. d. melanogaster.
CG2331-RD. d. melanogaster.

Organism-specific databases

CTDi36040.
FlyBaseiFBgn0261014. TER94.

Phylogenomic databases

eggNOGiKOG0730. Eukaryota.
COG0464. LUCA.
GeneTreeiENSGT00860000133780.
InParanoidiQ7KN62.
KOiK13525.
OMAiICIILND.
OrthoDBiEOG091G024K.
PhylomeDBiQ7KN62.

Enzyme and pathway databases

ReactomeiR-DME-110320. Translesion Synthesis by POLH.
R-DME-532668. N-glycan trimming in the ER and Calnexin/Calreticulin cycle.
R-DME-5358346. Hedgehog ligand biogenesis.
R-DME-5689896. Ovarian tumor domain proteases.
R-DME-6798695. Neutrophil degranulation.

Miscellaneous databases

GenomeRNAii36040.
PROiQ7KN62.

Gene expression databases

BgeeiFBgn0261014.
ExpressionAtlasiQ7KN62. baseline.
GenevisibleiQ7KN62. DM.

Family and domain databases

Gene3Di3.10.330.10. 1 hit.
3.40.50.300. 2 hits.
InterProiIPR003593. AAA+_ATPase.
IPR005938. AAA_ATPase_CDC48.
IPR009010. Asp_de-COase-like_dom.
IPR003959. ATPase_AAA_core.
IPR003960. ATPase_AAA_CS.
IPR004201. Cdc48_dom2.
IPR029067. CDC48_domain_2-like.
IPR003338. CDC4_N-term_subdom.
IPR027417. P-loop_NTPase.
IPR015415. Vps4_C.
[Graphical view]
PfamiPF00004. AAA. 2 hits.
PF02933. CDC48_2. 1 hit.
PF02359. CDC48_N. 1 hit.
PF09336. Vps4_C. 1 hit.
[Graphical view]
SMARTiSM00382. AAA. 2 hits.
SM01072. CDC48_2. 1 hit.
SM01073. CDC48_N. 1 hit.
[Graphical view]
SUPFAMiSSF50692. SSF50692. 1 hit.
SSF52540. SSF52540. 2 hits.
SSF54585. SSF54585. 1 hit.
TIGRFAMsiTIGR01243. CDC48. 1 hit.
PROSITEiPS00674. AAA. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTERA_DROME
AccessioniPrimary (citable) accession number: Q7KN62
Secondary accession number(s): A8DY85
, A8DY86, O76279, Q9U463
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: October 3, 2006
Last modified: November 30, 2016
This is version 115 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.