Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Proteasomal ubiquitin receptor ADRM1 homolog

Gene

Rpn13

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May function as a proteasomal ubiquitin receptor. May promote the deubiquitinating activity associated with the 26S proteasome (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

  • lateral inhibition Source: FlyBase
  • proteasome assembly Source: UniProtKB
  • proteasome-mediated ubiquitin-dependent protein catabolic process Source: FlyBase
  • ubiquitin-dependent protein catabolic process Source: FlyBase

Enzyme and pathway databases

ReactomeiR-DME-5689603. UCH proteinases.
R-DME-5689880. Ub-specific processing proteases.

Names & Taxonomyi

Protein namesi
Recommended name:
Proteasomal ubiquitin receptor ADRM1 homolog
Alternative name(s):
Regulatory particle non-ATPase 13 protein
p42E
Gene namesi
Name:Rpn13
ORF Names:CG13349
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome 2R

Organism-specific databases

FlyBaseiFBgn0033886. Rpn13.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus, Proteasome

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002860751 – 389Proteasomal ubiquitin receptor ADRM1 homologAdd BLAST389

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei6Phosphoserine2 Publications1
Modified residuei185Phosphoserine1 Publication1
Modified residuei196Phosphothreonine1 Publication1
Modified residuei205Phosphothreonine1 Publication1
Modified residuei207Phosphoserine1 Publication1
Modified residuei217Phosphoserine2 Publications1
Modified residuei218Phosphoserine1 Publication1
Modified residuei219Phosphoserine2 Publications1
Modified residuei367Phosphothreonine1 Publication1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PRIDEiQ7K2G1.

PTM databases

iPTMnetiQ7K2G1.

Expressioni

Developmental stagei

In larvae, expressed in the central nervous system.1 Publication

Gene expression databases

BgeeiFBgn0033886.
ExpressionAtlasiQ7K2G1. differential.
GenevisibleiQ7K2G1. DM.

Interactioni

Subunit structurei

Interacts with the 26S proteasome.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
CG15262-RAQ9V3I93EBI-88589,EBI-115777

GO - Molecular functioni

Protein-protein interaction databases

BioGridi62299. 45 interactors.
IntActiQ7K2G1. 15 interactors.

Structurei

3D structure databases

ProteinModelPortaliQ7K2G1.
SMRiQ7K2G1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini16 – 124PHAdd BLAST109

Domaini

The PH domain mediates interactions with PSMD1 and ubiquitin. Preferential binding to the proximal subunit of K48-linked diubiquitin allows UCHL5 access to the distal subunit (By similarity).By similarity

Sequence similaritiesi

Belongs to the ADRM1 family.Curated

Phylogenomic databases

GeneTreeiENSGT00390000013839.
InParanoidiQ7K2G1.
KOiK06691.
OMAiGKMVHPD.
OrthoDBiEOG091G0FEO.

Family and domain databases

InterProiView protein in InterPro
IPR006773. 26S_Psome_Ubiquitin-recp_Rpn13.
IPR032368. RPN13_C.
PANTHERiPTHR12225. PTHR12225. 1 hit.
PfamiView protein in Pfam
PF04683. Proteasom_Rpn13. 1 hit.
PF16550. RPN13_C. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7K2G1-1) [UniParc]FASTAAdd to basket
Also known as: A, B, F

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFGRQSGLGS SSNSSNLVEF RAGRMNMVGK MVHPDPRKGL VYMTQSDDGL
60 70 80 90 100
MHFCWKDRTS GKVEDDLIVF PDDFEYKRVD QCKTGRVYVL KFKSSTRRMF
110 120 130 140 150
FWMQEPKTDK DDEQCRRINE LLNNPPSAHQ RGGGGSNDGD LQYMLNNMSQ
160 170 180 190 200
QQLMQLFGGV GQMGGLSSLL GQMNSRTPSS RNTSSSGGGG ASALQTPENV
210 220 230 240 250
SVPRTPSAPS KSGSSRSSSN VNSQVGEGAG SSVDADAPGR SLNIDLSTAL
260 270 280 290 300
PGADAINQII ADPEHVKTLI VHLPESEDVD DDRKQQIKDN ITSPQFQQAL
310 320 330 340 350
AQFSSALQSA QLGPVIKQFE LSNEAVAAAF SGNLEDFVRA LEKSLPPGAT
360 370 380
MGGKPSASEK KASDPETPTS VARDENTDPA TEKQEEKQK
Length:389
Mass (Da):42,013
Last modified:October 3, 2006 - v1
Checksum:i260F2383BF6C7BFF
GO
Isoform 2 (identifier: Q7K2G1-2) [UniParc]FASTAAdd to basket
Also known as: D, E

The sequence of this isoform differs from the canonical sequence as follows:
     238-238: P → PGKNSTTSTTTASKSTGAYANPFQAYLSNLSPEHGA

Show »
Length:424
Mass (Da):45,555
Checksum:iC3744B91B17150C5
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_024972238P → PGKNSTTSTTTASKSTGAYA NPFQAYLSNLSPEHGA in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AE013599 Genomic DNA. Translation: AAF58312.1.
AE013599 Genomic DNA. Translation: AAG22269.1.
AE013599 Genomic DNA. Translation: ACL83116.1.
AE013599 Genomic DNA. Translation: ACL83117.1.
AE013599 Genomic DNA. Translation: ACL83118.1.
AY061027 mRNA. Translation: AAL28575.1.
BT003652 mRNA. Translation: AAO39656.1.
RefSeqiNP_001137662.1. NM_001144190.2. [Q7K2G1-2]
NP_001137663.1. NM_001144191.2. [Q7K2G1-2]
NP_001137664.1. NM_001144192.2. [Q7K2G1-1]
NP_001286397.1. NM_001299468.1. [Q7K2G1-2]
NP_610917.1. NM_137073.3. [Q7K2G1-1]
NP_725346.1. NM_166025.2. [Q7K2G1-1]
UniGeneiDm.19534.

Genome annotation databases

EnsemblMetazoaiFBtr0087610; FBpp0086736; FBgn0033886. [Q7K2G1-1]
FBtr0087611; FBpp0086737; FBgn0033886. [Q7K2G1-1]
FBtr0114493; FBpp0112985; FBgn0033886. [Q7K2G1-2]
FBtr0114494; FBpp0112986; FBgn0033886. [Q7K2G1-2]
FBtr0114495; FBpp0112987; FBgn0033886. [Q7K2G1-1]
FBtr0339958; FBpp0308980; FBgn0033886. [Q7K2G1-2]
GeneIDi36545.
KEGGidme:Dmel_CG13349.

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiADRM1_DROME
AccessioniPrimary (citable) accession number: Q7K2G1
Secondary accession number(s): B7YZG7, B7YZG8, Q86NT4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 2007
Last sequence update: October 3, 2006
Last modified: September 27, 2017
This is version 96 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families